current user: public

If you have questions about the server, please let us know.

Query: PF13053.6; Q81Q33_BACAN/1-89; Protein of unknown function (DUF3914 topsan), from PfamA32U

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MQIGSNIHTLSQPTKITPSNLEHNTISSTKLESKKVNDPIKFDIRSSEKEMKQPEHKFNELDLWKMLKDKGVPLWIILEMLQKVRKEKELast
1 -6.680[S] KOG4740 Uncharacterized conserved protein  ali follow..  10  463....MRIVQVVVQSVFILVASRLRSLSASNISNQPGKQIVTF-YHTFETIESNFGFPHKMSSVYSALLNISSPLVVLAEIWKHAYSKKY 565
2 -5.630[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  13  1MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEV---LNKCGP---MVLDALIKIKNEVD 84
3 -5.240[T] KOG3858 Ephrin, ligand for Eph receptor tyrosine kinase  ali follow..  26  279........ALSLSTLASPKGGSGTAGTEPS--------DIIIPLRTTENNY--PHYE-------KVSGDYGHPVYIVQEM......... 334
4 -4.720[S] COG4760 Predicted membrane protein  ali follow..  14  230.......................................FLIDFDAADQMIRAGAPEKAA---WGVALGLTVTLWLYIEILRLLSYLQN 277
5 -4.680[R] COG2153 Predicted acyltransferase  ali follow..  21LQLRCAVFVVEQNCPYQDIDGDDLTGDNRHILGWKNDELVAY-ARILKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHH.. 106
6 -4.570[S] KOG2946 Uncharacterized conserved protein  ali follow..  18  14........DMSIPGKRTTTATSASGVPEYNTLDEPIRETVLRDIRAVGIKFYEKSSLLRDWDLW--------PLVLCTFM......... 84
7 -4.500[U] KOG4072 Signal peptidase complex, subunit SPC25  ali follow..  14  35.......SIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGT-ISRLHDSLAIERKIK. 123
8 -4.390[S] COG3512 Uncharacterized protein conserved in bacteria  ali follow..  21  11.......................................VFFDLPVTTKAKRKAANQFR-----QFLLKDGY................. 38
9 -4.270[L] COG0550 Topoisomerase IA  ali follow..  20  448......................GKNPEDQELPSVTVSEKLALKEVQPTQHFTKPPARFTEAALVKELEKRGI................. 497
10 -4.260[S] COG5081 Predicted membrane protein  ali follow..  11  91LRLFYSLFGSTPKWTWTLTNMTYIIGFYIMFHLVK-GTPFDFN-----------GGAYDNLTMWEQI-NDETLYTPTRKFL........ 158

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.