current user: public

If you have questions about the server, please let us know.

Query: PF14001.6; C4LFP5_TOLAT/3-66; YdfZ protein, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst KIYDRNRNLLSAGQRVMIVGTGEIDVLETALTDGLTSSQAERSKCVLLTHAQERYAPIELVKLGLast
1 -57.000PF14001.6; C4LFP5_TOLAT/3-66; YdfZ protein  ali  100  1KIYDRNRNLLSAGQRVMIVGTGEIDVLETALTDGLTSSQAERSKCVLLTHAQERYAPIELVKLG 64
2 -7.210PF14578.6; IF2P_SULSO/468-553; Elongation factor Tu domain 4  ali follow..  26......GGIIRPKYPLIKEDGRRVGEVLQIQDNKKSLERATKGMEVAIS............... 68
3 -6.920PF09871.9; F7XP05_METZD/16-103; Uncharacterized protein conserved in archaea (DUF2098 topsan)  ali follow..  18  1........PIKVGSTVRYINTGTVGNITDIKQDS-------EGAWALLDDTDLYYRVDFLEVTA 49
4 -6.900PF10963.8; B8J329_DESDA/5-85; Phage tail assembly chaperone  ali follow..  23  17EIYNKYINELTANKKVAPTQNMLMRAVHDEDKDTLKEFSAMPGAVFEIAALVEEYAPELTVTVG 81
5 -5.760PF16325.5; C4ZAX9_AGARV/330-411; Peptidase family U32 C-terminal domain  ali follow..  19  23......RNKFSVGEQIEIMKPNLATVLALVDEDGNEMESCPHPQQVFYVKLSETPDEFDILR.. 82
6 -5.670PF02699.15; D5MIU9_9BACT/21-99; Preprotein translocase subunit  ali follow..  14  26KEQKDMLANLKTGDQIITTG-GLYGTIVKFGEDNRVKVRIAENVTVEIA............... 73
7 -5.620PF02563.16; R5GH66_9BACT/40-146; Polysaccharide biosynthesis/export protein  ali follow..  22  49.....NNSQGVLGYTVGSDGYIDFPVLGRLLVAGMTREQIAAHIKKELVTRDLVKDPVVTVEFA 107
8 -5.190PF05594.14; Q8PLI3_XANAC/3289-3387; Haemagluttinin repeat  ali follow..  15  43.......TRVQAGGSAALIAGNNLSLTPSALRDDNGLLRGGDAVSVTTGKDLIVSAGNDLQLHG 99
9 -5.050PF18657.1; D7GUC6_9FIRM/1483-1577; YDG domain  ali follow..  19  14KTYDGTKTATVHEPLIVKTGVDTGQLQITGLTAAFKDANAGTNKKVVIDAS............. 68
10 -5.020PF09939.9; C5AUI3_METEA/7-71; Uncharacterized protein conserved in bacteria (DUF2171 topsan)  ali follow..  12  1.........IREHATVVGSDGGHVGTVDHVGKGEIKLTKSDA-----DAGGLHHYIPLDLV... 47

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.