current user: public

If you have questions about the server, please let us know.

Query: PF00244.20; G1K9B0_ANOCA/9-229; 14-3-3 protein, from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst KAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDGNDKKMQLVKDYREKVESELKSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVASGDDRKQTIENSQAAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTLast
1 -93.800d3mhra1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  72  10.AKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNESEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT 231
2 -80.700d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]}  ali model 3D-neighbors follow..  25  2...............DVIKVLTESSDFRDNSLILLLAGSLRNRVTSIRNSLKSIKSQEEKLRKEKEFIQVIEDIKRDFEESILLESEDVIRIIDDNLLMYS-EEGARAFCIKLKGDLMRYKAEILKDEEKNQCIKQAVEFYEDALQRERSEKYPSDPLYLATILNYTILKYDLLGNPEGAMKFANRAIQAAE-NSRSDSEQFSENTEKLLKILRDNVSQWE 211
3 -80.100d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]}  ali model 3D-neighbors follow..  18  10RAQVFEWGGCFDKMFEALKSLIYLNSEFDDEERHLLTLCIKHKISDYRTMTSQVLQEQTKQLNNDELVKICSEYVFSLRKDIKAFLQSFEDCVDRLVEKSF---FSKFFKLKVKSDISRYKLEFGLCSLE-----DSKKIHQDAFTLLCEHPDKIEQLPLGFIQNLAYILSEKYGEKKQVFNMLNSLGKILELQIKEQENDRKAQITVYLQGIK....... 220
4 -6.310d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  18  14......................................................................................EQIRQDAENTYKSNPLDADN----LTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVW--CIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAV-DEQPDNTHYLKSLEMTAKAPQ....... 134
5 -6.110d3txna1 a.118.8.9 (A:38-322) Proteasome regulatory subunit Rpn6, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  14  17.GELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWAKQEKR-TFLRQSLEARLIAL-TEALALGAQLLLKKLDDKNLLVEVQLLESKTYHALSNL----------PKARAALTSARTTANA-IYCPPKVQGALDLQSGILHAADERDFKTAFSY----FYEAFEGFDSVDSVKALTSLKYMLLCK....... 221
6 -5.910d1w99a1 f.1.3.1 (A:84-276) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, Cry4Ba [TaxId: 1428]}  ali model 3D-neighbors follow..  1.....TPERVWNDFMTNTGNLID--QTVTAYVRTDANAKMTVVKDYLDQYTTKFNTWKREPNNQSY--------RTAVITQFNLTSAKLRETAVYFSNLVGYELLLLPIYAQVANFNLLLIRDGLINAQEWSLARSAGDQLYN----------------------------TMVQYTKEYIAHSITWYNKGLDVLRNKSNGQWITFNDYKREMTDILALFA 182
7 -5.830d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  31............RYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKASYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGG-------LVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWG 236
8 -5.730d4atma_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  19........EQFEEYVQNFKRQEAEGTRLQRELRGYLA-AIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDESLLTLDTYLGQFPDIKNRI---RKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQK--------------VFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMT... 214
9 -5.490d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  11  12........EIFDDHLNNFNRQQASANRLQKEFNNYIR-CVRAAQAASKTLMDSVCEIYEPQWSGYDALQAQADFAHKLGDQVLIPLNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANANKRKDDVKLLEEARRTYEILNTELHDELPALYDSRILF---LVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATESQR................. 217
10 -5.490d1dlca3 f.1.3.1 (A:61-289) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId: 1444]}  ali model 3D-neighbors follow..  39...IWPSEDPWKAFMEQVEALMD--QKIADYAKNKALAELQGLQNNVEDYVSALSSWQKNPVSSRN-----PHSQGRIRELFSQAESHFRNSMPS-FAISGYEVLFLTTYAQAANTHLFLLKDAQIYGEEWGYEKEDIAEFYK----------------------------RQLKLTQEYTDHCVKWYNVGLDKLRGSSYESWVNFNRYRREMTDLIALFP 224

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.