current user: public

If you have questions about the server, please let us know.

Query: PF13560.6; E2Q1W5_STRC2/16-79; Helix-turn-helix domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst HLGTELRQLRQAAGLKANQVVRRLIWSPSKLTRLETGENATVEPSDVIALCDMYGADPEKRALLLast
1 -40.200PF13560.6; E2Q1W5_STRC2/16-79; Helix-turn-helix domain  ali  100  1HLGTELRQLRQAAGLKANQVVRRLIWSPSKLTRLETGENATVEPSDVIALCDMYGADPEKRALL 64
2 -17.000PF13744.6; A9IKY1_BORPD/13-92; Helix-turn-helix domain  ali follow..  10  18ALALKLNELIDHRGLSQTEAAAITGMTQPKVSQVRRYKLQNISLERLMQALVSLDQR....... 74
3 -16.700PF01381.22; O74027_METWO/12-69; Helix-turn-helix  ali follow..  11  2.....AAVNLTKQGYSQKEIAEALDMNRSTVSHYLNGRN--LSWKSIEVAKIITEMCPRD.... 54
4 -16.100PF05339.11; Q9CGT0_LACLA/1-68; Protein of unknown function (DUF739 topsan)  ali follow..  6...SSLLGKITEKCGTQYNFAIAMGLSERTVSLKLNDKV-TWKDDEILKAVHVLELNPQDIPKY 65
5 -14.300PF13443.6; C7PBR9_CHIPD/6-68; Cro/C1-type HTH DNA-binding domain  ali follow..  21  1....NLDVMMAKRKISLNELSERVDLTLSNLSILKTGKAKAIRFSTLEAICRALDCQPGD.... 56
6 -14.200PF14590.6; Q086X3_SHEFN/5-170; Domain of unknown function (DUF4447 topsan)  ali follow..  21  9..AIEIQCLRQSLGLTTEQVASITKASNEDVMAWESGEQ-EAPIPAQKKLLEIDDIIEMQVLNT 69
7 -13.600PF08965.10; X2GUQ4_9GAMM/1-117; Domain of unknown function (DUF1870 topsan)  ali follow..  19  3..NLELQAYRRFLMLKVSEASEYIGTDASTWHNWEKGTV-PVPQYVVTAMQELKKLRTDKVNII 64
8 -13.200PF08667.10; Q7P0M9_CHRVO/4-177; BetR domain  ali follow..  15  6.FLVRLAQLLDATGIAERELRDLLGIDLSSANRKLKGGI-AFNIEELAKVAKTIHCSAD..... 66
9 -13.000PF15731.5; A1VWM6_POLNA/1-131; Antitoxin component of bacterial toxin-antitoxin system, MqsA  ali follow..  13  71..PDYIARVRKKLDLDQRQAAEIFGGGVNAFSRYENGKTRPSLALV--KLLKVLERHPDLLNEV 130
10 -12.100PF12844.7; Q03EQ2_PEDPA/10-80; Helix-turn-helix domain  ali follow..  24  1..GERLQDARIKKGWTIEEVQFKLQISKRYLMALEAGENDDLPGD-IKQYANLLEIDLGS.... 63
11 -10.900PF13413.6; D4ZY36_ARTPN/38-99; Helix-turn-helix domain  ali follow..  17  1....QLRDARMKNSFSLGMVAAYTRIRTHLLQAIEEGKIDSLPEP-IRQYADALGLNGEE.... 61
12 -9.770PF00157.17; G3VJ82_SARHA/126-197; Pou domain - N-terminal to homeobox domain  ali follow..  18  8QFAKELKRKRITLGYTQADVGITLGFSQTTICRFEALQLSFKNMCKLRPLLQKW.......... 67

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.