|
current user: public |
|
Query: PF16291.5; Q65N75_BACLD/114-202; Domain of unknown function (DUF4937 topsan, from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . | |||||||
# | Score | Template | Links and tools | %id | First | LKLIRCKSAEQKLQAFSEAQAKWAPLQNVSGFIRQWGGWMETEDGPEAVVLALWKSKHDYLNFMAEHHDEIYERTHQKGTFESINITLF | Last |
1 | -65.500 | PF16291.5; Q65N75_BACLD/114-202; Domain of unknown function (DUF4937 topsan | ali | 100 | 1 | LKLIRCKSAEQKLQAFSEAQAKWAPLQNVSGFIRQWGGWMETEDGPEAVVLALWKSKHDYLNFMAEHHDEIYERTHQKGTFESINITLF | 89 |
2 | -11.900 | PF08803.11; Q7CGF9_YERPE/4-99; Putative mono-oxygenase ydhR | ali follow.. | 10 | 1 | ILQVDFPYTGPWGNEMTKMEGLARSIAEEPGLIWKI--WTVNETTNEAGGIYLFSDISAAKAYLAMHTARLKSFGIPHVNGKIFLV... | 85 |
3 | -11.300 | PF11695.8; Q9A5F4_CAUVC/31-168; Domain of unknown function (DUF3291 topsan) | ali follow.. | 16 | 6 | VGRLKAPIDHPMIKDFDNLDRINALAEASPGFVWRLTG-AIDSDPLFIPNLSVWSDIPSLGAFVRSGHVEIMRRRRE............ | 91 |
4 | -10.300 | PF02281.16; Q7MP08_VIBVY/39-141; Transposase Tn5 dimerisation domain | ali follow.. | 7 | 30 | WHILYLNVNKRGGRYPKKLPKEVPTLKWAYQAVAKLGGFYDSKCTGIASWATMWLGWDKLQDMLS........................ | 94 |
5 | -10.300 | PF03992.16; HMOB_BACSU/65-140; Antibiotic biosynthesis monooxygenase | ali follow.. | 14 | 3 | AVLNNIAVTQEGRPLFENRKNRAGKVENEPGFEAI-----RPLDSDTYVILTLWETESAFQDWQQSGS..................... | 69 |
6 | -8.600 | PF07682.11; F4B4D5_ACIHW/1-294; Sulphur oxygenase reductase | ali follow.. | 12 | 5 | ......KNEPKTFEMFASVPKVCMVTARHPGFVGRYGGMTKESSSVRVLQYTFWKDWKDHEEMHRQNWSYLFRLCYSCAS......... | 97 |
7 | -7.270 | PF13826.6; G7XTL7_ASPKW/119-243; Domain of unknown function (DUF4188 topsan) | ali follow.. | 10 | 23 | ..........ELGDSAEKMQRDMRANPVKYGLLGS----CDSAAGNEFMTVFYLRDYAALHQFAHDIHMEGVRWWARI........... | 92 |
8 | -6.440 | PF16057.5; F6W4P7_XENTR/1587-1840; Domain of unknown function (DUF4800 topsan) | ali follow.. | 10 | 180 | ......SVLKQINSHHNTILRQWRSLLRL--LSCPRGAWADRNPPEVKWKISSAETYSRMRLKLVDPHDNL.................. | 254 |
9 | -6.400 | PF06139.12; Y9129_PARXL/1-133; BphX-like | ali follow.. | 21 | 44 | ............APIFTLLQDAWAVVGLQLGAIGAVALWGARDPGRYRAVIPV.................................... | 84 |
10 | -6.390 | PF00511.17; Q8UZ17_PSPVP/334-411; E2 (early) protein, C terminal | ali follow.. | 17 | 12 | VKCLRYRLRRHHRKAYRSCSTTWS--------------WDDLQDHTEHRICLSFYSEAQRVNFQKTVR..................... | 67 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review. |