|
current user: public |
|
Query: PF10929.8; K9VX85_9CYAN/6-70; Protein of unknown function (DUF2811 topsan), from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . 60 . | |||||||
# | Score | Template | Links and tools | %id | First | SILAEIPEELHESLKGYLDTHPNWDQDRVFAAALSLFLLQNGNGKTTEVSQNYRACARVYLETLF | Last |
1 | -7.910 | [P] COG3067 Na+/H+ antiporter | ali follow.. | 25 | 1 | .....MEISWGRAMRNFLGQSPDW-----YKLALLVFLIVN........................ | 32 |
2 | -7.080 | [K] COG0864 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain | ali follow.. | 12 | 8 | .IGVSLPKNLLDEFDRIISTRGYSSRSEAIRDAIRTYITEY........................ | 47 |
3 | -5.870 | [S] COG5639 Uncharacterized conserved small protein | ali follow.. | 19 | 16 | KVTVELPASLHRELVKYAEILGR-NPSRLIAPMLERFIATDRGFAKARKQGA............. | 73 |
4 | -5.370 | [K] KOG4109 Histone H3 (Lys4) methyltransferase complex, subunit CPS25/DPY-30 | ali follow.. | 16 | 74 | .LDSTVVPILLQGLGALAKDRPE--------EFLANFLLREKDRYNAENQNPAGQ.......... | 122 |
5 | -4.880 | [O] COG0652 Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | ali follow.. | 19 | 23 | DITLALAEKAPKSVANFVHVKKGHYNGTVFHRVIKGFMIQGG....................... | 66 |
6 | -4.830 | [S] KOG3098 Uncharacterized conserved protein | ali follow.. | 25 | 3 | .....................PTTRRYELLSAAMLGF............................ | 18 |
7 | -4.600 | [K] COG3905 Predicted transcriptional regulator | ali follow.. | 17 | 44 | AFTVRLPDEVAEKLDQ-LAEKLDRSRSYMAVQAIEDFVARE........................ | 83 |
8 | -4.500 | [UO] KOG4580 Component of vacuolar transporter chaperone (Vtc) involved in vacuole fusion | ali follow.. | 17 | 10 | ......AKVWLANERTFL----KWLHVVVLLGSLALALYNSAGER.................... | 44 |
9 | -4.380 | [R] COG3654 Prophage maintenance system killer protein | ali follow.. | 16 | 52 | ....DVFEIAAKYTACIAVSHALPDNKRTGLAVALEYLSLNDFELTQENDLLADAVRDLVIGII. | 112 |
10 | -4.370 | [H] KOG3754 Gamma-glutamylcysteine synthetase | ali follow.. | 21 | 573 | .............TRGFVQSHPAYKHDSDVNDNIVYDLLKK........................ | 600 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26; |