| | | | | | . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 |
# |
Score |
Template |
Links and tools | %id | First |
MPEEVNKDAMRTPSTSDKATNSERPAATATAVNIPLVNEVQLTAATGGAELSCYRCTIPFGVVVLIAGIVVTVVAYSFNSHGSTISYFGLVLLSAGLLLLASSAICWKVKLERKKERRRESQTVLVTNQRSIF | Last |
1 | -5.730 | d1pp7u_ a.4.5.44 (U:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis [TaxId: 5722]} |
ali model 3D-neighbors follow.. |
16 | 10 | LPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLA----SNPQLEEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLA................................................... |
87 |
2 | -5.240 | d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
12 | 28 | ....................................................CVLCIYERVALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQL.................................. |
74 |
3 | -5.160 | d2opva_ d.51.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
20 | 5 | ..........................................DNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMIL.............................................. |
49 |
4 | -5.070 | d2pu3a_ d.4.1.6 (A:) automated matches {Vibrio salmonicida [TaxId: 316275]} |
ali model 3D-neighbors follow.. |
14 | 94 | .....................................DLHNLVPAIGEVNGD--RSNFRFSQWN---GAIARTYLYMNNEYKFNLSKAQRQLM-----------EAWNKQ--STWECTRDERIAKIQGNHNQF |
202 |
5 | -5.060 | d2hh2a_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
18 | 4 | ......................................................TFSIPTHKCGLVIGRGGENVKAINQQTGAFVEI.............................................. |
36 |
6 | -5.040 | d2anra2 d.51.1.0 (A:106-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
18 | 2 | ......................................................KIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQL.............................................. |
34 |
7 | -5.030 | d3fdra_ b.34.9.1 (A:) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
20 | 28 | ........................................DIVAAPLPTNGSWYR-----ARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIC........................... |
89 |
8 | -5.000 | d4lija_ d.51.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
21 | 7 | ......................................................EYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI.............................................. |
39 |
9 | -4.920 | d2anra1 d.51.1.0 (A:5-76) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
21 | 5 | ......................................................KVLIPSYAAGSIIGKGGQTIVQLQKETGATIKL.............................................. |
37 |
10 | -4.890 | d1zzka2 d.51.1.0 (A:11-89) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
21 | 7 | ......................................................QVTIPKDLAGSIIGKGGQRIKQIRHESGASIKI.............................................. |
39 |