current user: public
If you have questions about the server, please let us know.

Query: PF17382.2; I1Q6A1_ORYGL/1-89; Uncharacterized Ycf70-like, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MVYGYGKSNMPHPNRKRKGTDTQYDYWEELLVMVSGLYALFCVFLVLFIFFDSFKQESNKLELSGKEEKKKLNGENRLSRDIQNLLYIKLast
1 -89.000PF17382.2; I1Q6A1_ORYGL/1-89; Uncharacterized Ycf70-like  ali  100  1MVYGYGKSNMPHPNRKRKGTDTQYDYWEELLVMVSGLYALFCVFLVLFIFFDSFKQESNKLELSGKEEKKKLNGENRLSRDIQNLLYIK 89
2 -9.140PF15102.6; TM154_HUMAN/24-165; TMEM154 protein family  ali follow..  20  51...........................LEFILMVLIPLILLVLLLLSVVFLATYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIF.. 111
3 -8.680PF11812.8; Q166A1_ROSDO/26-181; Domain of unknown function (DUF3333 topsan)  ali follow..  18  5..............KKRNAAETRFKAYGLIAISIGLLMLITLIFNIVSRGTGAFQQTFVTLEVSLPAD..................... 58
4 -7.980PF16101.5; W5N606_LEPOC/37-156; Proline-rich membrane anchor 1  ali follow..  14  44............SQTPEPSVPQMKPWWKEIVIIGTVGCAVLFLLLMVIICYKAIKRKPLRKEENGTSRGEAMSSRNNKALDANNAV... 119
5 -7.060PF06129.12; Q6TUW2_YMTV5/4-111; Chordopoxvirus G3 protein  ali follow..  13  1..................................LLTNLLFFIVFIIIAYCINY-YPTNKLQMAVKNLNYEYEVRKQQDTNFPQKL... 51
6 -7.030PF16883.5; Q2G176_STAA8/4-200; Domain of unknown function (DUF5080 topsan)  ali follow..  30  16.....................TAVMYSEKIVVLPIIIYAIVFVIIGITYIFDSYDQLTNFN............................ 57
7 -7.010PF15807.5; E2R4Y2_CANLF/1-130; Membrane-associated protein 117 kDa, PDZK1-interacting protein 1  ali follow..  13  14.........LLSPAEAQQATQYHLKPWLVGLAAVVGFLFIVFVLMLANRVWCSKVRAQDEEDTGFRMCSN................... 74
8 -6.980PF04608.13; A6VPE6_ACTSZ/27-170; Phosphatidylglycerophosphatase A  ali follow..  18  47LSFVAGCYLCQKTADDMGVHDPGSIVWDEFVGVWLCLSAVGAAAFAVFRFFDILKP-------IKIFDQKLENGFGIMIDDVLAAVY.. 135
9 -6.980PF06783.11; E7F7U5_DANRE/2-88; Uncharacterised protein family (UPF0239 topsan)  ali follow..  18  15........................TFFESLLRYGLFLGAIFQLICILAVIIPTSKGHEQPVETSDPADTRSTDQNRKAK.......... 69
10 -6.540PF05640.14; U3JEN6_FICAL/1-206; Na,K-Atpase Interacting protein  ali follow..  19  136.................SGCLLDYQYIEVVSSATQIFLALF--FVYACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTS 206
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.