current user: public

If you have questions about the server, please let us know.

Query: PF16028.5; H9J6C6_BOMMO/80-156; Solute carrier family 3 member 2 N-terminus, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst DAKIELDANKRQFTGMTREEVLKYADDPFWVNLRWSLFVLFWVAWLCMLAGAIAVIVRAPKCGPPEPRTWYELGPLVLast
1 -73.700PF16028.5; H9J6C6_BOMMO/80-156; Solute carrier family 3 member 2 N-terminus  ali  100  1DAKIELDANKRQFTGMTREEVLKYADDPFWVNLRWSLFVLFWVAWLCMLAGAIAVIVRAPKCGPPEPRTWYELGPLV 77
2 -7.390PF17060.5; MPS2_ZYGRC/12-339; Monopolar spindle protein 2  ali follow..  12  207ELKRKLQEQTLAISNLKEQYSKRYNPLHNDGPMVLVLATLVFLTIILLIGSMIWVTGGKDDSNSFSQYSWWENNSLL 296
3 -7.370PF14351.6; H2IY93_RAHAC/394-722; Domain of unknown function (DUF4401 topsan)  ali follow..  32  1...........................PWYLRLTLSI----WVAAMIILFLLILVLYVAD................. 31
4 -7.230PF14851.6; I3K7X2_ORENI/8-165; FAM176 family  ali follow..  19  4...............LLSNSMATYA----HIKANPESFALYFMMGVCFLFMALCLLVAGITCRA............. 49
5 -7.170PF11014.8; Q6NAR7_RHOPA/21-142; Protein of unknown function (DUF2852 topsan)  ali follow..  27  1.....................LRSSWSPGWILLTVAGFIVWWPIGLALLF........................... 29
6 -6.890PF14410.6; L0I5A3_HALRX/310-385; HNH/ENDO VII superfamily nuclease with conserved GHE residues  ali follow..  39.......VEYYLQDVISEAEFRREYQNPDHYHPQ........................................... 65
7 -6.830PF12273.8; K1X614_MARBU/45-169; Chitin synthesis regulation, resistance to Congo red  ali follow..  21  1.................................RWVALILVVIFFLLMGYLFSITRRRRQRGLAPMYGTGWIPGT.. 42
8 -6.760PF07214.12; Q8ZQK2_SALTY/1-94; Protein of unknown function (DUF1418 topsan)  ali follow..  14  12...LILEYLGMILLALALLSLNHYLTLPAPFNTPLAGVLMVFLGVVLILPAAVAMMWRIAQLLAP............ 73
9 -6.660PF17161.4; Q8A0A9_BACTN/407-525; Domain of unknown function (DUF5123 topsan)  ali follow..  24  95.....TDAANGNFKVSNQTIIDNEIGDPRW............................................... 119
10 -6.250PF10966.8; Q65I17_BACLD/7-64; Protein of unknown function (DUF2768 topsan)  ali follow..  20  10..............GLMFLAVIAIYISRYKFKNRFLKIITSFVAYTCMLISGVIVFF.................... 52

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.