current user: public

If you have questions about the server, please let us know.

Query: PF16472.5; R5URH3_9FIRM/40-322; Domain of unknown function (DUF5050 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst NTAGNLYNAGLFCEKNGTVYFANPDDDYRLYSMDTNGNHLKKLSYDRVMYINADDHYVYYVRNNENNGTGFDFFSYARNSLCRIDQNGENTKILDKDPCLYASLVGNYIYYLHYDDKDATTLYKIGIDGEGRKKVYSPYIFTCSTLGQYIYTSGTESDGAIYQLDTASDSLSKVYECNSFKPIVSDDNVYYMDVDQNNALVHTNMKSGHPVTLTKDSLDLYNVYGSSIFYQRYSEDNPALCMIKNDGSGYQELAQGNYSNINVTSSYIYFTDFKTKEMFCTPLast
1 -90.500PF16472.5; R5URH3_9FIRM/40-322; Domain of unknown function (DUF5050 topsan)  ali  100  1NTAGNLYNAGLFCEKNGTVYFANPDDDYRLYSMDTNGNHLKKLSYDRVMYINADDHYVYYVRNNENNGTGFDFFSYARNSLCRIDQNGENTKILDKDPCLYASLVGNYIYYLHYDDKDATTLYKIGIDGEGRKKVYSPYIFTCSTLGQYIYTSGTESDGAIYQLDTASDSLSKVYECNSFKPIVSDDNVYYMDVDQNNALVHTNMKSGHPVTLTKDSLDLYNVYGSSIFYQRYSEDNPALCMIKNDGSGYQELAQGNYSNINVTSSYIYFTDFKTKEMFCTP 282
2 -24.500PF14583.6; OGL_DICD3/1-386; Oligogalacturonate lyase  ali follow..  13  32ICHRNYFYQKCFSNDGSKLLFGAFDGPWNYYLLDLKTQQATQLTEGTGDNLSPDDDALYYVKNVR--------------NLMRVDLNTLEETNIYQYGTWVANSDCTKMVGIEIKKNPCCRLIRIDLKTGEATTILKENQWLGHPDDNTVAFCHEGPDARMWFINEDGSNMRKVKEHAPGEWVPNGSALAYVSYLKGSTICSVDPVTLENRQLTEMP-LMSNYDGTLMVGDGCNENDPFLYVFNMKTGKHFQVAQHNTSSFTPDDKHILFTSDVDGALYLAK 381
3 -12.600PF00930.21; DPP4_ASPFU/100-458; Dipeptidyl peptidase IV (DPP IV) N-terminal region  ali follow..  10  39PDQSGDIQYAQWTPTGDAIAFVR---DNNVFVWT-NASTSQITNDGGPDLFNGVPDWIYEEEILGDRFALWFSPDGAYLAFLRFNETGVPTFTVNEEIAPPYPRELELRYPKVSQTNPTVELNLLELRTGERTPVPIDAFDAKELIIGEVAWLTGKHDVKVVAVDVASLRSKTISERDGTDGWLDEYYIDISDQSGWAHLWLFPVAGGEPIALTKGNILSIDKPRQLVYFLSTKHHERHLYSVSWKTKEITPLVDDTVWSASFSSQGGYYILSYRG----VP 358
4 -10.900PF14339.6; R4LCK5_9ACTN/49-278; Domain of unknown function (DUF4394 topsan)  ali follow..  1...............................................................................KMATFTVDKPDTFDWVRNITGDFRPNDGQLYLVGDKG----GIYTIGIPSAVTTKVSQLQVPDFNPAANRLRVIS--DSGQDLRHNLDDHTTVSDPVLTTPPAS-TATTLFNVNTTADQVVIQSPANNGTLAATIYSTLSNGKTVNNTAFASVPYGGVSGLYSINLLTGEASFLGE........................... 221
5 -10.100PF17005.5; J8ZY85_EDHAE/6-349; WD40-like domain  ali follow..  11  8...........ISKNGQLIAFGGKSDTLTLAKFP-SLISITSETTDSIIYVKFILNDVILCATLDGN-------------LHVLENGEEVDNRDLEEDISFIDVINDLVVV----GTNKGSIHIFSQDLQNEILFVHSEIRDIKIIKGKLY---SLSESHYMIFDLTQGTLYKRSYKDFRTFNIVNKDLLFIGNEGESLLIKDNVVGSECTALVDDYLVSGGSGFSLTIINIKSPSNCFNLRFNVEGISKIVRLSKNIVGIATFCGKIAIGDVRSGETFKF. 267
6 -9.840PF06433.11; DHMH_METEA/68-409; Methylamine dehydrogenase heavy chain (MADH)  ali follow..  1..............NARRVFVYDPKHISQFYMIDGDTARVVGTADGGFLVVASDGSFFGQASTGKRTDYVELLDPQTNNPIADIELPNSPRFLVGTYPWMALTPNNKTLLFYQFSPQPAVGVVDLA-GKKFDRMIEVPDCYHIFPSSNDTFFMHC-RDGSLLKVGIGADGKSQTKRTEIFHYSPKSGRLVWPTYTG--KIFQIDLSSQDAKFLPAIEAFAYHRESDRIFLLKHKAPSRFLFVIDAKTGKNKIELKHEIDSVGVSQDQLYALSTGDKALYIF. 317
7 -9.560PF08662.11; A0A0D1CK95_USTMA/232-427; Eukaryotic translation initiation factor eIF2A  ali follow..  6..............................................................................................ADKIQIKWNKAGSALLFMTSTDHDKTNLYLMSVRGDFDCRVALDKEGEWNPNSKEFIVIYGYMPAKAVLFSHRVNVIAELGTQNFVAFNPQGRLFCIAGFGNSGTVDVWDRQELSKGKIFSMDASQWSPDGHFLLTATLSPRENGVKIWHCTGQLVHVDMIDELYQA..................... 196
8 -9.530PF06977.11; Q87UK6_PSESM/58-310; SdiA-regulated  ali follow..  21............................................................................................LEDDVSGLSFDPDRKSLFTV---TNQNPELVELSLDGRVLRRIAFGDAEAVEYISPGVYVISDERQLRLIQIHVDDSTKSLNAADEGLAYDSRGKRLFVARERDPVQIIEVRGKRDGKLSVRDLSSLQFDEVSGHLLAL--SDESKRILELDTTGRPIGSGS-PQAEGMAMDDEGTLYLVSEPNLFYVF. 252
9 -9.440PF16261.5; K9PI70_9CYAN/44-358; Domain of unknown function (DUF4915 topsan)  ali follow..  90.TTGDLNVHDVVLDDAENLIFVNTDFS-CLATISNDYSFVPLWQPPHLNGLAMRDGKPRYVTACSSTDTAAGWRNHRVKGGVVIDVQSNDIIATGLSMPHSPRWYNGKLWLL---NSGTGEFGYIESGKFVPLTFCPGFGRGLAFWGKYAVVGLSKLRSRPFSGLALETRLANEGKFPQCG-------LMIIDITNGEIVHWLQLSGVVEEL...................................................................... 300
10 -9.280PF09910.9; D5TZT5_THEAM/25-364; Uncharacterized protein conserved in archaea (DUF2139 topsan)  ali follow..  12  1..................VYYT-HEDSESIYRFELLGNGPAS-GGDTYNAVDYVDDKIYFIYKGRVNGGGEIDFRNKYSHIHEYDIAERRVRLVWSDSIHHYDPLSDSLLVARADGMRNLGVYKIDRNTGRAEQVSSVPALKGALYQEYACFD-KRGVDGVQCFDLVEKKLVKNYIEDWSKISIDGYPVERRGSGYATTGYT-----------------WHFFRGGLIVGNPAEPDIEELTFVRMFDFPGTPYAPHRSNALPIGGGILAVFNSYSHGYIH.. 279
11 -9.020PF02897.15; PPCE_RAT/7-423; Prolyl oligopeptidase, N-terminal beta-propeller domain  ali follow..  11  66....DYPKYSCHFKKGKRYFYFYNTGLQNLYVQDSLEGEARVFLDPNTLSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVTCMAWTHDGKGMFYNSYPQQDGKSYHVLGTDQSEDVLCAEFPDEELSDDGRYVLLEGCDPVNRLWYCDLQQGSNGI-FEGEYDYITNEGTVFTFKTNRNNYRLINIDFTDPDKVLVPEHEKDVLEVRSNFLVLCYLRNVKNILQLHDLTTGALLKTFPLDVGSVV-KDSEIFYQFTS----FLSP 398

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.