current user: public

If you have questions about the server, please let us know.

Query: PF13646.6; C3YB05_BRAFL/324-412; HEAT repeats, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst VSSLKKLLVDEDPNIRAVASIALGKTGTCTPDIVEALVNLLKDEDRLVRESTCVSLGYLQAQDAVPHVINAWRNDPISHVREAAQAALRLast
1 -44.300PF13646.6; C3YB05_BRAFL/324-412; HEAT repeats  ali  100  1VSSLKKLLVDEDPNIRAVASIALGKTGTCTPDIVEALVNLLKDEDRLVRESTCVSLGYLQAQDAVPHVINAWRNDPISHVREAAQAALR 89
2 -15.500PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  21  293VHMLVKALDRDNFELLILVVSFLKKLSIFMEDIVEKLVKMIPCEHEDLLNITLRLLLNLSQVGLLPKLTALLGNDNYKQIAMCVLYHI. 398
3 -15.300PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  12  56LPIVAKILNTRDPIVKEKALIVLNNLSVNAENSISDFFRLFSAGNEETKLQVLKLLLNLAENPVPSSLGSLFNKKEYKEVILKLLIIFE 201
4 -15.100PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  13  46SERLFNCLRTTNTDQITYCKNILKNIDAPATKYHDAVIEGLNHPTEDVRELCLIELERC-KEDLLSYIARGM-ADEHLKNAQIASNVF. 149
5 -14.900PF09450.10; Q217R8_RHOPB/20-124; Domain of unknown function (DUF2019 topsan)  ali follow..  14  35....................QVSAELKRRDGDQRRALLALYDHPNMQVRLKAAKHTLAVAPVEARQQL-EAIAGSKWFPQAGDAGMSLW 102
6 -14.400PF12755.7; C4QYN7_KOMPG/59-156; Vacuolar 14 Fab1-binding region  ali follow..  16  30IHPVLACFGDQDARVRYYACESLYNISKVANEIFDNLCKLTADSEVSVKKGADLLDRLIKD............................ 98
7 -14.000PF12717.7; G8Y240_PICSO/105-271; non-SMC mitotic condensation complex subunit 1  ali follow..  21  2..............IRALAIRTMGCVRVARDFIEIPLKRTLSDDNPYVRKTAAICVAKL-VEFGFLDQLRGLIKDSNPMVVANALNSL. 84
8 -13.400PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  16  187YKGLIALLPCTSPHAQQLSLQTLRVVQAIVGKIVEAVLGVLRSMELEVQYEAIQLIKDL-RPALLRGLVALLK................ 267
9 -12.900PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  25  44LKKLINLLSSDDPNILAIAANDVGQYVKHYERGKDRVMELMAHTNPEVRYRALLSVQQL.............................. 112
10 -12.800PF06685.11; Q8YLB6_NOSS1/1-246; Protein of unknown function (DUF1186 topsan)  ali follow..  18  3VEEILAQLEINTKTFPRLALEAAIEQREAITPILISTLDLLEKEDYILHIHALYLLAQFREESAYPTIIKFFSVPGDDIVTEDLGRIL. 105
11 -12.100PF12348.8; B8M2E9_TALSN/325-551; CLASP N terminal  ali follow..  21  96LQNMIKLCAGMKKISAQNANATVDAI-TYVPRILQHLSFACQDKNVQPRLFAAGWLKTLGGLDLVEKCIKKCLGDPNPGVRESMRGTF. 200
12 -11.700PF01347.22; VIT_ICHUN/18-588; Lipoprotein amino terminal region  ali follow..  18  487........DEYSTRVQAEAIMALRNIAKRDPRKVQEIVLPIVAIKSELRIRSCIVFFESKSVALVSMVAVRLRREPNLQVASFVYSQMR 571
13 -11.100PF01602.20; Q22601_CAEEL/28-590; Adaptin N terminal region  ali follow..  12  51...AVNLLSSNKYTEKQIGYLFISVLIEQQSDIVQGIRNDLTSRNPVHVNLALQCISNMGSREMVEAFCTDLPGETIDFVKQSAALCI. 144
14 -11.000PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  18  101MEEVAHLLQDEEPKIKILLLQSVACWCYLNPVFIPILISFFEGRFESLKFWTCYVLSELKDHSALKYHLQMLAAENWSGWTENFAEVL. 221
15 -10.600PF11701.8; F6ZSU7_XENTR/243-434; Myosin-binding striated muscle assembly central  ali follow..  12  86...VRSLFEGHGMDGKLRSIQTVSCL--ELTGIMESIISLCASEREIDQQVAVEALIYAAGKAGVALLKDIYKKNENDAIRIRALVGL. 189
16 -10.400PF10363.9; A0A1X7V8A1_AMPQE/783-906; Required for nuclear transport of RNA pol II C-terminus 1  ali follow..  13  2.ARALKDIQDSLIPVKGHGLQQLSQL-AHIDHTIELFLTHLGHSDTYIYLPSIQGLVELASDRIIPLMCNEYAQFNE............ 88
17 -10.200PF05918.11; D7TJH2_VITVI/11-547; Apoptosis inhibitory protein 5 (API5)  ali follow..  14  27....IIAAAKGSIKAKQLAAQLIPRF-DLSDAAVDSHLDLCEEEELGVRVQAIRGLPLF--SKIVDILAQLLTAE-ENVERDAVHKALL 120
18 -9.150PF12719.7; M3XT68_MUSPF/558-858; Nuclear condensing complex subunits, C-term domain  ali follow..  20  31...ILPGIVSVHPVIRNLAVLCLGCCGDFASKHFVLLLQVLQIDDVTIKISALKAIFDQ-TAKNVLKLLSDFLDSEVSELRTGAAEGL. 157

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.