current user: public

If you have questions about the server, please let us know.

Query: PF13988.6; D8MQN7_ERWBE/128-293; Protein of unknown function (DUF4225 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst QNLKQEHEYLTIQDRMLRSGHAVVSASVQFYHEHEKIIGYIIDGIGVVVGGLQMVAGATLIAGSMATGNVIGVVAGSSLVLSGAGSTIESAEKLLGRANPTNFMRNAYEDAAEFMGFDKRLGFLAYQAVDFTTSYYGVLKLSLKPEAWRLFNYLPSDYYRKVQTMSLast
1 -93.000PF13988.6; D8MQN7_ERWBE/128-293; Protein of unknown function (DUF4225 topsan)  ali  100  1QNLKQEHEYLTIQDRMLRSGHAVVSASVQFYHEHEKIIGYIIDGIGVVVGGLQMVAGATLIAGSMATGNVIGVVAGSSLVLSGAGSTIESAEKLLGRANPTNFMRNAYEDAAEFMGFDKRLGFLAYQAVDFTTSYYGVLKLSLKPEAWRLFNYLPSDYYRKVQTMS 166
2 -8.630PF11127.8; A4XP43_PSEMY/1-62; Protein of unknown function (DUF2892 topsan)  ali follow..  23  1........................................MKANVGTLDRSLRIAAGLILIALSLAGVIGLWGWIGVVPLATGVFR................................................................................ 46
3 -8.100PF11239.8; C7MBE6_BRAFD/1-83; Protein of unknown function (DUF3040 topsan)  ali follow..  16  5...EHEQKMLDEMERQLFADDPRLARAFA----PTKQPRRSRSGRRILIGLGAVIVGLGVLVLAVSLPAVWLGVIAFIGMLAGA.................................................................................. 81
4 -7.770PF05802.11; C5B9R0_EDWI9/34-192; Enterobacterial EspB protein  ali follow..  14GKLRDVLRQYQQAQQSNAFKMQKTAFETRVDSIDKDFQAKQAQAVAQIVGGIAQTVGGGFGEHGHTISTGLNNMTQGIVGVGYANDLTRQSQEEQALSDYQHGMADQLLKRAEET---EKALKVSGDLREILATLTQAHEHLSS--SVRI................ 159
5 -6.770PF04103.15; T176B_MOUSE/60-224; CD20-like family  ali follow..  20  1........................................SLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFGSVAILAGVGTIVHE............................................................................ 52
6 -6.690PF06197.13; D0L9X9_GORB4/20-220; Protein of unknown function (DUF998 topsan)  ali follow..  13  28...........................LSELDAQHCPHREVYVAGDVTTSVCALIAGAVALIPRPLVRGRLAVAAVVLLAAFGASTMADALLPI........................................................................ 94
7 -6.520PF05461.11; M3YMB0_MUSPF/26-333; Apolipoprotein L  ali follow..  11  56ESFLHQFPELKLKLEERIRKLHELADEVDRVHRDCTIANVVANSTGVVSGLLSI-LGLGLAPVTAGASLALLATGMGLGVAATVTQVSTSLVEDSSESSAKAQASHLTSTDFDKG................................................... 169
8 -5.990PF14007.6; D6XSR8_BACIE/4-90; YtpI-like protein  ali follow..  10  28.............................................HSYASKASMAVGLFMISFAINSQTTVAAVILLLFLAMGGANIFLGYKN......................................................................... 79
9 -5.990PF01184.19; A7TND9_VANPO/71-277; GPR1/FUN34/yaaH family  ali follow..  26  57..............................................FYGGLMQTIAGIWEIALENTFGGTTLCSYGAFWLSFGA.................................................................................. 94
10 -5.760PF12349.8; Q16VL3_AEDAE/637-791; Sterol-sensing domain of SREBP cleavage-activation  ali follow..  13  11............................................GGIVVVLVSVACSLGFFGLQLATTMLTIEVIPFLVLAVGVDNIFMLVHAFQRIDRVQTPTDKAIGKALGQIGPS-----LLTSASECCCFAIGGLSPMPAVNTFAWY............... 115

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.