|
current user: public |
|
Query: PF18305.1; U5W821_9ACTN/294-380; 3` to 5` exonuclease C-terminal domain, from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . | |||||||
# | Score | Template | Links and tools | %id | First | GPPPPHRWAERDPIAAARLQRCRQVVISTAEAHTLPPENLISPDFIRRLAWSPPEEVTPQAVADTLLGFGARNWQVVLLADNIAKAL | Last |
1 | -50.800 | PF18305.1; U5W821_9ACTN/294-380; 3` to 5` exonuclease C-terminal domain | ali | 100 | 1 | GPPPPHRWAERDPIAAARLQRCRQVVISTAEAHTLPPENLISPDFIRRLAWSPPEEVTPQAVADTLLGFGARNWQVVLLADNIAKAL | 87 |
2 | -7.720 | PF00570.23; Q8G567_BIFLO/575-642; HRDC domain | ali follow.. | 21 | 3 | ................SLFQKLRELRRTIAQEIGKPPYIVFSDKTLRDMA-----RIKPVTNAQFLAVNGVGQHKLDLYGQRFMQAI | 68 |
3 | -7.430 | PF11408.8; A7TDN2_VANPO/1149-1228; Sgs1 RecQ helicase | ali follow.. | 16 | 7 | ................FAFERIKAAVVEISNRSNLPLSTYMPVNAIKKIATFLPATEDE............................ | 49 |
4 | -7.400 | PF14430.6; H5X666_9PSEU/12-139; Immunity protein Imm1 | ali follow.. | 23 | 90 | .............................THEREVPTNAEITWPTVRQA------------VHDYVASGGARPWR............ | 127 |
5 | -7.050 | PF15205.6; G1M2V3_AILME/33-106; Placenta-specific protein 9 | ali follow.. | 25 | 9 | GDPTWNAGCDRYMAVHDRLDVIEETVEKTVEHLEAEVKGLL--GQLEELAWSLPPG............................... | 62 |
6 | -6.970 | PF10022.9; C7Z3K4_NECH7/14-395; Uncharacterized protein conserved in bacteria (DUF2264 topsan) | ali follow.. | 21 | 80 | ...........DPESPDYWGPIKSFDQRMVEAEMISFALLASP---RELLWERLSQKAQQNLITWLSGLHGKDWLW........... | 146 |
7 | -5.810 | PF10752.9; D3FXJ5_BACPE/1-83; Protein of unknown function (DUF2533 topsan) | ali follow.. | 14 | 40 | ........KKGLHISLNEVNAITKEMNQIAQDFYFPPRKEVTTDMVREYI..................................... | 81 |
8 | -5.650 | PF14818.6; G5C4S2_HETGA/1-142; Domain of unknown function (DUF4482 topsan) | ali follow.. | 15 | 10 | ...TETNWHKEKMELLDQFDNERKEWESQWKIMQKKIEELCQEVKLRR....................................... | 54 |
9 | -5.410 | PF13783.6; F5YA13_TREAZ/2-62; Domain of unknown function (DUF4177 topsan) | ali follow.. | 16 | 18 | .........................................................DPARLEMALNAYAEQGWRVISCTTG..... | 42 |
10 | -5.400 | PF17853.1; A0A0D5ABH6_9NOCA/181-307; GGDEF-like domain | ali follow.. | 15 | 28 | ......VWMRELDADRDALPELERVARQMCETVEGRPNPLFVAADRLSAVW.................................... | 73 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26; |