FFAS03 results for PF14117

Query: PF14117.6; D0J295_COMT2/9-67; Domain of unknown function (DUF4287 topsan), from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.

						`. 10 . 20 . 30 . 40 . 50 .`
#	Score	Template	Links and tools	%id	First	`GPASYFPSIEKAYGKPVTHWLKILDELRDKKHMEQVAHLKLEHGIGHGHANALVAYHRA`	Last
1	-5.520	`d1vq821 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}`	`ali model 3D-neighbors follow..`	6	14	`.........LDNQNSRVPAWVMLKTDREVQRNHKRRHWRRND.................`	46
2	-5.520	`d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}`	`ali model 3D-neighbors follow..`	10	5	`..KELLMKLRRKTGYSFINCKKALETCG--DLKQAESWLHKQ.................`	43
3	-5.270	`d5d3xa1 b.55.1.0 (A:245-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	8	128	`........CMAKTAEEKQKWLDAIIREREQRESLKLGMERDAY................`	162
4	-5.060	`d2v0fa1 d.76.2.1 (A:2629-2715) Chromodomain-helicase-DNA-binding protein 7, CHD7 {Human (Homo sapiens) [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	15	16	`..EERVPVVNKRNGK-------KMGGAMAPPMKDLPRWLEEN.................`	48
5	-5.020	`d2ckaa1 d.76.2.1 (A:2028-2085) Chromodomain-helicase-dna-binding protein 8, CHD8 {Human (Homo sapiens) [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	21	6	`..ETRIPVINKVDGT-------LLVGEDAPRRAELEMWLQGH.................`	38
6	-4.840	`d4gm2a_ c.14.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}`	`ali model 3D-neighbors follow..`	9	139	`..KKVIEIISKNTEKDTNVISNVLERD---------KYFNADEAVDFKLIDHILE....`	182
7	-4.820	`d1t0fa1 a.4.5.27 (A:169-268) TnsA endonuclease, C-terminal domain {Escherichia coli [TaxId: 562]}`	`ali model 3D-neighbors follow..`	10	13	`..SVKTEEVSAELLAQLSPLAHILQEKGDENIINVCKQVDIAYDLELGKTLSEIRALTA`	69
8	-4.630	`d3h90a1 f.59.1.1 (A:8-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}`	`ali model 3D-neighbors follow..`	18	28	`GSVSILAALVDSLVDIGASLTNLLVVRYSLQPAD------DNHSFGHGKAESLAALAQS`	80
9	-4.560	`d2cfxa2 d.58.4.2 (A:64-140) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}`	`ali model 3D-neighbors follow..`	11	36	`GAACYMLKINAESLEAVEDFINKTSPYAQTVTHVIFSEIDTK.................`	77
10	-4.530	`d1yg6a_ c.14.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}`	`ali model 3D-neighbors follow..`	6	147	`..GRMNELMALHTGQSLEQIERDTERD---------RFLSAPEAVEYGLVDSILT....`	190

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Jan 1, 2011

Comments and questions to: webmaster