current user: public

If you have questions about the server, please let us know.

Query: PF17017.5; L2GVI5_VAVCU/17-188; Aberrant zinc-finger, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst YKCLHSRCDLFYDSVLGLRRHISHYDHNLYYNAGYSLKCPVRKCDMELDNTDFLYSHFEKEHAPRLVAQLKDTLVRIKKTYETTNINYLELNASDNCVNLSIVMRENDLLKDVMCFVYPNGVMKINDIDKPDLIFCGIPGCGKHFKSVMAYKYHCQTYLHSFITLFDSYLast
1 -77.200PF17017.5; L2GVI5_VAVCU/17-188; Aberrant zinc-finger  ali  100  1YKCLHSRCDLFYDSVLGLRRHISHYDHNLYYNAGYSLKCPVRKCDMELDNTDFLYSHFEKEHAPRLVAQLKDTLVRIKKTYETTNINYLELNASDNCVNLSIVMRENDLLKDVMCFVYPNGVMKINDIDKPDLIFCGIPGCGKHFKSVMAYKYHCQTYLHSFITLFDSY 169
2 -35.200PF15909.5; G3VSV7_SARHA/22-119; C2H2-type zinc ribbon  ali follow..  15  2..CSSYGCRLAFPNPRELAQHLHSHLQPTQSMEGKRFHCSTPSCSETFPSMQELMTHTKLHYKPNRY------------------------------------------------------------------FKC--ENCLLRFRTHRSLFKHLHVCSDQSHSPA... 97
3 -34.100PF18868.1; V7CHV4_PHAVU/848-973; Zinc finger C2H2-type, 3 repeats  ali follow..  15  1..CAI--CLDSFTNKKLLETHVQERHHVQFVEQCMLLQCIP--CGSHFGNAEQLWQHVLSVHPVDF------KPSKAPEPQTLSTGEDSP------------------VKHDPGNSAPLENNSENTGGFRK--FVCRF--CGLKFDLLPDLGRHHQAAH.......... 125
4 -17.000PF17734.1; E2R8B3_CANLF/1-228; Spermatogenesis-associated protein 46  ali follow..  26  186YKCV--ACCRMYPTLHSLKSHIK-------GGFREGFSCKV--YYCKLKTLWG.................................................................................................................... 227
5 -14.400PF03145.16; B4QNB8_DROSI/191-380; Seven in absentia protein family  ali follow..  18  8FPCKHSGCTASLV-YTEKTEHEET----------RPYLCPCPGCKWQ-GPLDLVMQHLMMSHK.......................................................................................................... 65
6 -14.200PF04988.12; L8YBQ2_TUPCH/482-647; A-kinase anchoring protein 95 (AKAP95)  ali follow..  10  1....................................FVCSL--CKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTADFLQEYVTNKTKKTEELRKTVED--LDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAA--CDLFIPMQGIIQKHLKTMDH......... 119
7 -13.400PF12013.8; A0A0D1CRD4_USTMA/4-119; Orsellinic acid/F9775 biosynthesis cluster protein D  ali follow..  15  14..C--RSCATCLVREQSWRHHLRAKPHELLRESLQRFICHCGDCTYMTRRIKLMRDHLTVHD........................................................................................................... 115
8 -13.000PF12756.7; Q2ULX1_ASPOR/130-229; C2H2 type zinc-finger (2 copies)  ali follow..  14  1.RCLF--CNEKSSDLQQNTEHMFKTHGMFIPEKDYLVECLY--CHAVRNNPEGARTHMRDKG........................................................................................................... 74
9 -12.400PF18551.1; A0A0W0YXK1_LEGSP/105-294; Thaumarchaeal output domain 1  ali follow..  14  77QTC--SACDSGLLNIKNS--------------------CP--SCHSINIKPQKFVHCYTCGKIGPVPEFLRQERLVCSRC----NTRLRTLGVDYDKPMEDKLC--NDCGHYFA--------------EPEVNLVCL--VCHRTSSSRDLTSRRLYEYT.......... 189
10 -11.900PF09416.10; I1BQX9_RHIO9/91-242; RNA helicase (UPF2 interacting domain)  ali follow..  15  1HACKYCGCDRWFSRGNTSGSHIINH-HPESPLGDTILECYNCGCRNVFLLGFIPAKS................................................................................................................ 81
11 -11.800PF15135.6; F7F5S5_MONDO/19-277; Uncharacterised protein UPF0515 topsan  ali follow..  10  98FAC--QPCDFMW--------------WRRVPERKKVSRCR--KCKVKYDPVP------KDKMWGIAEFQCL----QCGHTFK-----------GFAQMGNPSPCYS--CGNPVLPNRILPPRRPQNERSRKHEHSCFA--ETCYNRQGSYEPGTSCVHPKSRK...... 217
12 -10.600PF05605.12; B9SAX0_RICCO/49-102; Drought induced 19 protein (Di19), zinc-binding  ali follow..  21  3YPCPF--CIEDFDLVE-----LCSHIDDDHPFESKPGICPV--CATRVG--VSMVRHLTTQHG.......................................................................................................... 54
13 -9.650PF15866.5; B4NED6_DROWI/112-319; Domain of unknown function (DUF4729 topsan)  ali follow..  19  2.....................................KCPLSNCDQMVF-PTGLLVHLLHKHSHSGTAKICDVFDHQPIRLHFDPWEYQCGQVH........................................................................... 57
14 -9.090PF04959.13; G3UA09_LOXAF/651-849; Arsenite-resistance protein 2  ali follow..  14  47............DPEQEVEKFVTSNTQE---LGKDKWLCPL--SGKKFKGPEFVRKHIFNKHAEK........................................................................................................ 94

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24