Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF02961.14; C3XZ01_BRAFL/2-89; Barrier to autointegration factor, from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst SSTSQKHRDFVGEPMGDKPVTALAGIGGTLGGRLEEEGFDKAYVVLGQFLVLKKNEELFKEWLKSACNANSKQSGDCYTCLKEWCDAFLast
1 -61.600d1ci4a_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  75  2.TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF 88
2 -10.000d2z43b1 a.60.4.1 (B:12-72) DNA repair protein Rad51, N-terminal domain {Sulfolobus solfataricus [TaxId: 273057]}  ali model 3D-neighbors follow..  17  1.................KTINDLPGISQTVINKLIEAGYSSLETL----------AVASPQDLSVAAGIPLSTAQKIIKEARD..... 56
3 -9.340d1z4da1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  19  1...................LTDLPGVGPSTAEKLVEAGYIDFMKI----------ATATVGELTDIEGISEKAAAKMIMGARDLCD.. 57
4 -9.280d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  13  9................STDIQYAKGVGPNRKKKLKKLGIETLRDLLEFFPRDYEDRRKIFK........................... 53
5 -8.330d3ldaa1 a.60.4.1 (A:78-144) DNA repair protein Rad51, N-terminal domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14  7..................EKLQVNGITMADVKKLRESGLHTAEAVAYA-----------RKDLLEIKGISEAKADKLLNEAAR..... 61
6 -7.470d1u9la_ a.60.4.2 (A:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  6.................DTFTKYLDIDEDFATVLVEEGFSTLEEL----------AYVPMKELLEIEGLDEPTVEALRERAKNALAT. 65
7 -6.950d3f4wa_ c.1.2.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  10  153..........MLKVRRKARIAVAGGISSQTVKDYALLGPD--VVIVGSAITHAADPAGEARKISQVL..................... 207
8 -6.810d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  1................TSSLETIEGVGPK-----------RRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIFWSLKH..... 56
9 -6.780d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  76KAPKLENTAFAVFSLGDTSYEFFCQSGKDFDSKLAELG---GERLLDRVDADVEYQAAASEWRARVVDALKSRA.............. 146
10 -6.780d1t94a2 e.8.1.7 (A:75-407) DNA polymerase kappa {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  265.......RQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSL.................................. 311

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9.