Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF02961.14; C3XZ01_BRAFL/2-89; Barrier to autointegration factor, from PfamA32U

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst SSTSQKHRDFVGEPMGDKPVTALAGIGGTLGGRLEEEGFDKAYVVLGQFLVLKKNEELFKEWLKSACNANSKQSGDCYTCLKEWCDAFLast
1 -62.000[BL] KOG4233 DNA-bridging protein BAF  ali follow..  69  2SGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEF 89
2 -7.410[L] COG3359 Predicted exonuclease  ali follow..  17  1..............MLKNTYIHIPGVGKALEQKIWASGINSWDEFLEM........................................ 34
3 -6.520[S] COG3743 Uncharacterized conserved protein  ali follow..  21  133..........MDKPAKPSDLKAISGIGPKLEKVLNGLGIWT----YAQIAAWSPQE---IAWVDDYLSFNGRIGRD------DWTAQ. 196
4 -6.430[J] KOG3333 Mitochondrial/chloroplast ribosomal protein L18  ali follow..  14  103.SASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEAASDSMKRLQSAMTEG-GVVLREPQRIYE......... 179
5 -6.250[L] KOG2094 Predicted DNA damage inducible protein  ali follow..  17  301.......KNAIMEFLKDLPIRKVGGIGRVCEAQLKAMDIQTVGDMN.......................................... 339
6 -5.870[S] COG4259 Uncharacterized protein conserved in bacteria  ali follow..  20  63............VEAGNKKMNAAPGAHAHLGLLLSRSGKEGAFRQFEEEKRLFPESGVFMDFLMKTGKGGKR................ 123
7 -5.320[L] COG0389 Nucleotidyltransferase/DNA polymerase involved in DNA repair  ali follow..  22  169..........VPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDV........................................... 203
8 -5.240[J] COG1491 Predicted RNA-binding protein  ali follow..  15  116.................HQLELLPGIGKKHMWDILKA----------------REEKPFESFIKNRVPMLSDPVKLIVRRVLM..... 167
9 -5.220[R] COG2384 Predicted SAM-dependent methyltransferase  ali follow..  28  84............ENTDKIDTIVIAGMGGILISEILEAGKEKLGHVKRLILQPNNHEESLRQWLVN....................... 136
10 -5.200[L] COG0322 Nuclease subunit of the excinuclease complex  ali follow..  16  553......HRKKRDKARVTSSLSDIPGVGSK-----------RRQALLTRFGGLRGVIAASREDLEKVEGISKALAETIYNHLH...... 617

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9.