current user: public

If you have questions about the server, please let us know.

Query: PF13145.6; F8BSA4_OLICO/251-370; PPIC-type PPIASE domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst VSDEDARKVYDSRRDEYATPAKREVLQIAFPSEDAAKTAREKIAGGTSFEDLAKEMKLTPGDINLGLTSEASLGDPTIAKAAFALPLNEVSQPVKGALATVLLKITKIEPGSQSTYESVALast
1 -77.500PF13145.6; F8BSA4_OLICO/251-370; PPIC-type PPIASE domain  ali  100  1VSDEDARKVYDSRRDEYATPAKREVLQIAFPSEDAAKTAREKIAGGTSFEDLAKEMKLTPGDINLGLTSEASLGDPTIAKAAFALPLNEVSQPVKGALATVLLKITKIEPGSQSTYESVA 120
2 -38.200PF00639.21; A3U4W5_CROAH/236-330; PPIC-type PPIASE domain  ali follow..  20  1..........................HIMVNPKDRIEELYLKVKQGEDFGVLAKQFSDDRNEGKLDRFGSGKLNSEVFEKKAFSLKAGQVTEPFETQYGWHIIKLID............. 95
3 -37.200PF13616.6; A6H2B0_FLAPJ/336-455; PPIC-type PPIASE domain  ali follow..  12  1........YGITKNLGRKVNANAKASHILIQAKAKAVSLLAQVLANSAFQMLAYTNSDDSSGGDLGYFSQGQMV-KPFNNFVFSNPVGKIG-LVETDFGFHIINVTDKQ........... 120
4 -5.760PF16842.5; D4B4V5_ARTBC/1406-1484; Occluded RNA-recognition motif  ali follow..  15  13VNDTRIRALAEPVLVKINLRPDHQGAIIEYADTHDAGKASLALEG........................................................................... 59
5 -5.660PF08649.10; M1W1S7_CLAP2/16-70; DASH complex subunit Dad1  ali follow..  10  1........YFELQREAIISDIALSFEHVLGNINKLNRSLEEVIKMGNDFSSVEA.................................................................. 46
6 -5.410PF13624.6; Q3A5Q7_PELCD/1-168; SurA N-terminal domain  ali follow..  15  55ISYQDFQITYQNMRQEMEKRFGRSLPPEIEKQLQLNTQAYEQLVNRLLLLQEADNRDIAVDKDEL....................................................... 119
7 -5.330PF10975.8; M4U8S9_9GAMM/62-129; Protein of unknown function (DUF2802 topsan)  ali follow..  22  28..............................PENRLYTRATKMVELGASIDELMQECELPRAEAEL....................................................... 62
8 -5.220PF05947.12; C5AMW3_BURGB/4-613; Type VI secretion system, TssF  ali follow..  1.ATVTLSDCFREELAQFSEKHRELARTLGLNAREASDPQVELLLQSFAFLAARLRHQVELD--------------ARLPNTLLSFLYPHLEAPIPS........................ 89
9 -5.210PF07240.11; TOTA_DROME/41-117; Stress-inducible humoral factor Turandot  ali follow..  12  12...QELLDIYRRLYPSLTPEERESIDKFVNEHTDAIIIDGVPIQGGRKARIVGKIVSPGVKGLATGFFE................................................... 77
10 -5.200PF18349.1; O67434_AQUAE/167-259; PAZ domain  ali follow..  15  1...ETLQTLLERN-----NPKRIRVKPIGIDFVGRVQDVFKAKEKGEEFFRLCMERSTHKSSKKA----EELLKNRELREKAFLV................................... 76

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.