current user: public

If you have questions about the server, please let us know.

Query: PF18429.1; Q6LUG9_PHOPR/33-97; Domain of unknown function (DUF5609 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst QKASWLLYGRHITELDVYKIGDSAGQALDIVAAWKVGSYDALLIGNELTDAFAAAVVSQKLDFSRLast
1 -65.900PF18429.1; Q6LUG9_PHOPR/33-97; Domain of unknown function (DUF5609 topsan)  ali  100  1QKASWLLYGRHITELDVYKIGDSAGQALDIVAAWKVGSYDALLIGNELTDAFAAAVVSQKLDFSR 65
2 -6.280PF17617.2; US10_HCMVM/25-185; Viral unique short region 10  ali follow..  33  107................VYDSGTPMGVLMNLTYLWYLGDYGAIL...................... 133
3 -5.490PF06468.13; E0W462_PEDHC/207-401; Spondin_N  ali follow..  28  30...SDVIGATHRTNFSFWGEGQIASDGLRQVA--EWGSARNLE...................... 67
4 -5.260PF04483.12; K9S419_9CYAN/51-110; Protein of unknown function (DUF565 topsan)  ali follow..  37  37...........IDSLNAFKLGLIYSLFLE---AFKLGS........................... 60
5 -5.060PF03631.15; Q8YVB1_NOSS1/27-284; Virulence factor BrkB  ali follow..  20  211.....ALFRLYVANFGNYNKVYGAVGTVIVLMLWLWMSAAVLLIGDQLNVTVG............ 258
6 -5.050PF09013.10; A8TCD3_9VIBR/3-122; YopH, N-terminal  ali follow..  30  14................AQENGDATGKLRGAVAANTQGSFQGLTVSNGAREAFAMDILKH...... 59
7 -5.020PF03937.16; Q2YKJ9_BRUA2/15-86; Flavinator of succinate dehydrogenase  ali follow..  16  2RKLLFRAWHRGMREMDLI-LGQYADKYIVSFNDDQLNEFEHIL...................... 43
8 -5.010PF08711.11; A5DW53_LODEL/24-75; TFIIS helical bundle-like domain  ali follow..  23........GIAVNKYRTHSNAQVSLLVKKMIRGWR.............................. 49
9 -5.010PF10356.9; Q6BJ13_DEBHA/52-255; Protein of unknown function (DUF2034 topsan)  ali follow..  30  19.........SLLNCCSLTRIGGSFDQGIDILGKWNLGHY.......................... 48
10 -4.970PF00996.18; I1K489_SOYBN/1-433; GDP dissociation inhibitor  ali follow..  21  4.....................................EYDVIVLGTGLKECILSGLLSVD..... 26

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.