Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF10752.9; D3FXJ5_BACPE/1-83; Protein of unknown function (DUF2533 topsan), from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MSVHLQIAEQVTNHRRAQKEFLALDEKREAAIDRVVEDAKKGLHISLNEVNAITKEMNQIAQDFYFPPRKEVTTDMVREYINKLast
1 -6.610d1ny9a_ a.181.1.1 (A:) Transcriptional activator TipA-S {Streptomyces lividans [TaxId: 1916]}  ali model 3D-neighbors follow..  11  1....................WQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGYEMHTCLGEMYVS. 62
2 -6.140d2m1ua1 a.39.1.0 (A:22-93) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  10  1..........SDEKTQLIEAFYNFDGDYDGFVEEFRGIIRDGLPMTEAEITEFFEAAD......................... 50
3 -5.730d2b5la3 a.297.1.1 (A:1044-1140) DDB1 C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  6  49...............DLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTR..................... 95
4 -5.620d3q0wa1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  16  2........................DDRELAILATAENLLED-RPLADISVDDLAKGISRPTFYFYFPSKEAVLLTLLDRVVNQ 61
5 -5.250d1vq8e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}  ali model 3D-neighbors follow..  12  8FYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITR.... 91
6 -4.900d1uj6a1 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  12  2......................PLESYKKEAAHAAIAYVQDGMVVGLGTGSTARYAVLELARR.................... 42
7 -4.890d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]}  ali model 3D-neighbors follow..  10  1.........................QTRDALFTAATELLEHGEGVPITQICAAAG-AHPNQVTYYYGSKERLFVEVACAAVLR 58
8 -4.840d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  12  4...........................KDTIIAAAFSLLEKSPTLEQLSMRKVAKQLGAPAIYWYFKNKQALLQSMAEAIEEH 61
9 -4.790d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  10  3........................QSKADDILQCARTLIIR-GGYNSFSYADISQVIRNASIHHHFPSKSDLVCKLVSQYRQE 62
10 -4.750d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  10  223...YEELKKQTEVEMKRIAEFLECGFIEEEEVREIVKLCSNLEVNKEGKLPNGIETKTFFRKGEIGGWRDTLSESLAEEI... 304
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;