Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF15970.5; B4EVM4_PROMH/3-83; HicB_like antitoxin of bacterial toxin-antitoxin system, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst NYPATSHFDEESETYEITYRDFDNIHAVAYTEDDIELEASDILHVGLEEFISSKMPIPMPSEPQSGDFIVYLPPISCLKIALast
1 -54.100PF15970.5; B4EVM4_PROMH/3-83; HicB_like antitoxin of bacterial toxin-antitoxin system  ali  100  1NYPATSHFDEESETYEITYRDFDNIHAVAYTEDDIELEASDILHVGLEEFISSKMPIPMPSEPQSGDFIVYLPPISCLKIA 81
2 -43.600PF15919.5; E1VAV2_HALED/3-129; HicB_like antitoxin of bacterial toxin-antitoxin system  ali follow..  21  1.YPIAIEIADEQHAYSVVVPDLPGCFSAGDTFDEAVANAREAIEGHLESLSDHGDPIPKTTTIEQ-KINVTLPELLIKRID 106
3 -22.600PF08972.11; A0ZK26_NODSP/6-80; Domain of unknown function (DUF1902 topsan)  ali follow..  10  1TIKVQAFWDAEASVWVADASNLPGLVTEAETIEQLTKKLEMMIPELME................................. 48
4 -13.600PF12910.7; A5CZB2_PELTS/1-145; Antitoxin of toxin-antitoxin, RelE / RelB, TA system  ali follow..  15  59TFNPVWEYDEENKLWSVTLPEIR-VYTDAPTKEEAAEQLVDLVLDYCEDYFNR............................ 110
5 -7.760PF05534.12; Q7MY97_PHOLL/58-110; HicB family  ali follow..  14  1.............................................YIETCEEEGIN-PFKEEDKLKSFTLRYPGWLEARLT 35
6 -6.280PF04083.16; Q7QH37_ANOGA/41-102; Partial alpha/beta-hydrolase lipase region  ali follow..  13  10.YYLEQHQVTTADGYILTMFRIPGSPANPVRQGKNVAFLMHGLLSSSADYVISG........................... 62
7 -6.150PF00814.25; TSAD_LISMO/31-317; Glycoprotease family  ali follow..  16  104KFPLLSLVVSGGHTELVLMKADNEFEIIGETRDDAAGEAYDKVARTLGLAYPGGVQIDKLAKDGEDTFHFPRAM....... 177
8 -5.950PF16482.5; W4Y2Y4_STRPU/607-714; Staufen C-terminal domain  ali follow..  12  40RPTQQLEYLAQVGGVSTKFNDFPKYRGVGATLEAAHDVAAITALRSLAGI............................... 108
9 -5.780PF15846.5; K7DZW6_MONDO/11-106; Domain of unknown function (DUF4720 topsan)  ali follow..  11  51................LDLEKFPNAFYINNEKPWPSSFHSDPMASAFADYEEQKNSFSN...................... 93
10 -5.730PF18482.1; A7TS28_VANPO/183-272; Fungal Pih1 CS domain  ali follow..  10  3KFEVSMRKTKSDQKFKLRI-EISTFIESSLDLSIKYNNSSNELNINLHDYNEQELKIPLPNIFNDKDI............. 72
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.