current user: public

If you have questions about the server, please let us know.

Query: PF16541.5; L2GD02_COLGN/38-169; Alternaria alternata allergen 1, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst LTDFDFHASYIFTTPAHQNSWGYVSFNVSNPVLDYTVSCSAASSRLNDFFYGEMVYDCKAPDGESATTSFTFSRPDGALALNQSWTCNDDPKYPARYTAKGGAVADLSCEETSWQNLNWTIGQVYSRREIKCLast
1 -66.400PF16541.5; L2GD02_COLGN/38-169; Alternaria alternata allergen 1  ali  100  1LTDFDFHASYIFTTPAHQNSWGYVSFNVSNPVLDYTVSCSAASSRLNDFFYGEMVYDCKAPDGESATTSFTFSRPDGALALNQSWTCNDDPKYPARYTAKGGAVADLSCEETSWQNLNWTIGQVYSRREIKC 132
2 -8.140PF00114.19; Q60163_MORBO/35-157; Pilin (bacterial filament)  ali follow..  21  96...............................................................................AADGVWSCTIDGSAATGWKDK----IPTGCT...................... 123
3 -7.700PF14155.6; F5YUG4_MYCSD/19-129; Domain of unknown function (DUF4307 topsan)  ali follow..  43.................DDQTVTVKISVTRSDPSRPAVCIVRVRAGDGSETGRREVLIPPSESSTVQVTTIVKSSQPPLM--DIYGC............................................. 111
4 -7.290PF16758.5; UL141_HCMVM/51-241; Herpes-like virus membrane glycoprotein UL141  ali follow..  17  78......................SLTFNVSTDTAG--------------------MYECVLRNYSHGLIMQRFVILTQLETLDQIWSCGMYRGFQRNYRADAEDCWKPACPDEE-PDRCWTVIQRY....... 191
5 -7.180PF13015.6; B6K4H4_SCHJY/349-504; Glucosidase II beta subunit-like protein  ali follow..  10  52......................EYRIRFYETVFQDDISLGEFVEQEGNILKYANGQKCWNGPPRSAQVKVECGKSNEIISVLEAQKCE-------------QMLSPAACSTTLYRKSLITEANEHPTPETI. 150
6 -7.170PF09590.10; Q66956_9RETR/5-596; Lentivirus surface glycoprotein  ali follow..  13  443...............NKSKSHGEARFRIRNEGTNTSLTCGSTANPVDCTMKANTMYNCSLQNGFTMKIEFNMTKAVEMYNIAGNWSCNSD-------IPPGWGYMNCNCTNSTSSSFP-------TCPKMAC 560
7 -7.070PF03498.14; Q6EZE1_ECOLX/49-197; Cytolethal distending toxin A/C domain  ali follow..  11  50........................TVKFVNVAQG---TCMEAFKN------GVIHNTCDDNSL------------------SQEFQLLPSTNGNVLIRSSALQ----TCIRADYLSRTILSPFAFTITLEKC 126
8 -6.770PF04092.13; F0JB87_NEOCL/229-366; SRS domain  ali follow..  11  8...............GKDSNPEPLKVEMTTDKNTLTIQCGSEGSLNPETYATQY---CDPEGEVGSCTLKKFED-----TFATSWWSKADDSRSATLT-ESEKQFLVGCIPKGSSANSLDAAQAAATTTSNC 132
9 -6.710PF15299.6; F6Q6D7_XENTR/180-406; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8  ali follow..  10  10....................................................................................WKSQYVPYDGIPFVNAGSRAIVMECKGAQPKKSAENDNMSGGLYKATC 63
10 -6.680PF15882.5; W5MIN6_LEPOC/50-341; Domain of unknown function (DUF4735 topsan)  ali follow..  107..........................LLLGTWKDNGTPCIVTK-------------SCRETMTRFGCPRYSLSHQLLYFMMGRMQGCSNILQGEHRQARANLTIRDYECSNMMKSNVEFEKDDIFIENIMLC 209

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.