current user: public
If you have questions about the server, please let us know.

Query: PF14117.6; D0J295_COMT2/9-67; Domain of unknown function (DUF4287 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
# Score Template Links and tools%idFirst GPASYFPSIEKAYGKPVTHWLKILDELRDKKHMEQVAHLKLEHGIGHGHANALVAYHRALast
1 -43.000PF14117.6; D0J295_COMT2/9-67; Domain of unknown function (DUF4287 topsan)  ali  100  1GPASYFPSIEKAYGKPVTHWLKILDELRDKKHMEQVAHLKLEHGIGHGHANALVAYHRA 59
2 -7.140PF11300.8; L0F544_DESDL/8-135; Protein of unknown function (DUF3102 topsan)  ali follow..  14  27...........EIGR------RLKEAKSLVEHGEWGKWLEESVSYSQSTACRLIRICEE 68
3 -6.160PF04496.12; SCP_VZVD/10-108; Herpesvirus UL35 family  ali follow..  8  51GAAASAARARANHNAN------TIRRTAMFAETDPMTWLRPTVGLKRTFNPRIIR.... 99
4 -5.750PF14096.6; Q65J85_BACLD/29-103; Domain of unknown function (DUF4274 topsan)  ali follow..  2  1..............ENPVILQVFAANYNWNSGFDVPKAILENENCDYGTGLLMF..... 40
5 -5.670PF08520.10; A2QPC8_ASPNC/2-73; Fungal protein of unknown function (DUF1748 topsan)  ali follow..  11  15..SAFLAGVKRSTGLTPS-----LNSDKITDNKDFKKWIDNYLGVGEWVMDQSVAVLGS 66
6 -5.510PF15486.6; H0XU67_OTOGA/6-166; Domain of unknown function (DUF4644 topsan)  ali follow..  27  49GLALYLPGHMQPAGQCESHWLGRLMAGGCLPQPEGTPW-QGTLGPGNSHCSALLE.... 107
7 -5.340PF10427.9; B4NHM7_DROWI/429-568; Argonaute hook  ali follow..  12  12GPQARLTSGVPHKQDGGTMWVHPNNSGGGRNPVNVAGWGDDSHNVGVTGSVSVS..... 72
8 -5.280PF10086.9; A3CSR2_METMJ/15-237; YhfC intramembrane metalloprotease  ali follow..  8  68.YLGLMAGLFEEIGRYLVYRYLFGRQKIPLTRENGLL-----FGTGWGGIESIF..... 115
9 -5.090PF00832.20; E5S598_TRISP/142-183; Ribosomal L39 protein  ali follow..  15  8.........AQRVNKPVPQWFRLRTGNRIRYNVKRRHWRRTK................. 40
10 -5.070PF08721.11; G8PIV2_PSEUV/167-247; TnsA endonuclease C terminal  ali follow..  9  21......EGLDELSLDQMDFYGHHFKKNPNKTLISICKELDVAYGLPLGQSLQEIRQLLA 73
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 8 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41.