Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF15432.6; F2I912_AERUA/17-140; Accessory Sec secretory system ASP3, from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst YAYGSQIVLENPDHIHFKNTLMPSGERITSWSSRSVFQTTKDSAKLPLLTRGESYQLIFQGKTVPEGSIFFKISFFDYYGGPIEEYYLRTPSDYFTVPDTYNYYEIALHHGGCLSLDFNQIILVLast
1 -8.900d4xuoa_ b.18.1.0 (A:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]}  ali model 3D-neighbors follow..  13FEEGTTQGWTARGKVDVTAEQAYQGKQSLQTTGRTEAWNGPSLSLTDVVHKNEVVEISGYVKLVAGSALKFTVERRDGNGDTQYDQVNAAEQGQYSYEQGSSLLLYLESTDAKAAYLLDEFQIR 151
2 -8.590d1guia_ b.18.1.14 (A:) Carbohydrate binding module from laminarinase 16A {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  21  69................................................LYRGKTYTISFKAKADTPRPINVKILQNHDPWTNYFAQTVQTFTFTYTHPDDAVQISFELGEGTATTIYFDDVTVS 153
3 -8.390d1cx1a1 b.18.1.14 (A:3-153) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}  ali model 3D-neighbors follow..  18  1..............LDSEVELLPHTS-LGPWSLYGTSEPVFADGRMCVVGEGESYVLSFTASATPDMPVRVLVG-AFEQGSAPLTGEPATREYAFTSNLTFGQVAFHLGKAGAYEFCISQVSLT 147
4 -7.770d1h6ya_ b.18.1.7 (A:) Xylan-binding domain {Clostridium thermocellum [TaxId: 1515]}  ali model 3D-neighbors follow..  24...........PAEVLLSGRTAYKGSSLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASFCMKLQYVDGSGTQRYDTIDMKYNPQYRIPSDATDMYVYVTADDTINFYIDEAIGA 151
5 -7.590d4bj0a1 b.18.1.14 (A:2-166) automated matches {Rhodothermus marinus [TaxId: 29549]}  ali model 3D-neighbors follow..  10  79................................................VRPGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQPFTFEFTVSDQETVIRAPIAANVGNTIYIDGLAIV 164
6 -7.570d1gu3a_ b.18.1.14 (A:) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}  ali model 3D-neighbors follow..  14  47................................................IEEGTTYTLRYTATASTDVTVRALVGQNGAPYGTVLDTSPRQVTETFTASATYIAFQLGGFSADAWTLCLDDVALD 140
7 -7.070d2yc2a_ b.18.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}  ali model 3D-neighbors follow..  13  10...GGLVVMASCSDERFPPENMLDGKDNTFWVTTGMF------PQEFVLRLESCIRVKITTLSLNVRKLAVEKQFEKVFEVELANRGDRLQTEVHQVNIRAKYLKFILLQGHGEFATVNRVSV. 131
8 -6.690d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  9...GSEVILATSSDEKHPPENIIDGNPETFWTTTGMF------PQEFIICFHKHVRIRLVIQSYFVQTLKIEKDFEQWIEKDLVHTEGQLQNEEIVAHGSATYLRFIIVSAFDHFASVHSVSA. 130
9 -6.650d1i5pa1 b.18.1.3 (A:473-633) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]}  ali model 3D-neighbors follow..  14  21...GFTISPIHATQVNNQTRTFISEK--GNQGDSLRFEQSNTTARYTLRGNGNSYNLYLRVSSIGNSTIRVTINGRVYTVSNVNTTTNNDGVNDVASDNTNVTLDINVTLNSGTPFDLMNIMFV 153
10 -6.550d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  13  30FAYLITIKNLSSQTVQLMS---------RRWLKQTVVEGDGVVGEQPRIKANDEYTYSSGTALTPVGVMQGQYLMIDEQGESFTVEI---EPFRLAVPH......................... 123

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.