current user: public

If you have questions about the server, please let us know.

Query: PF13424.6; Q4DK03_TRYCC/687-760; Tetratricopeptide repeat, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst HQRPLQNYAQLKCQLGDMLSALSLQETELEIAKEFGDTRATSRCMGAIALTKRFLGRYDEAAENYMEELSVYNALast
1 -50.100PF13424.6; Q4DK03_TRYCC/687-760; Tetratricopeptide repeat  ali  100  1HQRPLQNYAQLKCQLGDMLSALSLQETELEIAKEFGDTRATSRCMGAIALTKRFLGRYDEAAENYMEELSVYNA 74
2 -36.400PF10579.9; Q8QGW4_DANRE/1-80; Rapsyn N-terminal myristoylation and linker region  ali follow..  15  5QTKQQIEKGLKLYQSNDTEKALYVWMKVL---RKTSDPGGKFRVLGCLITAHSEMGKYKEMLQFSLAQINTARE 75
3 -28.600PF12862.7; APC5_SCHPO/263-353; Anaphase-promoting complex subunit 5  ali follow..  7..........NSWFSGDYQQSVENLCRYFDHIMHSDEKVSYQYALLNLAMLQADFGCNEEALHAIEDTINTARE 70
4 -27.100PF17139.4; R7EHD4_9BACE/12-276; Domain of unknown function (DUF5112 topsan)  ali follow..  37KAEASNNLGFCAFMRMDFEQAEKFHMDVYNLTK---NELELLIADIGLMKIYQRTALNKEFYDYRNSALHRMKR 107
5 -23.800PF13432.6; A1AQL4_PELPD/29-93; Tetratricopeptide repeat  ali follow..  15  1.....SRLSDAYLKLNLVDDALHTARRGVEKFPA------YVAGQRSLALACYAKGLMDESRQALEAVVAA... 60
6 -23.700PF12968.7; Q8KAL8_CHLTE/2-144; Domain of Unknown Function (DUF3856 topsan)  ali follow..  18  54DAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDISAVYSRALALDGLGRGAEAMPEFKKVVEM... 129
7 -21.800PF10602.9; RPN7_SCHPO/77-250; 26S proteasome subunit RPN7  ali follow..  10  36.LEAMKNKADYYTNICDRERGVQLCDETFERATLTGMK---IDVLFSKIRLAYVYADMRVVGQLLEKLKPLIEK 105
8 -21.700PF12688.7; Q9RUW3_DEIRA/41-159; Tetratrico peptide repeat  ali follow..  17  1.SVALFERAGARDSVGREAEAVQLYEQALAAGL---SGVRRRRAVIQLASSLRNVGQVERGLALLEAEQQR... 67
9 -20.900PF13371.6; Q1LJ97_CUPMC/200-272; Tetratricopeptide repeat  ali follow..  11  1.......LKAIYLQESRWQRLLAVQNRLVILLPD------SIEEVRDRGLAYANLECFRPALEDLEAYVQAR.. 59
10 -20.400PF10952.8; F0LVC6_VIBFN/6-145; Protein of unknown function (DUF2753 topsan)  ali follow..  12  2..EKHTLLADIAMQQADHLRSILHYQQALTLSDRIGVAEEIVISCHNMAGFWRTIGDDQYELKYLELASERILT 82
11 -20.300PF14938.6; B8ML21_TALSN/2-284; Soluble NSF attachment protein, SNAP  ali follow..  16  115.ATHQQNLAECYEEIGNPKKALEEYEKAAEWYESDNAEALANKYFLKVADLAAIEADYYKAIAHYEKVGKASID 188
12 -19.200PF12569.8; A7S752_NEMVE/188-686; NMDA receptor-regulated protein 1  ali follow..  17  187...TYFFLSQHYDHLRDTEKALDYINKAIDHTPTLIE------AYMVKGRIYKHAGDIDKAAEIMDEARAF... 248
13 -18.800PF08631.10; H2L969_ORYLA/170-426; Meiosis protein SPO22/ZIP4 like  ali follow..  14  4.............AQGNNQEAIVFIERCKDILLRLPNETAYSVVCYNFGIEAYNLTKFEDSAFWLSQSYDIGKA 65
14 -18.400PF16065.5; E2AQ63_CAMFO/137-267; Domain of unknown function (DUF4807 topsan)  ali follow..  15  35....LSTLGGAFSALGEEKMAGKISMRQFELALRLDNPLLIARCRLYSALSLIQRGYFTTPKYMIQRIYKFAIK 109
15 -17.900PF17826.1; G1SXV9_RABIT/101-469; Family of unknown function (DUF5588 topsan)  ali follow..  18  50..TTKKFKGDLAYRQGEYQKALQEYSSIAEKLSP-TNFSMKRDIQEGQARCLAHLGRHQEALEIATELENKATN 120
16 -17.400PF11349.8; C6WR17_ACTMD/8-134; Protein of unknown function (DUF3151 topsan)  ali follow..  11  35.SEAWALLAETALDNDDPVAAYAYARTGYHRGLDQ-PNQGFLRSLAALSRAAGGIGEVAEQDRCAKFLADS... 120
17 -16.500PF07079.11; O84657_CHLTR/57-602; Protein of unknown function (DUF1347 topsan)  ali follow..  15  462.ANCLADAQYLFAK-GDYRLCIVYSSWLARAAPS-------TEALQLLGLSLVEQKEYTEALEVFQRLPLGEDT 526
18 -16.400PF13429.6; Q39U81_GEOMG/198-480; Tetratricopeptide repeat  ali follow..  14  216MPSLYEPFGAALAYLGEYHKALPYFQARYSQKRS------DPAWLAAYADTMEQAGWVEAAFLERLNALALSR. 282
19 -16.200PF14559.6; E3HZX0_RHOVT/142-209; Tetratricopeptide repeat  ali follow..  16  3.............EEGDIAGAAQLYGAVLKNDRE------NADAIGGLSKCYVRLDDLARAEQVLSMTPPAKQT 57
20 -16.200PF09986.9; Q898V4_CLOTE/16-227; Uncharacterized protein conserved in bacteria (DUF2225 topsan)  ali follow..  16  118.AMTCLKLAWMYRLKNNLTNALKGFIEAYESEEFPIFGMDKYTIMYLIGELNRRLGDKDKALLWFSYVITTPNV 197
21 -16.100PF15015.6; SPT16_MOUSE/5-569; Spermatogenesis-associated, N-terminal  ali follow..  12  172WLQVALKDASSCYRQKKYAVAAGQFRTALELCSK-DIASIASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPA 257
22 -15.500PF06552.12; TO203_ARATH/7-193; Plant specific mitochondrial import receptor subunit TOM20  ali follow..  14  24DADNLTRWGGVLLELSQFHSAITKFEEALLIDPK------KDEAVWCIGNAYTSFAFFDLATQFFQQAVDE... 109
23 -15.300PF14561.6; B6IUQ4_RHOCS/220-309; Tetratricopeptide repeat  ali follow..  10  21DHQTRYDLALALYAAGKAEAAVEALLEIVKRDRDWNE----QAARKQLLKFFEAFGPTDKLTVMARRKLS.... 86
24 -15.200PF09295.10; Q6CDA2_YARLI/40-455; ChAPs (Chs5p-Arf1p-binding proteins)  ali follow..  10  258DADLLSLQAEFLLSKNREDMALGCATRAVNSAPS------ESKLWTELVQVYIRQKDWENALLTLNSCPMFT.. 323
25 -14.900PF17874.1; W4QMK5_9BACI/433-753; MalT-like TPR region  ali follow..  16  39RTATTWTMGYAYQLQGDRAAARKAYIEALSISQNIGHVIITIMTTLGLGNIHEGDNQLYVAAETYRQALTLAGD 112
26 -14.000PF13374.6; CLU_HUMAN/1019-1060; Tetratricopeptide repeat  ali follow..  26  2.CACLRLLARLHYIMGDYAEALSNQQKAVLMSERV....................................... 35
27 -13.800PF17004.5; E0SAD0_ENCIT/8-116; Putative TPR-like repeat  ali follow..  17  13HPEFNRFRAVAYINMGKFGEALKYAEKRYKKALRILRYLDTEGSKVLASQCLYYLGYYNTAYKVLSEIKKDDE. 98
28 -13.300PF09613.10; F5XVY8_RAMTT/1-126; Bacterial type III secretion protein (HrpB1_HrpK)  ali follow..  10  12..DALAAVFYVGSDLEEDAQTLVVLRAIRRL------RPHAPTLAVVEAQQLVENGDLQGARLLLEEADACS.. 75
29 -13.300PF13414.6; B2J3Q3_NOSP7/192-233; TPR repeat  ali follow..  1........GNALYDRGELAEAVTQYKKSISF------DPKYADAHYYLGNALYAQG.................. 42
30 -13.200PF09477.10; Q7N0U7_PHOLL/1-115; Bacterial type II secretion system chaperone protein (type_III_yscG)  ali follow..  11  7..GLLADIALVGSGHHCHDEANIIADWLMSGEEE------QEAANLIRLSSLTNQGKYQQALDFGRDL...... 66
31 -13.200PF09976.9; C7RN42_ACCPU/16-225; Tetratricopeptide repeat-like domain  ali follow..  16  111RDLARLRLAAVLLDEKAYDEALKQLAG-------NTTGGFAVRFLGSRGDVLSAQGKTAEARAAYQEALVRLDE 177
32 -12.400PF16918.5; V9XE69_9NOCA/412-767; Protein kinase G tetratricopeptide repeat  ali follow..  10  129DWRMDWYAGIAELLQDDYEAAFTRFDKVLQALVVWRTDHAVVSAAFGLARQLTARDEIRAAVDVLDEVPTTSRH 240
33 -12.000PF15642.6; B3ESR0_AMOA5/1055-1441; Toxin in Odyssella and Amoebophilus  ali follow..  14  333TQMIDYALKMWERNDGQTINAMNLLLGGTQHQPSW------LKAFTQTARLETEDGRYLDG............. 387
34 -12.000PF04733.14; COPE2_ARATH/7-293; Coatomer epsilon subunit  ali follow..  15  132..DLYALNVQIFIKMHRAEYAEKQLRVMQQIDEDSEKYPMTCLILNGKAVCCMQMGNFDEAETLLLEALNK... 230
35 -11.900PF04781.12; B3H4B1_ARATH/23-139; Protein of unknown function (DUF627 topsan)  ali follow..  15  39QGDIFYQLAEETEITNDLFASLDAFSMFTLPCDALKSFRGCVLSLIQLGDQLGIKKFYRKAASKAYQALSVTN. 117
36 -11.900PF00515.28; OGT1_RAT/147-180; Tetratricopeptide repeat  ali follow..  15  2..CVRSDLGNLLKALGRLEEAKACYLKAIETQPN........................................ 33
37 -11.500PF13176.6; Q8YTD5_NOSS1/458-493; Tetratricopeptide repeat  ali follow..  28  1...SLNNLAELYRSQGRYREAEPLFIDALAMTKRL....................................... 32
38 -11.300PF12895.7; A5DQ17_PICGU/77-157; Anaphase-promoting complex, cyclosome, subunit 3  ali follow..  25  28.......LAQVYYNSGQYLRAKELISGKPEYEKSVTCR---------AARSAIKLELWDEALDLVGEN...... 81
39 -11.200PF10373.9; C0NR07_AJECG/209-489; Est1 DNA/RNA binding domain  ali follow..  14  1....................AIRYYKLADTLNPDSG------MSHNQLAVIGLADGNHLQATYHLYRALSAREP 48
40 -10.900PF13512.6; Q6LMX6_PHOPR/21-165; Tetratricopeptide repeat  ali follow..  12  10.PAELYVTAQQALQSGSWTTAIERLET---LDSRYPFGAYSEQVQLDLIYAYYKNDDLALGEATIARFNR.... 75
41 -10.700PF04184.12; F7I5Z8_CALJA/4-540; ST7 protein  ali follow..  258..YIKRRLAMCARRLGRTREAVKMMRDLM----KEFPLLSMFNIHENLLEALLELQAYADVQAVLAK....... 318
42 -10.700PF18768.1; A0A1I6VL50_9BACI/211-260; Helix-turn-helix bacterial domain  ali follow..  12  1................QYEKALKQVEKAIETSCRNSNMTLIGQLFYQKGECLEKLGHSEDDIRIA......... 49
43 -10.300PF10255.9; W4Z016_STRPU/127-527; RNA polymerase I-associated factor PAF67  ali follow..  15  124...SLIGLLRLHSLLGDYYQAIKVLEHIQLNEQTLYSKVAACSTYYYVGFAYLMMRRYQDSIRSFTNILLFIQR 196
44 -10.200PF13258.6; YHIL_ECOLI/209-532; Domain of unknown function (DUF4049 topsan)  ali follow..  58.KVLYDLLNTRDMILNELHQHVFLKDDAITPCIFLGDHTGDKDSRINKNVVVLAGNHEINFNGNYTARLANHK. 153
45 -10.000PF08626.11; C0NZX0_AJECG/5-1447; Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit  ali follow..  17  324KGRLNIVMGTLFLQAGRWPDSLKELAEGATIARANSDYIWHAKALESILQC....................... 374
46 -9.920PF16811.5; D5CPB6_SIDLE/41-285; TRAP transporter T-component  ali follow..  11  145HGEAHLYLGVFATLLGKPEEGRVHFERAIQL-----SAGRDLMAKVEYARRYRITYDRELHDRLLHEVLDA... 216
47 -9.300PF11207.8; F7YLW7_VIBA7/16-218; Protein of unknown function (DUF2989 topsan)  ali follow..  19  142TAEMQYALATFYVQ-RDREKAIYLLHRTLELSP---KGSINLDAIKSLASTNQILKQKEKA............. 198

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.