current user: public

If you have questions about the server, please let us know.

Query: PF15313.6; H0V9E3_CAVPO/32-167; Hexamethylene bis-acetamide-inducible protein, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst WKPYYKLSWEEKRKFDERQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLCPRRAAKSDSSDEDFLEEAGEEDGGSDGMGGDGGEFLQRDFSETYERYHAESLQNMSKQELIREYLELEKCLSRMLast
1 -88.700PF15313.6; H0V9E3_CAVPO/32-167; Hexamethylene bis-acetamide-inducible protein  ali  100  1WKPYYKLSWEEKRKFDERQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLCPRRAAKSDSSDEDFLEEAGEEDGGSDGMGGDGGEFLQRDFSETYERYHAESLQNMSKQELIREYLELEKCLSRM 136
2 -8.910PF09323.10; Q5M538_STRT2/1-178; Domain of unknown function (DUF1980 topsan)  ali follow..  84............................................LLVPTVTLDANTVSAKGYHFPLAAGSDPNQANQEGTTTQYLRPDTSSYFTSSAYEKEMTKELAKYKGCETIQITTENYMEVMELIYLYPNDF 175
3 -8.050PF14176.6; H6NHA1_9BACL/140-251; YxiJ-like protein  ali follow..  14  14......................................PSRDISKMMVDFRHDFQKLGGQAICFNADFAEYCMVIAGTLSYVLTGKSNEIPQIQIDYIKLSFFTWYPQYKFIEGRMSEYKEFNRRYENNEEVRMLL 111
4 -7.570PF15482.6; L9KFK8_TUPCH/4-214; Coiled-coil domain-containing glutamate-rich protein family 1  ali follow..  30  178.....................................APPNTTQFIMDQ-------------------------------------------------------IYQDMQQQEELERQQRAQAGA........... 210
5 -7.450PF18607.1; A0A0J8YCS4_9BACT/15-106; ParA helix turn helix domain  ali follow..  13  9......................................................................................TEQIQTQKQEFSEDRYFQVYAKAALSKLPKFTRANVDYAVGEMEEN.... 54
6 -6.970PF03114.18; SH3G3_DROME/6-241; BAR domain  ali follow..  13  1.................................................................................................LKKQINKANQYMT-EKMGGAEGTKLDMDFMEMERKTDVT 38
7 -6.560PF10455.9; Q6CPI5_KLULA/40-383; Bin/amphiphysin/Rvs domain for vesicular trafficking  ali follow..  15  1..................................................................................................RLSILKRRHQLQ-ETLGTVHDSQLPIQYKFLEQKSDAL 38
8 -6.450PF10044.9; E2BKR6_HARSA/19-111; Retinal tissue protein  ali follow..  26  46..........................................................................................................DMNHLHQLGNLSMTGLISEVKRLHDLAYQL 75
9 -6.440PF08568.10; Q6CFU3_YARLI/1-673; Uncharacterised protein family, YAP/Alf4/glomulin  ali follow..  14  3.............................................LTDDHKKDLEKLGEEKGKEEHTVAGEDEEDVNHGADDSEDAEDEDAEDENDYTELDVDIVCQFIKDAAREAEKTGDYISYATVIDIHCSDP 94
10 -6.320PF15272.6; E7KJ61_YEASA/173-368; Spindle pole body component BBP1, C-terminal  ali follow..  17  31...........................................................................................REQFHRNEQTYKQAYEEMRAELVNELKKSKLFENYYSLGQKYKSL 76

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.