Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF15919.5; E1VAV2_HALED/3-129; HicB_like antitoxin of bacterial toxin-antitoxin system, from PfamA32U

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst YPIAIEIADEQHAYSVVVPDLPGCFSAGDTFDEAVANAREAIEGHLESLSDHGDPIPKTTTIEQHLENPDYKGWVWATVEVDITPYLGKSHKINVTLPELLIKRIDTAVAKQGDVYQSRSGFLSRAALast
1 -38.000d2dsya1 d.304.1.2 (A:3-82) Hypothetical protein TTHA0281 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  26  14ARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFLLSRGETPPPLGEVR................................................................ 76
2 -24.900d1wv8a1 d.304.1.1 (A:2-72) Hypothetical protein TTHA1013 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  19  3LKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLE................................................................................ 49
3 -11.800d2wvfa1 a.43.1.0 (A:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}  ali model 3D-neighbors follow..  28  3..........................................................................................IRFSVSLQQNLLDELDNRIIKNG--YSSRSELVRDMI 37
4 -11.800d2bj7a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  18  2........................................................................................ELIRFSISIPSKLLEKFDQIIEEIG--YENRSEAIRDLI 38
5 -11.700d2cpga_ a.43.1.3 (A:) Transcriptional repressor CopG {Streptococcus agalactiae [TaxId: 1311]}  ali model 3D-neighbors follow..  22  2.........................................................................................KKRLTITLSESVLENLEKMAREMGL---SKSAMISVAL 36
6 -10.900d2hzaa1 a.43.1.3 (A:1-48) Nickel responsive regulator NikR, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  22  2..........................................................................................QRVTITLDDDLLETLDSLSQRRG--YNNRSEAIRDIL 36
7 -7.150d1y9ba1 a.43.1.9 (A:3-83) Hypothetical protein VCA0482 (VCA0319) {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  21  1.......................................................................................TTLPRITARVDVDTQDLLAKAAALAGMS--SINSFVLNAA 38
8 -6.660d1p94a_ a.43.1.3 (A:) Plasmid partition protein ParG {Salmonella enterica [TaxId: 28901]}  ali model 3D-neighbors follow..  27  31......................................................................................SGKIKRVNVNFDEEKHTRFKAACARKG---TSITDVVNQL. 67
9 -6.310d2gpea_ a.43.1.11 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  2.........................................................................................TTTMGVKLDDATRERIKSAATRID---RTPHWLIKQA. 35
10 -6.110d2gova1 d.60.1.4 (A:7-190) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  11  12WQVLSTGGKEDVSYEER---FATVEVTDKPVDEALREAMPKIMKYVGGTNDKGVGMGMTVPVSFAVFPNEDGSKVWFRIPNQFQGSPPAPSDESVKIEGITVYSTQFGGYAKEADYVAHATQLRTT. 148

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.