Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family, from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst LISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYKLast
1 -22.700d2hzaa1 a.43.1.3 (A:1-48) Nickel responsive regulator NikR, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  41  4.VTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQ 42
2 -22.500d2wvfa1 a.43.1.0 (A:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}  ali model 3D-neighbors follow..  30  5.FSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVE 43
3 -22.300d2bj7a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  38  6.FSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIR 44
4 -11.400d2cpga_ a.43.1.3 (A:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}  ali model 3D-neighbors follow..  21  5.LTITLSESVLENLEKMAREMGL-SKSAMISVALENYKKG 42
5 -9.290d2gpea_ a.43.1.11 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  4TMGVKLDDATRERIKSAATRID-RTPHWLIKQAIFSYLEQ 42
6 -7.140d1p94a_ a.43.1.3 (A:) Plasmid partition protein ParG {Salmonella enterica [TaxId: 28901]}  ali model 3D-neighbors follow..  7  37.VNVNFDEEKHTRFKAACARKG-TSITDVVNQLVDNWLKE 74
7 -5.310d1baza_ a.43.1.1 (A:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}  ali model 3D-neighbors follow..  13  6.VNLRWPREVLDLVRKVAEENGRSVNSEIYQ......... 35
8 -4.880d1mnta_ a.43.1.1 (A:) Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]}  ali model 3D-neighbors follow..  16  7.FNFRMPMEVREKLKFRAEANGRSMNSELLQ......... 36
9 -4.500d1y9ba1 a.43.1.9 (A:3-83) Hypothetical protein VCA0482 (VCA0319) {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  10  6.ITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQ 44
10 -3.710d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal domain {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  12  4.LKVHFVDEATEVEKRATLQELHVRRGDITEYMVRSTEVR 42
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.