current user: public

If you have questions about the server, please let us know.

Query: PF14413.6; G2Q1R0_MYCTT/139-266; Thg1 C terminal domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst QNLRDYMSWRQVDCHINNLYNTTFWALIQLGGLDATEAEKTLKGTYAADKNEILFSRFGINYNNEPEMYKKGSVVFRDYELVEPGTHNTTAEVDNLAEPVQQSKTQTENDKKRRAKARIVVQHLDIIKLast
1 -79.200PF14413.6; G2Q1R0_MYCTT/139-266; Thg1 C terminal domain  ali  100  1QNLRDYMSWRQVDCHINNLYNTTFWALIQLGGLDATEAEKTLKGTYAADKNEILFSRFGINYNNEPEMYKKGSVVFRDYELVEPGTHNTTAEVDNLAEPVQQSKTQTENDKKRRAKARIVVQHLDIIK 128
2 -6.600PF16867.5; G8MI78_9BURK/28-189; Dimethlysulfonioproprionate lyase  ali follow..  53KALEADLGWSRVNGSDGYTEAHVHGMICGPGGAESRYTRYPDHSHPPEEAYVLFTPGEFRQNGGEWIDPGMGGGIH.................................................... 144
3 -6.400PF05090.14; B4LDV5_DROVI/83-514; Vitamin K-dependent gamma-carboxylase  ali follow..  315......YSWDM--------------MVHSYDTVLTSIKVVDNDNQKVHHLNPYAFTEYD-RWTKYADMAVQYAKCIEKNIREDMDQHPQNSPLTSSNISIYFDIWCAMNGRFQQ---RTFDPRVDLLK 418
4 -6.360PF08930.10; Q99YR7_STRP1/1-84; Domain of unknown function (DUF1912 topsan)  ali follow..  22  6EFLKDFEDWVKTQIQVNQLAMATSQEVAQEDG-DERAKDAFIRYESKLDAYEFLLGKFGKAFHDIPD............................................................. 76
5 -6.230PF06441.12; T0LF99_COLGC/17-139; Epoxide hydrolase N terminus  ali follow..  10  47RELAEYYNWKDQEAGPPRLTS-------ERINNTFNHFLVKIQVPDYGLVTLHYTHTKSPNPDAIPLLFVHG........................................................ 115
6 -6.190PF13162.6; F0R8L3_BACSH/28-138; Protein of unknown function (DUF3997 topsan)  ali follow..  13  44....DFILVKAYRALRDSINTTEYYIIPVNNTQEAWEAQENKFGAFSKKDFEVKRKELGVSDD................................................................. 111
7 -6.090PF14160.6; I3KJ96_ORENI/188-294; Centrosome-associated C terminus  ali follow..  1.............................RPSLSRSKSDMSDRYSRAGTELERFFNLCGLDPTDVHELTGSSSDIVSMARFRSASAPGSECAGSGREDEDEDEEEAGKAANRVPYGVSVIERNARVIK 99
8 -5.960PF10077.9; A5FAU7_FLAJ1/13-146; Uncharacterized protein conserved in bacteria (DUF2314 topsan)  ali follow..  82.........NNGDEVEIPVNQISDWLFASQGKTYGAFTIHAMRSEMSEDERNEHDDAWGLDF.................................................................. 134
9 -5.880PF01578.20; CCSA_GUITH/70-295; Cytochrome C assembly protein  ali follow..  14  165....TYWSWDPKETW--ALITWLVFAAYLHARITKSWTGERPAYLAALGFVVVWICYLGVNF.................................................................. 220
10 -5.760PF15147.6; G3R7K7_GORGO/1-123; Domain of unknown function (DUF4578 topsan)  ali follow..  14  54ERVLQQQGSQERSPGLMSEDSNLHYADIQVCSRPHAREVKHVHLENATEYATLRFPQATPRYDS-----KNGTLV..................................................... 123

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24