| | | | | | . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 |
| # |
Score |
Template |
Links and tools | %id | First |
ICTGQNCSACLGPSVGNSSCFWLECSGKSYCSDSPSVENCTAENKTEDCSAATTTRPSPTSSSVTTQTTPNATATPVTPSPRKSSFDAASFIGGIVLVLGVQAVVFFLYKFCKSKERNYHTL | Last |
| 1 | -6.930 | d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
14 | 6 | ........KCRSPERETFSCHWTDEVHHGTKNEGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTLTSNGGTVDEKCFSVDEIV.............................. |
98 |
| 2 | -6.720 | d1olza3 g.16.2.1 (A:481-536) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
13 | 1 | FCGKGTCEDCVLAR-----CAW-TCVALHQTESPSRGLIQEMSGDASVCPDKS..................................................................... |
56 |
| 3 | -6.520 | d1eerb1 b.1.2.1 (B:8-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
13 | 20 | ........LCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDEPWKLCRLHQAPTARG............................................................... |
70 |
| 4 | -6.300 | d2gysa1 b.1.2.1 (A:1-103) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
7 | 10 | ........RCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPR......................................................... |
66 |
| 5 | -6.020 | d2uzga1 g.44.1.5 (A:36-130) Ubiquitin carboxyl-terminal hydrolase 33, UBP33 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
17 | 22 | ..SLGTCQDCKVQGPNLWACLENRC................................................................................................. |
44 |
| 6 | -5.860 | d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
28 | 8 | ........ECFFDGAAVLSCSW.................................................................................................... |
21 |
| 7 | -5.860 | d3d85d2 b.1.2.1 (D:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
14 | 15 | ..KNKTFLRCEAKNYSGRTCWWLTTISTDLTFSVKSSRGSSD-PQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESQYTSSFFIRDII.......................... |
124 |
| 8 | -5.790 | d1yjqa1 a.100.1.7 (A:168-293) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
11 | 9 | .......KLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTSAEDLRDYVMQVIDATAENISSMLQDIRALRHTEIDYINGFLLRRA-VPENTRLFEMVKRKESEYE.. |
126 |
| 9 | -5.760 | d4gs7b1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
29 | 1 | .....SQFTCFYNSRAQISCVW.................................................................................................... |
17 |
| 10 | -5.610 | d4gs7c1 b.1.2.1 (C:33-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
28 | 7 | ........QCFVFNVEYMNCTW.................................................................................................... |
20 |
