current user: public

If you have questions about the server, please let us know.

Query: PF12953.7; F6B8R9_DESCC/2-131; Domain of unknown function (DUF3842 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst RVAVIDGQGGGIGKAIVDKFRQAFGEEIEIIALGTNALATSLMLKSGANEGASGENAIVFNASRVDVILGTIGIITANSMLGELTPMMAKAIAESPAKKILIPLNRCNIEVAGIKNVPLPHYIDDAIELVLast
1 -72.600PF12953.7; F6B8R9_DESCC/2-131; Domain of unknown function (DUF3842 topsan)  ali  100  1RVAVIDGQGGGIGKAIVDKFRQAFGEEIEIIALGTNALATSLMLKSGANEGASGENAIVFNASRVDVILGTIGIITANSMLGELTPMMAKAIAESPAKKILIPLNRCNIEVAGIKNVPLPHYIDDAIELV 130
2 -7.460PF01073.19; O22813_ARATH/15-299; 3-beta hydroxysteroid dehydrogenase/isomerase family  ali follow..  13  1...VVTGGLGFVGAALCLELVRRGARQVRSFDLRHSSPWSDDLKNSGVR-DVTKKQDVDNALDGADCVLHLASYGMSGKEMLR-TCNVLEAAFKHEITRIVY............................ 112
3 -6.990PF08084.11; I1BJI8_RHIO9/2229-2348; PROCT (NUC072) domain  ali follow..  15  10.................................GSCSLTAYKLSPAGFEWGKTNVDPGSQPQGYLPTHGEKVQILLSDRFLG-----------------FMVPSDVWNYNFMGAQ............... 75
4 -6.890PF13460.6; G2TRC2_BACCO/7-191; NAD(P)H-binding  ali follow..  17  1......GANGKIGKILVDLLQKS---DRHIRAMVRKEEQAQFFRQKGVDADLEGTDELAEAAKGCDIVFTAGS---GGHTDKTLAVKTMEAAEKAGISRFMI............................ 93
5 -6.570PF12237.8; B4KYG7_DROMO/518-691; Phosphorylated CTD interacting factor 1 WW domain  ali follow..  12  45.....ELTQAALPVPVFECLHRHFGVSFECFASPFNSYFRSAFADTDAYFGSRGPFLDFKPVSGSFQVNPPHCEELMDACLLHIDKLLTDSMEPLSFI-VFLP........................... 144
6 -6.490PF07067.11; O34054_BPO12/1-236; Protein of unknown function (DUF1340 topsan)  ali follow..  15  103...DSDKTNAGLTEELFLQYRNEIQ---ELRAAHPNCFANYIMEVKGCSQAKTICTAINTIYTEIGILTPRKVVQLEGLLSRELFGKIAKHVFNSEVDRIYLEYRTKG---LGLEKESVKRALYKAIYM. 234
7 -6.050PF12601.8; POLN_RUBVT/1275-1340; Rubivirus non-structural protein  ali follow..  28  19.LAVPLSRGGGTCAATDEGLAQAYYDDLEVRRLGDDAMARAALASV.................................................................................... 63
8 -5.960PF12147.8; Q2K5I6_RHIEC/285-593; Putative methyltransferase  ali follow..  12  134STHLLD--AAGHGRYVLDAIEAAGVRPDSARLQDYSDAGRNSIARRGLNDFVSFHQQDAFDGEGLAAITPAPDLAIVSGLYELFSDNAMIAASLSGIARAMQP........................... 239
9 -5.920PF00106.25; YOXD_BACSU/7-201; short chain dehydrogenase  ali follow..  21  1KTALITGGGRGIGRATALALAKE---GVNIGLIGRTSANVEKVAEEVKALGVKDADQVNQAVAQVKEQLGDIDILINNA................................................... 85
10 -5.920PF03435.18; Q94BZ0_ARATH/41-165; Saccharopine dehydrogenase NADP binding domain  ali follow..  15  1..VLVLGGTGRVGGSTATALSKL-CPELKIVVGGRNREKGEAMVAK-SQVDINDAKMLETSLRDVDLVVHAAG......................................................... 76

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24