current user: public

If you have questions about the server, please let us know.

Query: PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like, from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst SPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESRHDFQVRVKVGLast
1 -34.800d4b8ja_ a.118.1.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}  ali model 3D-neighbors follow..  13  123TSENTKVVIDHGAVPIFVKLL-GSSSDDVREQAVWALGNVAGSPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSFCRGKPQPSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAAGVCPRLVELLLHPSPSVLIPALRTVGNIVTDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKDQIQAVI---------------NAGIIGPLVNLLQTAEFDIKKEAA 366
2 -33.900d4ev8a_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  24EASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLISGGPQALVNIMRTYTEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP-SQRLVQNCLWTLRNLSDAATKQ----EGMEGLLGTLVQLLGSDDINVVTLSNLTCNNYKN...... 276
3 -33.300d4r10a_ a.118.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  11  1..........GLSLPDLVKLM-CDHDESVVARAVHRAYMLSREDPNAPGFDHRSFVEALMAASKSSNVNVRRNAIGALSHMSEQRGGPLLIFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQANAVEALTPHLHKTNPKLLAQVADGLYFLLDDAPSKITFLSLLGPQILVSILRESDHRKLIYTVVRCIRSLSVC--PSNKPALISLGCLPALYVELCTAKDLIIKLLEIIRVANDGMTACAC 275
4 -32.200d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1..........GLTIPKAVQYL-SSQDEKYQAIGAYYIQHTCFDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFSTTNKLETRRQNGIREAVSLLRRTGPEVFFNATGCLRNLSSADAGRQTMSGLIDSLMAYVQNCDDKSVENCMCVLHNLSTNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSQLIGLKEKGLPQIARLLQSGNSDVVRLSNMSRHPLLH...... 365
5 -31.300d3l6xa_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  258PARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQEDTVISILNTINEVIAENLEAAKKTQGIEKLVLINKSGSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKS........................................................................... 453
6 -30.500d1xqra1 a.118.1.21 (A:84-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  11..KSCLRVLSQPMPPTAGEAE-QAADQQEREGALELLADLCENMDNAADFCQLSGMLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLGHPEHKGTLCSMGMVQQLVALVRTEHS-PFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQ.... 263
7 -19.800d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17.........KKLNDDELFRLL-DDHNSLKRISSARVLQLRG----------GQDAVRLAIEFCSDKNYIRRDIGAFILGQIKICKKCEDNVF----NILNNMALNDKSACVRATAIESTAQRC--KKNPIYSPKIVEQSQITAFDKSTNVRRATAFAISVIN----------DKATIPLLINLLK-DPNGDVRNWAAFAININKYDNSDIRDCFVEDKRVLSVLCDELKKNTVYDDIIEALYKFDDNEIITSAI 270
8 -17.800d4adya1 a.118.1.28 (A:309-753) Proteasome regulatory subunit Rpn2, PC domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  119.............IVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIE------VYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHD-----MFTYSQETQHGNITRGLAVGLALINYGRQEL-----ADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKR------LLHVAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVQRCGTAFALGIA-KGLQSAIDVLDPLTKDPVDFVRQAAM 349
9 -17.100d1te4a_ a.118.1.16 (A:) MTH187 {Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  11  2......................ADENKWVRRDVSTALSRMGD-----------EAFEPLLESLSNEDWRIRGAAAWIIGNFQDER----------AVEPLIKLLEDDSGFVRSGAARSLEQIGGER--------VRAAMEKLAETGTGFARKVAVNYLET.............................................................................................. 110
10 -17.000d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  325.............ILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHL--LPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLP--AIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKEWAHATIIRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAK--SLQKIGPILDNSSEVKPILEKLTQDQDVDVKYFAQ 579
11 -15.100d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]}  ali model 3D-neighbors follow..  10  3....................IGDCRVCSFRMSL----------------LLTGRCTPGDACVAVESGRQIDRFFRHLAVQYLADPF-RAIAVRYSPVEALTPLIRDSDEVVRRAVAYRL---------------PREQLSALMFDEDREVRITVADQLEQMAADRDLVRAYVVQRIPPGRLFRFMRDEDRQVRKLVAKSLGLMTQDPEPEVRRIVASRLRGDDLLELLHDPDWTVRLALRELDEPDPEVRLAIA 230
12 -14.100d5o9zv_ a.118.1.2 (v:) Splicing factor 3B subunit 1, HEAT repeats {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  155.............LPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQPQICGTVLWRLNNKSAKVRQQAA 462
13 -13.900d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  47.............VKMILKLL-EDKNGEVQNLAVKCLGPLVSKVKEYQV---ETIVDTLCTNMLSDKEQLRDISSIGLKTVSSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLV---MSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEK---IPLVVKFCNVDDDELREFESFVRRCPKEVYPHV. 291
14 -13.000d4xria_ a.118.1.0 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]}  ali model 3D-neighbors follow..  10  90...........TRVKQLALETLASPNSKAGQAAAQVIAAIAAIELPRNQWPEL--MHALVRNASEGGQHQKQASLTAIGFICETNSLVGHSNAILTAVVQGARKEEPNNEVRFAAITALGDSLEFVGNNFKHEGERNYIMQVVQAQDSRIQQGAFGCLNRIMALYYEHMRYYMEKALFGLTILGMKSDDEDVAKLAVEFWSTVCE................................................. 291
15 -12.800d3ea5b_ a.118.1.1 (B:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14  89SPEAKNQIKTN-----ALTAL-VSIEPRIANAAAQLIAAIADIELPHGAWPEL--MKIMVDNTGAEQPNVKRASLLALGYMCESQALVSSSNNILIAIVQGAQSTETSKAVRLAALNALADSLINMEREGERNYLMQVVCEATQAEDIEVQAAAFGCLCKIMSKYYTFMKPYMEQALYALTIATMKSPNDKVASMTVEFWSTICEEEIDIAYELAQFPQSPLQSYNFALSSIKDVVPNLLNLLTRQNE...... 338
16 -11.400d2z5ka_ a.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  4.........DEQGLQQILQLLKESPDTTIQRTVQQKLEQLNQYPDFNNYLIF------VLTKLKSEDEPTRSLSGLILKNNNFPNGVTDFIKSE-----CLNNIGDSSPLIRATVGILITTIASKGELQN---DLLPKLCSLLDSEDYNTCEGAFGALQKICEDAEILDSDVLDRPLNIMIPKF-KHSSPKIRSHAVACVNQFIISRTQ----------------ALMLHIDSFIENLFALAGDEEPEVRKNV. 231
17 -11.100d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  84DANARREVKNY-----VLHTL--GTETYRPSSASQCVAGIACAEIPVNQWPEL--IPQLVANVTNPNEHMKESTLEAIGYICQDIDPQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCD................................................. 288
18 -11.000d2jkrb_ a.118.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  108..........TEYLCEPLRKCLKDEDPYVRKTAAVCVAKL--HDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLD----INKLLTALNECTEWGQIFILDCLSNYNPKDD--REAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMKKLAPPLVTLLSG-EPEVQYVALRNINLIVQKRPEYNDPIYVKLEKLDIMIRLASQANQVLAELKEYATEVDVDFVRKA. 362
19 -10.700d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  76.............LIPLIHLLSTSDNEDCKKSVQNLIAELLSSDKYGDDTVKF--EQLFDVSLKGDFQTVLISGFNVVSLLVQNGLHNVKLVEKLLKNLINILQNIEQMDTCYVCIRLLQELAVIPEYRDVIKKFMPTLFKILQHLGIQLQYHSLLLIWLLTFNPVFANELVQKSDFLDLLKLVKITIKEKVSRLCISIILQCCSTRVKQHKKVIKQLLLLGNALPTVQSDEELRQDISNLKEILENEYQELTS 354
20 -10.100d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  322............ACNQLGQFL-QHRETNLRYLALESMCTLASSEFSHEAVKTHIET-VINALKTERDVSVRQRAVDLLYAMCDRSNAQQIVAE------MLSYLETADYSIREEIVLKVAILA--EKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDD----VQGYAAKTVFEALQAPACHENLVKVGGILGEFGNLIAGDPRSSPTRALLLSTYIKFVNLFPEVKATIQSQLKNADVELQQRA. 572
21 -10.100d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  118................LFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSA------FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILD---------ILLKNQAK-----LIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDL........................... 324

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.