Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF18021.1; A0A0C3Q319_9HOMO/149-241; Agglutinin C-terminal, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst YFVLPYELRKSIWEGTALQRQNVRKHVFDYDNFVIKAKDAVISWGRDRLLVDEFSILFGVVYGNARTGPKAYNWYLSSGMHDLMFFDAQTGQELast
1 -69.500PF18021.1; A0A0C3Q319_9HOMO/149-241; Agglutinin C-terminal  ali  100  1YFVLPYELRKSIWEGTALQRQNVRKHVFDYDNFVIKAKDAVISWGRDRLLVDEFSILFGVVYGNARTGPKAYNWYLSSGMHDLMFFDAQTGQE 93
2 -58.200PF18022.1; A0A0C2WFZ8_9HOMO/318-415; Ricin-type beta-trefoil lectin C-terminal domain  ali follow..  31  7CIICPQEVIDTVWRNQGLQNRESRPELYDSDYFAFQMKGAMCDWVQDNLRAP-VGLLFGVMFGENNNGKHAYNWSLNQDLTAVTFFEPQNG.. 97
3 -12.500PF15644.6; R4M122_9ACTN/808-932; Papain fold toxin 1, glutamine deamidase  ali follow..  13  82..............................................TQLINGGHGSFAFLMSAWEGGSAHAWAAV--NHNGEILFVDPQSGR. 125
4 -10.000PF06035.11; Q92QC1_RHIME/32-193; Bacterial transglutaminase-like cysteine proteinase BTLCP  ali follow..  12  76............................DCEDYVLLKRRRLIESGFSPADLL-------TVVLQPNGDGHAVLTVRTD--RGDFILDNMRSK. 131
5 -8.730PF03543.14; YOPT_YERPE/103-320; Yersinia/Haemophilus virulence surface antigen  ali follow..  18  146...........................................................KIHLSGQMSAHAIAAYVNEK-SGVTFFDPNFGE. 177
6 -8.070PF04473.12; Q5JHU4_THEKO/395-551; Transglutaminase-like domain  ali follow..  11  79.............................CGDYAILTAAMLLDSGVSPVYLLDISF-------ENSKVGHAAVAVKIE--GELFVLDQHLP.. 131
7 -7.800PF11978.8; H2ZJH1_CIOSA/56-175; Shoulder domain  ali follow..  16  55.............................CKAIASRIRGAVASVTFDDFHKNSSRIIRSSVFGVDDKGKVRGSFEFPQNRLVVTSIDIQS... 115
8 -7.020PF07906.13; Q327D9_SHIDS/1-264; ShET2 enterotoxin, N-terminal region  ali follow..  86..............EEKAINVPGIIYFVENGSWGDIIYHIFNEMIFHAEKNRALEIS---------TSNHNMALGLKIKETKIQLYDPNH... 158
9 -6.870PF14481.6; A4VI65_PSEU5/2-107; Type 4 fimbrial biogenesis protein PilY2  ali follow..  10  12..VAFTANAETFEISGAVQRIELETSLITIDGKRYQLPNRVPESLVPTGGPVIYQLRPGSVIAASGSYATPFPKL-----DSVAILRQPSPEE 97
10 -6.600PF17838.1; H2UDE2_TAKRU/444-559; PH domain  ali follow..  41..............................TDVLVFLQEKDQRYIFSCLDKPAVLSLQNLIVRDIANQERGMFLIIDSSPPVMYEFHATTKEK 103

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.