current user: public

If you have questions about the server, please let us know.

Query: PF14470.6; D5BGD3_ZUNPS/37-134; Bacterial PH domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst LTRNENVEYVAVQKKPAVNFSPDSVALTNKRIIFCRPKTFGLSMDFQDFLWKEIADCHIKEGIIGATFTAKKVKGGGIISMDYLPKSQARLLYRYAQELast
1 -55.200PF14470.6; D5BGD3_ZUNPS/37-134; Bacterial PH domain  ali  100  1LTRNENVEYVAVQKKPAVNFSPDSVALTNKRIIFCRPKTFGLSMDFQDFLWKEIADCHIKEGIIGATFTAKKVKGGGIISMDYLPKSQARLLYRYAQE 98
2 -24.200PF08000.11; C7PDL4_CHIPD/2-124; Bacterial PH domain  ali follow..  17  26LTPSENIELGFK-------LIRDTFIFTNKRMILVDQGITGSKVEYLSVTYKSISRFSIETA-LDAELKIWISSEVPSIRKQFNKSVDVYEVQKVLAQ 121
3 -15.300PF12462.8; D4GNL4_PANAM/1-164; DNA helicase IV / RNA helicase N terminal  ali follow..  11  20........................VRLLTAGVEVSGDK------HEYLIPFNQLSDITCKRGMVWGELEFLL-ADNKVVRLHGTEWQETQRFYHYLMQ 86
4 -11.500PF11605.8; Q4QDE7_LEIMA/5-95; Vacuolar protein sorting protein 36 Vps36  ali follow..  9LEADEVCITVQHGVNEKTQRQNGKLSLTTHHLRYNDEA----ISTVLQLPLELVRRSGQAPSISSGF............................... 77
5 -10.800PF07289.11; K3X3B3_PYTUL/11-342; Bardet-Biedl syndrome 5 protein  ali follow..  16  148LLPHEQVYTRLNGVLSSDQGNLGTFFVTNVRIVWHANLAENFNV---SIPYMQINSARIRSSKFGPALVIETSSGGYILGFRVDPEDRLHELFKEIQS 246
6 -10.600PF03703.14; Q2S4T2_SALRD/280-363; Bacterial PH domain  ali follow..  9............................DGDKLRKRHGLF--TVTEGTIPLDKVQALILRTNPFMYELKVQTIGLDVEVIAPFAGAERILELARQV.. 84
7 -9.760PF06115.11; Q1WUG6_LACS1/1-117; Domain of unknown function (DUF956 topsan)  ali follow..  13  6...NTKVDLTMAGTSYMGLSDYGKIMIGDKGFEFFNDR---DVRKYIQIPWEEVDVVIASKGKWIPRFALRTKKNGM-----TFSAKNSKEVLRAIRE 96
8 -9.360PF08512.12; D8U9V6_VOLCA/358-450; Histone chaperone Rttp106-like  ali follow..  12  8..........................ADDGQLYPLDRGFFYVHKPPLLIPDNDIESVEFARSSSVRTFDLVIRKGGTEHMFRNIQRSEWGNLFEFINT 86
9 -8.260PF02893.20; GYP2_YEAST/29-160; GRAM domain  ali follow..  31.DGKGHSDRVNNKGRKTAYVYSGRLFLTPHFLVFRDA--FDHSSCVLILNISTIKRVESPSESYEFALLVTLYTGAKVLIQFIGIRYRSEQFCDKLKL 126
10 -8.170PF03517.13; D6WHX2_TRICA/33-160; Regulator of volume decrease after cellular swelling  ali follow..  1......................GTLFVSERTLSWQKDGTTGFSIEYYNVSLHAVSK.......................................... 34

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.