FFAS03 results for PF03519

Query: PF03519.14; W0HTY6_9GAMM/17-94; Invasion protein B family, from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.

						`. 10 . 20 . 30 . 40 . 50 . 60 . 70 .`
#	Score	Template	Links and tools	%id	First	`GCDPSLLGNFDSHSTIALDFNDMPSIYISSSDDDIWLWSRIAEYQDTILEQCSYNLLKELLEGAEYIRGGHFSLAENE`	Last
1	-43.600	`d1ry9a_ d.198.1.1 (A:) Surface presentation of antigens protein SpaK (Spa15) {Shigella flexneri [TaxId: 623]}`	`ali model 3D-neighbors follow..`	29	18	`GCPPSIITDLDSHSAITISLDSMPAINIALVNEQVMLWANFDAPSDVKLQSSAYNILNLMLMNFSYSINELVELHRSD`	95
2	-43.600	`d2fm8a1 d.198.1.1 (A:1-134) Surface presentation of antigens protein SpaK (Spa15) {Salmonella typhimurium [TaxId: 90371]}`	`ali model 3D-neighbors follow..`	46	18	`GCDPSLIGGIDSHSTIVLDLFALPSICISVKDDDVWIWAQLGADSMVVLQQRAYEILMTIMEGCHFARGGQLLLGEQN`	95
3	-9.280	`d1jyoa_ d.198.1.1 (A:) Virulence effector SptP secretion chaperone SicP {Salmonella typhimurium [TaxId: 90371]}`	`ali model 3D-neighbors follow..`	15	20	`........TFDDNNQCLLLLDSDIFTSIEAKDDIWLLNGMIIPLSPVCGDSIWRQIMVI...................`	70
4	-7.160	`d3c0ua1 c.52.1.0 (A:2-180) automated matches {Escherichia coli K-12 [TaxId: 83333]}`	`ali model 3D-neighbors follow..`	15	60	`.................LCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL.................`	103
5	-7.090	`d2g3wa1 c.52.1.33 (A:4-182) Hypothetical protein XAC2396 {Xanthomonas axonopodis pv. citri [TaxId: 92829]}`	`ali model 3D-neighbors follow..`	13	58	`.................LSNDDEPDLWRRDYTGDPDLWIDLGQPDESRVRKACNRSREAVV.................`	101
6	-7.060	`d2ot9a1 c.52.1.33 (A:2-180) Hypothetical protein PSPTO1487 {Pseudomonas syringae pv. tomato [TaxId: 323]}`	`ali model 3D-neighbors follow..`	25	60	`.................LSDVDEPALWEKSLDDRVLHWIEVGQPDADRLTWCSRRTERTSL.................`	103
7	-6.530	`d1xkpc1 d.198.1.1 (C:2-127) Chaperone protein YscB {Yersinia pestis [TaxId: 632]}`	`ali model 3D-neighbors follow..`	13	17	`........VADKQGVYRLTIDKH-LVMLAPHGSELVLRTPIDAPMLREGNNVNVTLLRSLMQ................`	69
8	-5.820	`d3e1za_ b.1.26.1 (A:) Chagasin {Trypanosoma cruzi [TaxId: 5693]}`	`ali model 3D-neighbors follow..`	11	3	`.....KVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWY.......................................`	36
9	-5.770	`d3mj0a1 b.34.14.1 (A:601-717) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}`	`ali model 3D-neighbors follow..`	13	74	`..KKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEE................................`	117
10	-5.640	`d2c34a1 b.1.26.1 (A:1-113) Inhibitor of cysteine peptidases, ICP {Trypanosome (Leishmania mexicana) [TaxId: 5665]}`	`ali model 3D-neighbors follow..`	11	4	`.....PLSVKDNDKWVDTHVGKTTEIHLKGNPTTGYMWT.......................................`	37

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Jan 1, 2011

Comments and questions to: webmaster