Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF11166.8; Q2FYD6_STAA8/2-99; Protein of unknown function (DUF2951 topsan), from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst FGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKEEDEKNKEKNAKNIRDIKMWILGLIGTILSTFVIALLKTIFGILast
1 -5.710d4ypoa2 a.100.1.0 (A:181-325) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  19  90....................ERMRDILREIQDGSFVHKLVADVEGGNKQLEELRRQNAEHPIEVVGKKLRDLMSWV...................... 145
2 -5.490d2ahme1 d.302.1.1 (E:43-197) Nonstructural protein 8, NSP8 {SARS coronavirus [TaxId: 227859]}  ali model 3D-neighbors follow..  6  1......................LKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINN.... 72
3 -5.380d1cz3a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  13  13.GKIASSVESWSSFEDRKNFRKITTEIGNVVMGRITFEEIGRPLPERLNVVLTRRPKTSNNPSKFLEGKGYERVAVIGLREKLVDELFVTVEPYVFG. 128
4 -5.190d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  12.................................TYKDNELLTKYSYENAVVTKTASVQDYVFKLDLKKPEKLGIMLIGLGGNNGSTLVASVLANKHNV 84
5 -5.120d4dnda_ a.47.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  38.......ELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMV......................... 103
6 -5.030d2ih3c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}  ali model 3D-neighbors follow..  14  27........................................................AERGAPGAQLITYPRALWWACETATTVLWGRLVAVVVMVAGI 77
7 -4.560d1wfqa1 b.40.4.5 (A:8-83) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  14.GVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKV---------DDVEFEVSSDRRTGKPIAVKLVKI.......................... 76
8 -4.550d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  8  33...........KFISAHPEMAAVFGFSGASDPGVAELAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIG. 119
9 -4.500d4lv5b_ c.37.1.8 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  11  2..............DLPSSFTGYFKKFNTGRKIISQEIL--NLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLR...... 77
10 -4.430d3ze3a_ f.62.1.1 (A:) Diacylglycerol kinase (DgkA) {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  10  64.....................................ELLNSAIEAVVDRIGSEYH----ELSGRAKDLGSAAVLIAIIDAVITWAILL......... 111
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;