current user: public

If you have questions about the server, please let us know.

Query: PF15347.6; PHAG1_HUMAN/2-432; Phosphoprotein associated with glycosphingolipid-enriched, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst GPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRLLast
1 -114.000PF15347.6; PHAG1_HUMAN/2-432; Phosphoprotein associated with glycosphingolipid-enriched  ali  100  1GPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL 431
2 -11.700PF15332.6; W5NRL9_SHEEP/27-249; Lck-interacting transmembrane adapter 1  ali follow..  16  1..................................LCTACKQSRRQLSRLQGSAMPAEVSLLRRPHHCSLSKSDTRLHELHRSRPCSRAPRPASMDLLCPQWLEASR------------GMTRPPAPFSHQELPLAAPST-----------------GPEATYSNVGLATIP------------------------------------------RARLAVRPVVAEYACVQKFRGTDQGPQGLGQGKVEATPP---------------------------------------------------------TQVDILYSRVNKPKRRDPGPATDQPDPKGGGAILALGSDPAYEVLP-----------------------------------------------GGLAMDKSLLENVYESIQE.......... 223
3 -8.860PF16066.5; B4M7Y3_DROVI/86-225; Domain of unknown function (DUF4808 topsan)  ali follow..  11  4..TEEVLIVGLV-LILW--VGAIMLFF-IRMLE------QPKFQQQHRSSCPLVDIDAVPTHQRASVSRMSMGMVHNHNLNMPTCQFAAYKPSLYAKGYASHVSHVARPRQNSVFVGASTSHYLMPRPPRKTRSAMD...................................................................................................................................................................................................................................................................................................... 135
4 -8.680PF15807.5; E2R4Y2_CANLF/1-130; Membrane-associated protein 117 kDa, PDZK1-interacting protein 1  ali follow..  21  14.....LLSPAEAQQA-W-GLAAVVGFLFIVFVLMLCSKVRAQDEEDTGFRMCSNPQDVGVSEEGKREKIEEIKDTKGRKAEKEGERNLGLELEEQEEPRVEGKVTNTA................................................................................................................................................................................................................................................................................................................................... 129
5 -8.670PF11200.8; A7AQJ9_BABBO/2-370; Protein of unknown function (DUF2981 topsan)  ali follow..  1..SQGLFYIAIQQF-LLGSLTQLACVYLVFYLFLIFLTVLDMAEPRGPQLKDVSDFASIRSAALPSTALMRSNAFLRQRELPYAFDQNDSLELGDSFPALVSDDNKTLEDSISTASTDAEDNIPSKNLRMPQTEEMPINQHVGNDLNMPGNGAMPISGNIDAVTGNLEPASKAIQQTTPNVNESMKIPNEMPMPYGNSKEAKSAELPIAIPEQTVAKNTYDAKTETFYDRLPLVPHIGETEGEAEEVSKDELPPETHDLTPEGVSEVVAIYKIQKR........................................................................................................................................................... 319
6 -8.380PF14358.6; E1RE56_METP4/9-80; Domain of unknown function (DUF4405 topsan)  ali follow..  23  27GSGGAGKNPDYINSFIWVLFDWSALVFIILMVIHLAMHC........................................................................................................................................................................................................................................................................................................................................................................................................ 72
7 -8.140PF13131.6; Q81SD6_BACAN/1-52; Protein of unknown function (DUF3951 topsan)  ali follow..  32  3.....LLTIGAILLTLF-------IFFIIGFITFMCESVTVKSKGKHK............................................................................................................................................................................................................................................................................................................................................................................................... 52
8 -8.050PF15183.6; D4A897_RAT/1-89; Melanocortin-2 receptor accessory protein family  ali follow..  35  40.............IALWLSLAT---FVVLLFFILLYMSWSGSPQVRHSPQAYQ.......................................................................................................................................................................................................................................................................................................................................................................................... 76
9 -7.870PF01606.16; A0T1N0_PRRSV/1-212; Arterivirus envelope protein  ali follow..  11  23....AVVANSNATFCFWFPLVRGNFSFELMVNYTVCPLCPTRQAAAEILEPGKSFWCRIGHDRCSENDHDELGFMVPPGLSSEGHLTS....................................................................................................................................................................................................................................................................................................................................................... 106
10 -7.700PF07204.11; Q84142_9REOV/1-99; Orthoreovirus membrane fusion protein p10  ali follow..  16  26NTAGGDLQATSSLIAYWPYLA-----LIIIIIIVICLVCCCRAKVKRDATRSVFYRELLTLNSGKCNAAPPS....................................................................................................................................................................................................................................................................................................................................................................... 96

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24