current user: public

If you have questions about the server, please let us know.

Query: PF14927.6; C3ZI62_BRAFL/87-231; Neurensin, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst QFGVRSYLHQFYEDCAGIRRNSLDSHPYDNPYLSDDFRYLINPKPRKSTYIWWKVAMVCGFSLIAFGAVALMAGYLVPQRRELVGYLGGVPVVDSAATDLNYKLDACKLAGLILLCVGGLTVAFSLLVPSFLHGYMEKELLMQESLast
1 -91.000PF14927.6; C3ZI62_BRAFL/87-231; Neurensin  ali  100  1QFGVRSYLHQFYEDCAGIRRNSLDSHPYDNPYLSDDFRYLINPKPRKSTYIWWKVAMVCGFSLIAFGAVALMAGYLVPQRRELVGYLGGVPVVDSAATDLNYKLDACKLAGLILLCVGGLTVAFSLLVPSFLHGYMEKELLMQES 145
2 -10.300PF16311.5; H2L5R6_ORYLA/1-133; Transmembrane protein 100  ali follow..  18  53...................................................CYRCTIPFGVVVLIAGIVVTVVAYS-----------------------FNSHGSTISYFGLVLLSAGLLLLASSAICWKVKLERKKERRRESQ. 122
3 -9.600PF10177.9; W5KY66_ASTMX/13-159; Uncharacterised conserved protein (DUF2371 topsan)  ali follow..  15  40....................................................SGMAAAFGVLVLMVGIAMAVLGYWPRENLAHTVSLQRVNDATINSFSNYQYSDNLKVFGPLVMGIGIFLFICANAV................. 132
4 -9.070PF15029.6; H0VXD9_CAVPO/9-242; Transmembrane protein 174  ali follow..  19  28..........................................................AGATLLFSGIFLGLVGIT-------------FTVMGWIKYQSVSHFEWTQLLGPILLSVGVTFILIAVMLSCQLCKESEERVPDSEQ 105
5 -8.890PF15345.6; M4AQD5_XIPMA/9-221; Transmembrane protein 51  ali follow..  14  10.........................................................ALGVGLVALGVVMIVWSLVPANTGFNNSSSGS---GDDGI---DGKRNKASSVAFVLAGSGVAMLLLSLCLGLRNKQREQLRRQEIQN 92
6 -8.220PF04713.12; Q8V3Q1_SWPV1/3-77; Poxvirus protein I5  ali follow..  13  10......................................................VSLTLLTIFMLACGGSLLFKTIAPHR-----------LVITRSVTFNKVVNFLEYVAILIFIPGTITLYSAYVRTLF.............. 75
7 -8.150PF04103.15; T176B_MOUSE/60-224; CD20-like family  ali follow..  16  1.........................................................SLGVTQILLGLVSCALGAILAGVGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNS........................... 84
8 -8.000PF00892.20; YDED_BACSU/160-296; EamA-like transporter family  ali follow..  17  67..............................................................ILFVILFGTMIAFWFPKETSLLGSLEPLSAVVTTVVWLKAPFGSFQWIGAICIIGITLILAL..................... 137
9 -7.850PF12650.7; S6A3B6_9SPIO/8-107; Domain of unknown function (DUF3784 topsan)  ali follow..  21  1........................................................FLSGVVMSIFGVLILIAGYNTMPA-------EKKKSYNPQQL--------AGKTGIFLYCIGAFTVIFGIIL................. 64
10 -7.520PF00822.20; EMP2_MOUSE/1-165; PMP-22/EMP/MP20/Claudin family  ali follow..  98.....................................................ERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKLYYLLQEGSYGYSF-ILAWVAFAFTFISGLM........................ 164

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35