current user: public

If you have questions about the server, please let us know.

Query: PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MTSAKEQAAIGRLLAFLQEWDNAGRAARSRILDNFIEANQGKMGPELELEFSQGASLFLARLTAWLRLSYMNGTCLDQLLKAIGIFLSAASGHRYLIEFLEVGGVLTLLEILGLSQLKEEDKKESIKLLQLVANAGRKYKELICESYGVRSIAEFMASSKSEKAQRQVQILLDSLGHGNPKYQNQVYKGLIALLPCTSPHAQQLSLQTLRVVQAIVGKSHPSIVEAVLGVLRSMELEVQYEAIQLIKDLTSYDVRPALLRGLVALLKPLast
1 -74.000PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali  100  1MTSAKEQAAIGRLLAFLQEWDNAGRAARSRILDNFIEANQGKMGPELELEFSQGASLFLARLTAWLRLSYMNGTCLDQLLKAIGIFLSAASGHRYLIEFLEVGGVLTLLEILGLSQLKEEDKKESIKLLQLVANAGRKYKELICESYGVRSIAEFMASSKSEKAQRQVQILLDSLGHGNPKYQNQVYKGLIALLPCTSPHAQQLSLQTLRVVQAIVGKSHPSIVEAVLGVLRSMELEVQYEAIQLIKDLTSYDVRPALLRGLVALLKP 268
2 -31.100PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  10  3...................................................NSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRD--PIVKEKALIVLNNLSV-NAENQRRLKVYMNQVCDD-TVTSRLNSSVQLAGLRLLTNMTVTNEYQHILAISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRAQVPSSLGSLFNKKYKEVILKLLIIFENINDNFKWEESEGSLFFFLK. 229
3 -30.900PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  11  285.LKMRNKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKN------------DMVEMDIVEKLVKMI-PCEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDN----YKQIAMCVLYHISM-DDRFKSMFAYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICLKMLMKRALKFKDPLLMKMIRNISQ-GPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLEYKLVPYLKDKLK. 544
4 -24.000PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  58.............................................................IVVLGQVLMNESLPIEKRAQAAQKIGLLAFTGGPPAGNFAAEYMEEVAHLLQDEELAPKIKILLLQSVACWCYLNPVSQKRAKSLQFIPILISFFEGRFESTIKSEI---------------------------NSYLLLKFWTCYVLSVMTCNNLSCDHSALKYHLQMLAAENWS-TENFAEVLYFLI.................. 225
5 -22.600PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H  ali follow..  14  97.NSLSGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISARPKMQNGIVPNGELTSTQDVLRGLVDWLCSQLRNTHPNCSVPTAMHCLATLLREQYVRALFVQADGVKLLIPLISSTQQSIQLLYETCLCIWLLS--YDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVQNTDEDLLDALNQLEIGL........................................................ 322
6 -21.300PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  14  1.....AAEKCKELVENISNASGDEIVAFLRDLSVLISSSPNIRD------------LASLIPSERLFNCL-RTTNTDQITYCKNILKNILKFEKPDAPA--TKYHDAVIEGLNHPT--EDVRELCLIELERCSGTVNGVLALMDKEDLLSYIARGM-ADEHLKNAQIASNVFTNLAKHEAGLKVLFDSHLQSEFNKTKDTVRMRVYDMYITVQAHSPKKESGIFEKLISELDGRDVLVQMNCLELLTKLASISDQKGVVTKLNNLLL. 259
7 -14.000PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  11  40....................................................................................................EHEQLKKLINLLRSSD-DPNILAIAANDVGQYVKHYERGKKFVTDMGGKDRVMELM-AHTNPEVRYRALLSVQQLVSQS......................................................................................... 116
8 -13.900PF16782.5; J8Q2G5_SACAR/122-421; Nucleotide exchange factor SIL1  ali follow..  23.......................................................................SSHDITVLEDKFDNVMEFAHDYKHGYKIIVHEFPLLANVSL-NENLSLTLRELSTRVITSCMRNNPPVVEFIDEAGFKGQVILALSHKFSNILIKRYLSILNELPVTSQDLPIYSTINLQNVYQRKDKQLQIKVLELISKILKTGVRKNEDPDEVLYKRNVQKWSPDLQEWANEFQAMAQDKEMRTFFDTLYNLKS. 232
9 -13.400PF13646.6; C3YB05_BRAFL/324-412; HEAT repeats  ali follow..  16  1..........................................................................................................................................................................................VSSLKKLLVDEDPNIRAVASIALGKTGTCTPD----IVEALVNLLKDEDRLVRESTCVSLGYL-----AQDAVPHVINAWR. 73
10 -13.300PF08045.11; E9DYC2_METAQ/1-287; Cell division control protein 14, SIN component  ali follow..  12  80..............................................LQEGFEWNVAMRLIRTLDRLMAKGSDGQNDLLILSALDLIQGVLLHPPSKTLFSREQNMNLLLDLLEPFN-CPAIQSATLLTLVVALIDTPSNTRTFEGLDGLLTVTSLFKSRSSREVKLKLVEFLYCYLMPETP-------------SIPRADQRDSVPAMLQRSPSKLAGAFNAESRRKRAGSSGLVTLTTEEKQELLSRHLSS------VEDLVKDLKP 286
11 -13.000PF01602.20; Q22601_CAEEL/28-590; Adaptin N terminal region  ali follow..  153.DSFQPGDYASRIVHLLNDSHMGVVTSAASLIEALSKKWPEEYKGAVPLAISRLSRIVTATYTDLQDYTYYFVPAPWLCVKLLRLLQNYPPPDDPSNK-AKNAVLFEAIALIIHMDSEPQLLVRACNQLGTFLSHRETNLRYL----ALESMINSLKTERDVSVRQRAVDLLYAMC--DRSNANQIVAEMLAYLETADYSIREEMVLKVAILAEKYATDYTWYVDVILKLIRIAGDYVSEEVWYRVIQIVVNDVQGYAAKTVFEALQ. 460
12 -12.700PF09759.9; Q5BC22_EMENI/804-903; Spinocerebellar ataxia type 10 protein domain  ali follow..  16  1.............................................................................LKKLVVLVLSSLVKCPEVQDQIRRYGGVETILSCTNFDAHNPYIKEHAVMCLKFLLEGNRENQKLIEELEAREVR.................................................................................................................... 76
13 -12.000PF12717.7; G8Y240_PICSO/105-271; non-SMC mitotic condensation complex subunit 1  ali follow..  13  2.............................................................................IRALAIRTMGCVRVAR------MVDFIEIPLKRTLS--DDNPYVRKTAAICVAKLFDLSPK----ACVEFGFLDQLRGLIKDSNPMVVANALNSLFEIKDMNVDSSLELIKTLLMCLNECTEWGRITILDTLTKYEASSSEEASHIIDRATPQLQHANPSVVLSSIKVI...................... 165
14 -11.900PF06685.11; Q8YLB6_NOSS1/1-246; Protein of unknown function (DUF1186 topsan)  ali follow..  10  2........QVEEILAQLEINTKTFPRLALEAAIEQREAITPILISTLDKLSEN-------------LEQLLEKEDYILHIHALYLLAQFR----------EESAYPTIIKFFSVPGDVALVTEDLGRILACVS------------GGRIEPIKQLIENSKNEYVRGAALEALLVLIAQEVITREQVIQYYAKLFSTLDKEDHYIQTTLVTNSA---QLCAVELQEQINRAFEQNSVDLFFIDQEDVSTYLVVEKEEAL.......... 220
15 -11.600PF11841.8; W4Z9X2_STRPU/133-288; Domain of unknown function (DUF3361 topsan)  ali follow..  14  1.............................................................................................TFAQDFISNHGIELLVKMVEEGSQNGEPLSLTLKSFIELMDHNVISWDSL-SANYVKKIASFVNRSSDFQVTERALNILESSILNSTKLYNVIANETQHLENVQNPGIQQNCLALMNALCLKAPEDR................................................ 134
16 -11.500PF12530.8; D8SAX6_SELML/484-706; Protein of unknown function (DUF3730 topsan)  ali follow..  10  1........................................................................................................LFSLKYHQR-HDVNTNVVIAFLNALPDICGHPTTVPLSM------HLLQHMVDYKGNLRIQATSIRLIYKIWQHTDRAYSFLQKTLVPSWFSQAKDVLLSRATSLRDLCGHDPDVGIELILSVQACVECRSPVVKALGLQSLSFLCGHDASPSISESFCMLLK. 178
17 -11.100PF05918.11; D7TJH2_VITVI/11-547; Apoptosis inhibitory protein 5 (API5)  ali follow..  14  1.............................................................................................................................IEKLYEYGERLNEAKDKSQNVEDYRGIIAAA--KGSIKAKQLAAQLIPRFFKFFPDLSDAAVDSHLDLCEEEELGVRVQAIRGLPLFCKDTPEYVSKIVDILAQLLTAEENVERDAVHKALLSLLRQDVKASLTGLFKHIMT. 140
18 -10.500PF11701.8; F6ZSU7_XENTR/243-434; Myosin-binding striated muscle assembly central  ali follow..  12  22...............................................................................................MTLWVIDTGLKKILEVGGS-SVTESTRMSASVLLNKLFDDLKCDAERENFHKLCEDYVRSLFEGHGMDGKLRSIQTVSCLLQGPSEAGNRTMESIISLCASEREIDQQVAVEALIYAAGKAKRASANGVALLKDIYKNENDAIRIRALVGLCKL................... 192
19 -10.300PF11865.8; Q7S6V7_NEUCR/738-897; Domain of unknown function (DUF3385 topsan)  ali follow..  11  12........................................................................................................LEILQSIIRGEPQHGTLRQETIKLMGILGALDPYKHQVEERT------DDNKRNNEAAQLTDVSLMMGGLTPSNEDYYPTVVINALLQILKDQSGNVVDAIMSIFITLGLKCVQFLDRVVPAFISVIRASSNARLEFYFNHLSRLVS................. 157
20 -10.200PF08569.11; I1JJR7_SOYBN/4-337; Mo25-like  ali follow..  10  70TREFFKDDTFRLFILYLSNLKLGARQDATHVIANLQRQRVNSQLIASQYLEKN------LDLVDMLIGGYEKEGDIALTYGAV--ARECIRHQSVARHVLESEHMKKFFDYIQLPN---EIASDAVATFKELLTRHKSTVAEFLSKN-FKEYNSQLLESTSYFTRRYAIKLLGDMLLDRSNAAVMVMRILMNLLRDSNKTIQLDTFHVFKLFVANQNKP-----PEVVSILVTNKHKL----LQFLDNFNNDKADEHFQADKQQVIS. 328
21 -9.990PF12755.7; C4QYN7_KOMPG/59-156; Vacuolar 14 Fab1-binding region  ali follow..  14  1..................................................................................................................................................................NSRNGGLIGLAATAIA-PKYLEKIIHPVLACFGDQDARVRYYACESLYNISKVAKGE-NEIFDNLCKLTADSEVSVKKGAD-LLDRLIKD................ 98
22 -9.930PF01347.22; VIT_ICHUN/18-588; Lipoprotein amino terminal region  ali follow..  289........IHTVLKHLVENNQLSVHEDAPAKFLRLTAFLRNVDAGVLQSIWHKLHQ---KDYRRWILDAVPAMATSEALLFLKRTLASEQLTSAEATQIVTRESLSYARELLHTSFIRNRLRKTAVLGYGSLVFRYCANTVSCPDE--LHDLLSQSSDRADEEEIVLALKALGNA--GQPNSIKKIQRFLPGQGKSLDEYSTRVQAEAIMALRNIAKRDPRKVQEIVLPIFLNVAIKSELRIR-SCIVFFESKPSVALVSMVAVRLR. 555
23 -9.780PF12348.8; B8M2E9_TALSN/325-551; CLASP N terminal  ali follow..  8..............................................................MLPHFEGRETEHNWIPREKSVETLRRLVRGNAPQTY---IAGIKSLLDGILKNSLRTTLSTTGCLLIQEIAKVCGPGIDNMVEI-LLQNMIKLCAGMKKI-SAQNANATVDAIIS-NVTYVPRILQHLSFACQDKNVQPRLFAAGWLKTLLNKQARHKDLVEKCIKKCLGDPNPGVRESMRGTFWTFYKIWPDR--AEEIISTLDA 220
24 -9.530PF05004.13; T1J854_STRMM/21-332; Interferon-related developmental regulator (IFRD)  ali follow..  44......IDKLKDAIDGATQKNAKGRQTCLESIQNVLSRK-------LPDVIDTRRETITECIKSSLKR---KVDEQSAAAILAVLTCIQLGPGSSSDSMFAE-LCPVLTTSLNDKSLTFKTRGTCATALA---------------------LLALIIGEMEQGTIISLMSTFEALFSASYFKG----NGTVPNHALEVTALHSSALAAWSLLLTVVSINDERHVMRLSELLESSDVELRIVAGETIALLYEGETLDDLSFKLKQLAT. 286
25 -9.410PF14500.6; R4X873_TAPDE/43-304; Dos2-interacting transcription regulator of RNA-Pol-II  ali follow..  11  1.........VSDLGDYLIEEDVSLRSKAMRLLEGVLGALPRDNLSGQHVTV----------MVQFFCDRL---SDDACTMEALSALVSLSRMRFFAPEDADKVASFVIGRTEGFNNLPQRTRFYLYTLYERLMSTHRKALRTL-DSQFVSGFMSLISGEKDPRNLMLAFSIMRIILAE---NIDDSIENIFDSVNEPSTITTEDLKMRLRQCLSATPKFAPFLIPALIEKLNAVAVSVKKDTLLTLVACCDIYESSIMDTYNNELWV. 254
26 -9.150PF14225.6; A0A0C4DMH7_MAGP6/2022-2272; Cell morphogenesis C-terminal  ali follow..  12  1..........PQLCACLDSINEREFLGGVEMLNEYLDKSSPSVQRLLLDGRPPKWEGYFEGLQPLLYKGLRSSVCLEATLATLDRLALLQGDDECSIFFTIAANLPRFLHAMDQPRPLDESVARTAEVLRGVAVEN--------NHSPVALVLTGFLSGNYQTGKELIQATFSAFKES-AQLDFRMVVMIMGFLTNRISWVKIKTMKVLHVIISEIDMRRSDLLSPLLRLLQS---EYCMEALHVLDNIMN................. 248

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.