current user: public

If you have questions about the server, please let us know.

Query: PF13855.6; C3Y9A4_BRAFL/119-179; Leucine rich repeat, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
2 -18.200PF14580.6; H3BFR2_LATCH/1-175; Leucine-rich repeat  ali follow..  27  43.QFDTIDFSDNEIRKLDG--FPLLKRLKTLLMNNNRICRIGEGLEQALPNLRELILTSNSI 100
3 -14.700PF00820.19; OSPB_BORBU/36-296; Borrelia lipoprotein  ali follow..  10  200.KTGKWEDSTSLTISADSKKTKDLVFLTDGTITVQQYNTAGTSLEGSASEIKNLSELKNAL 260
4 -10.000PF12799.7; A4HHM1_LEIBR/66-108; Leucine Rich repeats (2 copies)  ali follow..  31  2.WLKYLNLAVNNITVIDG--LQGCEALERLDLTLNFIAEPT.................... 39
5 -7.510PF13306.6; A2EUR9_TRIVA/224-352; BspA type Leucine rich repeat region (6 copies)  ali follow..  12  12.KMTAISIPST-VKCIGENAFSECRSLSDIIFVDNQLINISNHAFY--TNISSIIVPRL.. 68
6 -5.520PF18837.1; A0A1U8BYT7_MESAU/399-428; Leucine-rich repeat  ali follow..  26  1..........................LHTLHLQMNFINQAQLSIFGTFPSLRFVDL..... 30
7 -4.300PF17171.4; H3E663_PRIPA/476-540; Glutathione S-transferase, C-terminal domain  ali follow..  14  18.......FFGDKPTTLDCSAFGLLVMFVYTPIWPTPIKRHLEENCANL............. 58
8 -4.220PF11047.8; SOPD2_SALTY/1-319; Salmonella outer protein D  ali follow..  20  273.FSDVLNKDYDDYQNNKREI----AILRRIYRSHNNTLFISEKS................. 312
9 -4.130PF16461.5; A0A0G3Q840_KLUIN/18-150; Lambda phage tail tube protein, TTP  ali follow..  2.....IYTGSGTPNPLVDTDWARLAQVKELTPGELTADSFDETYIDDPNADWTATAQG... 54
10 -4.120PF09063.10; Q38062_BPPP7/2-128; Phage PP7 coat protein  ali follow..  14  56....NLKLDQADVVDCSTSVCGELPKVRYTQVWSHDVTIVANSTEASRKSLYDL....... 105

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.