Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF15232.6; I3KXN7_ORENI/2490-2562; Domain of unknown function (DUF4585 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst SYGQTPRRVLLDPETGKYFYIEVPVQPLRKMLFDPETGQYVEVLIPQQTMSHSGLYPPSAAPYPPLPNPSMYALast
1 -52.600PF15232.6; I3KXN7_ORENI/2490-2562; Domain of unknown function (DUF4585 topsan)  ali  100  1SYGQTPRRVLLDPETGKYFYIEVPVQPLRKMLFDPETGQYVEVLIPQQTMSHSGLYPPSAAPYPPLPNPSMYA 73
2 -7.620PF01092.19; Q5KIJ1_CRYNJ/1-126; Ribosomal protein S6e  ali follow..  19  2......KVNFSNPATGAQKLIDFEDERKTRIFMEKRMGQEVA............................... 37
3 -7.560PF16374.5; Q7N439_PHOLL/100-235; Cycle inhibiting factor (CIF)  ali follow..  15  79........LVNDRRLGHMFLIDIPSNDQETVIYQSDLGQGALPPLKIADWLNSRGKDAVSL............ 133
4 -7.390PF17780.1; A0A061DDG2_BABBI/740-790; OCRE domain  ali follow..  17  5........MTYDPNSDYFY------DHRLGVYYDAASGYYFT............................... 32
5 -7.180PF17161.4; Q8A0A9_BACTN/407-525; Domain of unknown function (DUF5123 topsan)  ali follow..  17  85ATGVTLDPGFTDAANGNFKVSNQ--TIIDNEIGDPR..................................... 118
6 -7.060PF03543.14; YOPT_YERPE/103-320; Yersinia/Haemophilus virulence surface antigen  ali follow..  19  148........HLSGQMSAHAIAAYVNEKSGV-TFFDPNFGEF................................. 178
7 -7.050PF17136.4; B0VI20_CLOAI/43-106; Ribosomal proteins 50S L24/mitochondrial 39S L24  ali follow..  13  2HMIKKHAKPTQQNPQGGIITMEAPIDASNVMLFNEKLNAVSKP.............................. 44
8 -6.930PF15644.6; R4M122_9ACTN/808-932; Papain fold toxin 1, glutamine deamidase  ali follow..  13  89..HGSFAFLMSAWEGGSAHAWAAVNHNGEILFVDPQSGR.................................. 125
9 -6.840PF13619.6; A9AYW3_HERA2/7-64; KTSC domain  ali follow..  16  9GYDPTTQTLEIEFKNRSIYYVDVPENVYNELMQAASHGSYFNGCIRGA......................... 57
10 -6.700PF14345.6; K9T8G4_9CYAN/17-196; GDYXXLXY protein  ali follow..  20  17.............FSGKTIVLQTPVDPY-----DLLRGRSLRLRYNISRVDALERLP................ 56
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;