Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF12913.7; Q3A1R0_PELCD/145-197; SH3 domain (SH3b1 type), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst PAFYAFSQPGEGFPFDYLQYSSIPASTPVRVRHRSADGCWVLVETEAMFGWLPLast
1 -39.100PF12913.7; Q3A1R0_PELCD/145-197; SH3 domain (SH3b1 type)  ali  100  1PAFYAFSQPGEGFPFDYLQYSSIPASTPVRVRHRSADGCWVLVETEAMFGWLP 53
2 -9.850PF14603.6; G3PZ17_GASAC/300-388; Helically-extended SH3 domain  ali follow..  14  31..................KELPVKAGEQLDVIVKAEDNKLICRNEDGKFGYVS 65
3 -8.420PF18348.1; A0A0F7PNC2_9RHIZ/45-93; Bacterial dipeptidyl-peptidase Sh3 domain  ali follow..  20  11..................MDTEALLGETLTVFDRSGGWAWVKLAADGYVGYLR 45
4 -8.310PF17902.1; V4A6K8_LOTGI/692-756; SH3 domain  ali follow..  5  24..................GDITLNKNDECFLMDNTQKQKWKIKTLSGSETIIP 58
5 -7.870PF08239.11; E9IE92_SOLIN/305-375; Bacterial SH3 domain  ali follow..  11  9..........SKPSLKGAPIGMLALGNTVTVQEYNHEGTWVRIDDDSVAKYC. 52
6 -7.820PF03400.13; Q32H87_SHIDS/20-150; IS1 transposase  ali follow..  21  1.............................VIVCAEMDEQWGYVGAKSRQRWL. 23
7 -7.450PF01578.20; CCSA_GUITH/70-295; Cytochrome C assembly protein  ali follow..  23  133..............LDNLSYRTIGFGFPLLTIGIIAGAVWANEAWGTYWSWDP 171
8 -7.390PF14627.6; V9VTX6_9RHOB/79-185; Domain of unknown function (DUF4453 topsan)  ali follow..  26  47..........AGHRPEAPLVGQIVAGDYVSYSHIPVGS-WTYVTTSGSGGWL. 93
9 -7.260PF15108.6; G3H5D6_CRIGR/36-218; Voltage-dependent calcium channel gamma-like subunit protein family  ali follow..  27  9.......KRPHRSFFESFIRTLIIVCTALAVVLSSVDGHWLLVEDRLFGLW.. 55
10 -6.490PF14836.6; GGNB1_MOUSE/281-368; Ubiquitin-like domain  ali follow..  12  63................TLEEAGMVDGQHLLLEEMDEMGNW............. 86
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;