current user: public

If you have questions about the server, please let us know.

Query: PF13241.6; Q2FTK6_METHJ/4-113; Putative NAD(P)-binding, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst LMIDFTGKKVIIFGGGVIGARKARYFAYEADVLVYSRSFHPEFQEIPVRTEVCNLTGDLEILRNMIHDASLVIAATSDPELNELIESACAREHIWCNVAAGKRGDVVLPALast
1 -63.700PF13241.6; Q2FTK6_METHJ/4-113; Putative NAD(P)-binding  ali  100  1LMIDFTGKKVIIFGGGVIGARKARYFAYEADVLVYSRSFHPEFQEIPVRTEVCNLTGDLEILRNMIHDASLVIAATSDPELNELIESACAREHIWCNVAAGKRGDVVLPA 110
2 -13.000PF00670.21; SAHH_DICDI/191-351; S-adenosyl-L-homocysteine hydrolase, NAD binding domain  ali follow..  15  19..VMIAGKVAVVAGYGDVGKGCAQSLSKGARVLVTEIDPINALQACMDGYQIV------TMETAAPLSNIFVTTTGCRDIVRGEHFAVMKEDAIVCNIGHFD........ 113
3 -10.400PF01488.20; HEM1_PSEAE/169-304; Shikimate / quinate 5-dehydrogenase  ali follow..  11  6IFSDLHRSQALLIGAGETITLVARLFEQGVKRIVVANRTLERASLLAEQ--FGAHAVLLSEIPEELANSDIVISSTASQLVERALKQRKHKPMFMVDIAVPRDIE..... 116
4 -9.950PF06690.11; D7DUD4_METV3/2-259; Protein of unknown function (DUF1188 topsan)  ali follow..  13  38...GEEFEQAIIFGAYLSGNYIANTLADCGEVILI--DSQPHLEDIVTGNGIKFMDLNTFNNKDKEINPDLIIDVTGLGGVDPNMLKDFDPKVLIIEDPKSSFDKELMEA 148
5 -9.710PF05221.17; D9SB20_FIBSS/15-498; S-adenosyl-L-homocysteine hydrolase  ali follow..  16  254....MAGKIAVVCGYGDVGKGCAQSLRGGARVIITEIDPICALQAAMEGYEVKTLDEVVS------YADIFVTTTGNTGIISAAQMEKMKNRAIVGNIGHFD........ 346
6 -9.400PF02826.19; Q98GE4_RHILO/107-283; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain  ali follow..  19  34..IELAGKTIGIVGLGAVGQAVGHIAAHGFDLKVVATTRSMQ----PAPEKVGFLSIDALVEQSDIIVLCCPLTPETRGLISRERIARMKPNALLINVSRGPVVD..... 132
7 -8.750PF03059.16; A3DUI9_MALBX/3-277; Nicotianamine synthase protein  ali follow..  10  118.....MPIKIAFVGSGPLPLTSIVLASHLTKTSFDNYDINASANSKALGKRMVFHTTDIMDVTTALKDYEIVFLAAEKLKIIDHLAKYMAPGATLMLRSAHGARAFLYPV 239
8 -8.720PF07991.12; ILVC_METAC/15-178; Acetohydroxy acid isomeroreductase, NADPH-binding domain  ali follow..  13  1....LKDKTIAIMGYGSQGHAHARNLHESGLNVVVGLRKGSSSWAKAESDGLKVMTVEEAAKAADV----IMILLPDEKQASV........................... 75
9 -8.640PF01262.21; Q9S227_STRCO/141-353; Alanine dehydrogenase/PNT, C-terminal domain  ali follow..  16  25...GVLAGRAVVIGGGVSGWNAAQIAIGGFHVTLLDKDITKREADKIFGTKIQTVVSNAFELEKACLEADLVIGAVAPKLVTNELVSRMKPGSVLVDIAIDQGGCF.... 135
10 -8.600PF01564.17; SPEE_SCHPO/71-256; Spermine/spermidine synthase domain  ali follow..  24  13LNSHPNPKKVLVIGGGD-CVEEAILCDIDEDVIKVSKQYLPEMSAGFNHPKVKVHIGDFKFLQDYQNTFDVIITDSSDPPYFQLLSDALRGGGVITTQAE.......... 133

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.