current user: public

If you have questions about the server, please let us know.

Query: PF13330.6; G3PLY1_GASAC/1308-1396; Mucin-2 protein WxxW repeating region, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst WSPWYDTTFPTLGTSGGDSETYEKLREAGHKICAKPSQIQCRAEKFPNVTIDNVGQVVQCDLAEGLTCRNEDQSGPLALCFNYHVRVQCLast
1 -66.400PF13330.6; G3PLY1_GASAC/1308-1396; Mucin-2 protein WxxW repeating region  ali  100  1WSPWYDTTFPTLGTSGGDSETYEKLREAGHKICAKPSQIQCRAEKFPNVTIDNVGQVVQCDLAEGLTCRNEDQSGPLALCFNYHVRVQC 89
2 -9.400PF18696.1; Q6P691_RAT/71-223; Synaptotagmin-like, mitochondrial and lipid-binding domain  ali follow..  13  1WLAWVTALNYEAERSGGPLRLSFQKDPRPQSLQLTVGEVSSVVKSAQEK-------MVICHVNLQFLVSAGPASTTGSECQLYDVQL.. 84
3 -7.520PF12529.8; W5MZ48_LEPOC/525-703; Xylosyltransferase C terminal  ali follow..  16  19WENLFDKMDGVSSLSDVALTTYSSFFRLGLRSLGASQGSNSKCRYEPIGYPVSVNLYFYDDRFQGYLVMQEVQSAGTGEREMLEVWA.. 105
4 -6.950PF06656.11; GLYC_RSVT/41-824; Tenuivirus PVC2 protein  ali follow..  20  1....................................VKVPCSARAPPCKLTYELNGYF---IENGLICYNRASVNYFETCYNYDYKL.. 50
5 -6.710PF11572.8; D7BHV2_MEISD/6-100; Protein of unknown function (DUF3234 topsan)  ali follow..  20  2.ATWYVLEDPQVA---GEHLVLESLGQRLSTIWLSQDEARAFMEKTPTAAGMQVGKLEGYALKETYL-VALGRLGVNQIVVGYQ..... 80
6 -6.480PF00029.19; Q5SNV2_DANRE/2-203; Connexin  ali follow..  14  1.................NWGFLENVLSGVNRYSTVVGRVWLSILIFRILVFVAAAEQVWKDEFKDFVC-NTQQPGCEQVCFDHFFPI.. 70
7 -6.230PF10034.9; H9G3T3_ANOCA/57-723; Q-cell neuroblast polarisation  ali follow..  11  518..NWIKSSTPKKAVIAGSMQLLAGVKCTGRVLTNHPKSLRERTKQVYQVYAKRSPEDVH-SFGTDFVILEDSI------CYERRHNRGC 606
8 -6.140PF03956.13; R6XLN5_9BACT/8-198; Lysine exporter LysO  ali follow..  10  96..GYYSLSSIYRGAELGTVALLSNIIREMATLLLAPLGVTSMDTTLPIIMASSGKEYSVISLFHGFVL---------EFSIPFIVTFWC 191
9 -6.100PF03762.17; G1KGZ6_ANOCA/41-210; Vitelline membrane outer layer protein I (VOMI)  ali follow..  14  73HGHWSGVRWPADGVLRAFQLKTEPDQGAGDDTSVNNIRFRCLPLEEVGGTFGDYSEWSNTCYKGGICGMQTKQEPYQGVWVD-DVRFFC 169
10 -6.060PF12456.8; Q1K7U3_NEUCR/713-828; Inositol phosphatase  ali follow..  15  33WT--LTPNVPDTVRSSSFEEAVLLLTDKALYLCRFDWNLD-KVSSFERVDLAHVTK-----IKFGTYITSTISAAQVDEMRNVGLIV.. 112

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.