current user: public

If you have questions about the server, please let us know.

Query: PF16782.5; J8Q2G5_SACAR/122-421; Nucleotide exchange factor SIL1, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst DDYEFSNDFKEIRSIFDSHSTLSSHDITVLEDKFDNVMEFAHDYKHGYKIIVHEFPLLANVSLNENLSLTLRELSTRVITSCMRNNPPVVEFIDERFAGFKGQVILALSNLNDSNHKFSNILIKRYLSILNELPVTSQDLPIYSTINLQNVYQRNGKDKQLQIKVLELISKILKTGVRKNEDPDEVLYKRNVQKWSPDLQEWANEFQAMAQDKEIDELHMRTFFDTLYNLKSIFKSDITINKAFLNWLAQQCKERQSNLDNGLHERDIEQDTFDKKLINSRHLIFGNPMAHRLKNFRDELLast
1 -98.700PF16782.5; J8Q2G5_SACAR/122-421; Nucleotide exchange factor SIL1  ali  100  1DDYEFSNDFKEIRSIFDSHSTLSSHDITVLEDKFDNVMEFAHDYKHGYKIIVHEFPLLANVSLNENLSLTLRELSTRVITSCMRNNPPVVEFIDERFAGFKGQVILALSNLNDSNHKFSNILIKRYLSILNELPVTSQDLPIYSTINLQNVYQRNGKDKQLQIKVLELISKILKTGVRKNEDPDEVLYKRNVQKWSPDLQEWANEFQAMAQDKEIDELHMRTFFDTLYNLKSIFKSDITINKAFLNWLAQQCKERQSNLDNGLHERDIEQDTFDKKLINSRHLIFGNPMAHRLKNFRDEL 300
2 -20.500PF08045.11; E9DYC2_METAQ/1-287; Cell division control protein 14, SIN component  ali follow..  16DGPKVRKGLRQVEGLLAQIPPRKDLGELSQDPAFREFFKLQEGFEWNVAMRLIRTLDRLMAKGSDGQNDLLILSALDLIQGVLLLHPPSKTLFSRE--QNMNLLLDLLE------PFNCPAIQSATLLTLVVALDTPSNTRTFEGLDGLLTVTSLFKSREVKLKLVEFLYCYLMPETPSIPRADQRDSVPAMLQRSPSKL--AGSSGLVTLTTEEKQELLSRHLSSVEDLVKDLKN................................................................ 283
3 -15.900PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  43EKKIPSAETYFHEEKIVVLGQNESLPIEKRAQAAQKIGLLAFTGGPPAGNFAAEYMEEVAHLLQDELAPKIKILLLQSVACWCYLNPVSQKRAKSL--QFIPILISFFEGRFESTINSYLLLKFWTCYVLSVMTNNLSCVKELKDHSALKYHLQMLAAEN............................................................................................................................................ 209
4 -13.900PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  72......................NGTCLDQLLKAIGIFLSAASGHRYLIEFLEVGGVLTLLEILLSQLKEEDKKESIKLLQLVANAGRKYKELICE--SYGVRSIAEFMA------SSKSEKAQRQVQILLDSLGHGNPKYQNQVYKGLIALLPC--TSPHAQQLSLQTLRVVQAIVGKSHPSIVEAVLGVLRSMELEVQYEAIQLIKDLTSYDV-----RPALLRGLVALLK.................................................................... 267
5 -12.000PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  3NSDDTVLSPQELQKVLCLVEMSEKPYILE--AALIALGNNAAYAFNRDIIRDLGGL-PIVAKILNTRDPIVKEKALIVLNNLSVNNSSVQLAGLRLLTNMTHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFEYKEVILKLLIIFENI................................................................................................................................ 203
6 -11.800PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  13  46...........SERLFNCLRTTNTDQITYCKNILKNILKFEKPDAPATKYHD------AVIEGLNHPTEDVRELCLIELERCSGTVNGVLALMDKE--DLLSYIARGMA-------DEHLKNAQIASNVFTNLAKHEAGLKVLFDSHLQSEFNALLKKDTVRMRVYDMYITVQAHSPKAFDV--------------CKESGIFEKLISELDGR--DVLVQMNCLELLTKLASISPSGLEDQKGVVTKLNNLLLEVETD.......................................... 264
7 -11.600PF08609.10; B8MTN3_TALSN/5-96; Nucleotide exchange factor Fes1  ali follow..  10  47...GGPSDADLMKESMAALLS-DEVDLENKMVAFDNFEQLVETIDNANNM.......................................................................................................................................................................................................................................................... 92
8 -10.800PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  10  38.....DKEHEQLKKLINLLRSSDDPNI--LAIAANDVGQYVKHYERGKKFVTDMGGKDRVMELMAHTNPEVRYRALLSVQQLVSQS...................................................................................................................................................................................................................... 116
9 -10.700PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H  ali follow..  153KLTSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFVQADGVKLLIPLISTQQSIQLLYETCLCI--LLSFYDAAVDYLSTT--RVMPRLVEVVK------GSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVAQAWTDEDLLDALNQLEIGL................................................................................................................................ 322
10 -10.700PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  241ENQTLRKDYEKTFKKYQGLVVKQEQ----LRVALYLLLNLAEDTRTELKMRNKNIVH-MLVKALDRDNFELLILVVSFLKK-LSIFMENKNDMVE--MDIVEKLVKMIP-------CEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKS........................................................................................................................ 406
11 -10.100PF11701.8; F6ZSU7_XENTR/243-434; Myosin-binding striated muscle assembly central  ali follow..  10  67DDLKCDAERENFHKLCEDYVRSEGHGMDGKLRSIQTVSCLLQPSEAGNRTLELTGIMESIISLCASEREIDQQVAVEALIYAA-GKAKRASFITANGVALLKDIYK---------KNENDAIRIRALVGLCKL....................................................................................................................................................................... 192
12 -9.150PF01602.20; Q22601_CAEEL/28-590; Adaptin N terminal region  ali follow..  1ELKRINKELANIRSKFKGDKTLDGYQKKKYVCKLLFIFLLGNDIDFGH---------MEAVNLLSSNKYTEKQIGYLFISVLIEQQSDL--------------MKLIVQGIRNDLTSRNPVHVNLALQCISNMGSRE--MVEAFCTDLPKLLVSGETIDFVKQSAALCILKLFRNSP-----------------DSFQPGDYASRIVHLLNDS--HMGVVTSAASLIEALSKKWPEEYKGAVPLAISRLSRIVTATYTDLQDYTYYFVPAPWLCVKLLRLLQNYPPPDDPSNKARLLECL 256

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.