current user: public

If you have questions about the server, please let us know.

Query: PF02691.15; VACA3_HELPX/43-1023; Vacuolating cyotoxin, from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980
# E-value Template Links and tools%idFirst AFFTTVIIPAIVGGIATGAAVGTVSGLLSWGLKQAEQANKAPDKPDKVWRIQAGRGFDNFPHKQYDLYKSLLSSKIDGGWDWGNAARHYWVKDGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDGANRTTRVNFDAKNILIDNFVEINNRVGSGAGRKASSTVLTLKSSEKITSRENAEISLYDGATLNLVSSSNQSVDLYGKVWMGRLQYVGAYLAPSYSTIDTSKVQGEMNFRHLAVGDQNAAQAGIIANKKTNIGTLDLWQSAGLSIITPPEGGYESKTKDNPQNNPKNDAQKTEIQPTQVIDGPFAGGKDTVVNIFHLNTKADGTLRAGGFKASLSTNAAHLHIGEGGVNLSNQASGRTLLVENLTGNITVEGTLRVNNQVGGAAIAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTANFNGNIYLGKSTNLRVNGHTAHFKNIDATKSDNGLNTSTLDFSGVTDKVNINKLTTAATNVNIKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKGGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDTCVVRKDNLNDIKACGMAIGNQSMVNNPENYKYLEGKAWKNTGINKTANNTTIAVNLGNNSTPTNSTTDTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDFGTIESVFELANRSSDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITQQLNAATTTLNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRKHTNHIDSFAKRLQALKDQRFALast
1 8.000e-86UniRef50_Q48246 Vacuolating cytotoxin homolog (Fragment) n=39 Tax=Helicobacter pylori TaxID=210 RepID=Q48246_HELPX  ali  95  1........................................................................................................................................................................................................................................................................................GVLDLWQSAGLSIITPPEGGYESKTKDNPSQNSPNDTQKTEIQPTQVIDGPFAGGKDTVVNIFHLNTKADGTLKAGGFKASLTTNAAHLHIGEGGVNLSNQASGRSLLVENLTGNITVEGTLRVNNQVGGAAVAGSSANFEFKAGADTNNATATFNNDIHLGKAVNLRVDAHTAYFNGNIYLGKSTNLRVNGHSAHFKNIDATKSDNGLNTSALDFSGVTDKVNINKLTTSATNVNVKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKSGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSATGFYKPLIKINNAQNLTKNKEHVLVKGRNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDICVVRKGNTDDIKACGMAIGNQSMVNNPNDYKYLEGKAWKNTG............................................................................................................................................................................................. 513
2 2.000e-84UniRef50_A0A286P1D5 Vacuolating cytotoxin A n=9 Tax=Helicobacter pylori TaxID=210 RepID=A0A286P1D5_HELPX  ali  71  59.........................GLLGWGLKQAEEANKTPDKPDKVWRIQAGRGFNEFPNKEYDLYKSLLSSKIDGGWDWGNAARHYWVKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSFKDSADRTTRVDFNAKNISIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSGKNAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVNFNHLTVGDHNAAQAGIIASKKTYIGTLDLWQSAGLNIIAPPEGGYKDKPNNTNSQNPPNSGQKTEIQPTQVIDGPFAGAKDTVVNINRINTNADGTIKVGGYTASLTTNAANLNIGKGGINLSNQASGRSLLVENLTGNITVDGALMVNNQVGGYALAGSSANFEFKAGVDTKNGTIAFNNNISLGRFVNLKASAHTVNFKDIDT-------------------------GNGGFNTLDFSGVTNKVNINKLITASTNVAIKNFNINELLVKTNGISVGEYTNFSEDIGNQSRINTVRLETGTRSIYSGGVKFKGGEKLVINDFYYAPWNYFDARNIKNVEITNKLAFGPQGSP................................................................................................................................................................................................................................................................................................................................................................................... 638
3 3.000e-76UniRef50_A0A2A6TQS1 Autotransporter outer membrane beta-barrel domain-containing protein n=3 Tax=Helicobacter pylori TaxID=210 RepID=A0A2A6TQS1_HELPX  ali  90  55.....................GTVSGLLSWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQQNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVNFNAKNISIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVDFNS------------------------------------------TQNNSNTQVINPPNSAQKTEIQPTQVIDGPFAGGKDTVVNINRINTNADGTIRVGGYKASLTTNAAHLHIGKGGVNLSNQASGRSLLVENLTGNITVEGTLRVNNQVGGAAVAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTAYFNGNIYLGKSTNLRVNGHSAHFKNIDASKSDNGLNTSALDFSGVTDKVNINKLTTSATNVNVKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKSGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSATGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDICVVRKNNTDDIKACGMAIGNQSMVNNPENYKYLEGKAWKNTGINKTANNTTIAVNLGNNSTPTENGGNTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDFGTIESVFELADRSSDIDTLYTHSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITKQLNAATTTLNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRRHTNHIDSFAKRLQALKDQRFA 970
4 2.000e-72UniRef50_Q48245 Vacuolating cytotoxin autotransporter n=1135 Tax=Bacteria TaxID=2 RepID=VACA2_HELPX  ali  75  55.....................GTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYKSLLSSKIDGGWDWGNAATHYWIKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLNGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVNFNHLTVGDHNAAQAGIIASNKTHIGTLDLWQSAGLNIIAPPEGGSSQNNSNTQVINPPNSTQKTEVQPTQVIDGPFAGGKDTVVNIDRINTKADGTIKVGGFKASLTTNAAHLNIGKGGVNLSNQASGRTLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGVDTKNGTATFNNDISLGRFVNLKVDAHTANFKGIDT-------------------------GNGGFNTLDFSGVTNKVNINKLITASTNVAVKNFNINELIVKTNGVSVGEYTHFSEDIGSQSRINTVRLETGTRSIFSGGVKFKSGEKLVIDEFYYSPWNYFDARNIKNVEITRKFASSTPENPWGTSKLMFNNLTLGQNAVMDYSQFSNLTIQGDFINNQGTINYLVRGGKVATLNVGNAAAMMFNNDIDSATGFYKPLIKINSAQDLIKNTEHVLLKAKII-----GYGNVSTGTNGISNVNLEEQFKERLALYNNNNRMDTCVVR--NTDDIKACGMAIGNQSMVNNPDNYKYLIGKAWKNIGISKTANGSKISVYYLGNSTPTENGGNTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDFGTIESVFELANRSKDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITKQLNTATTTLNNIASLEHKTSSLQTLSLSNAMILNSRLVNLSRRHTNNIDSFAKRLQALKDQRFA 999
5 5.000e-67UniRef50_A0A1Q2PIN9 Vacuolating cytotoxin (Fragment) n=3 Tax=Helicobacter pylori TaxID=210 RepID=A0A1Q2PIN9_HELPX  ali  76  59.........................GLLGWGLKQAEEANKTPDKPDKVWRIQAGRGFNEFPNKEYDLYKSLLSSKIDGGWDWGNAARHYWVKGGQWNKLEVDMKDAVGTYKLSGLRNYTGGDLDVNMQKATLRLGQFNGNSFTSFKDAANRTTRVDFNAKNISIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSGKNAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVNFNHLTVGDRNAAQAGIIASKKTYIGTLDLWQSAGLNIIAPPEGGYKDKPNNTNSQNPPNSGQKTEIQPTQVIDGPFAGAKDTVVNINRINTNADGTIKVGGYTASLTTNAANLNIGKGGINLSNQASGRSLLVENLTGNITVDGALMVNNQVGGYALAGSSANFEFKAGVDTKNGTIAFNNNISLGRFVNLKASAHTVNFKDIDTGNGGFNTLDFSGVTN......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 529
6 6.000e-67UniRef50_Q6DLS7 Vacuolating cytotoxin (Fragment) n=16 Tax=Helicobacter pylori TaxID=210 RepID=Q6DLS7_HELPX  ali  90  55.....................GTVSGLLSWGLKQAEEANKAPDKPDKVWRIQAGRGFDNFPNKQYDLYKSLLSSKIDGGWDWGNAARHYWVKDGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDSADRTTRVNFDAKNILIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLNGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVDFNHLTVGDKNAAQAGIIASSKTHIGTLDLWQSAGLNIIAPPEGGYKNNNSNTQVINPPNNTQKTEIQPTQVIDGPFAGGKDTVVNINRINTNADGTIRVGGYKASLTTNAAHLHIGEGGVNLSNQASGRTLLVENLTGNITVEGTLRVNNQVGGAAVAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTAYFNGNIYLGKSTNLRVNGHSAHFKNIDASKSDNGLNTSALDFSGVTDKVNINKLTTSATNVNVKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKSGKKLVIDEIYHAPWNYFDARNITDVEVNKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSATGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDICVVRKNNTDDIKACGMAIGNQSMVNNPDSYKYLEGKAWKNTGINKTANNTTIAVNLGNNSAPTENGGNTTDLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDFGTIESVFELADRSKDIDTLYTHS................................................................................................... 941
7 1.000e-61UniRef50_UPI0009944284 autotransporter outer membrane beta-barrel domain-containing protein n=1 Tax=Helicobacter pylori TaxID=210 RepID=UPI0009944284  ali  78  55.....................GTVSGLLSWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAARHYWVKGGQQNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVNFNAKNISIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVDFNHLTVGDKNAAQAGIIASNKTHIGTLDLWQNAGLNIIAPPEGGYAQNNSNTQVINPPNSAQKTEIQPTQVIDGPFAGGKDTVVNIDRINTNADGTIRVGGYKASLTTNAAHLHIGKGGVNLSNQASGRSLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGTDTKNGTATFNNDISLGRFVNLRVDAHTANFKGIDT-------------------------GNGGFNTLDFSGVTGKVNINKLITASTNVAVKNFNINELIVKTNGVSVGEYTHFSEDIGSQSRINTVRLETGTRSIFSGGVKFKSGEKLVINEFYYSPWNYFDARNIKNVEITRKFASSTPENPWGTSKLMFNNLTLGQNAVMDYSQFSNLTIQGDFINNQGTINYLVRGGQVATLNAGHQASMIFNNLVDSATGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDICVVRKNNTDDIKACGMAIGNQSMVNNPENYKYLEGKAWKNTGINKTANNTTIAVNLGNNSTPTSSESNTTNLPTNTTNNARFASYALIKNAPFAYSATPNLVAINQHDFGTIESVFELANRSSDIDTLYANSGAKGRDLLQTLLIDSHDAGYARQMIDNTSTGEITKQLNAAT.......................................................... 952
8 2.000e-61UniRef50_Q6DLS8 Vacuolating cytotoxin (Fragment) n=26 Tax=Helicobacter pylori TaxID=210 RepID=Q6DLS8_HELPX  ali  84  55.....................GTVSGLLSWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYQSLLSSKIDGGWDWGNAARHYWVKGGQQNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNISIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLNGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVDFNHLTVGDKNAAQAGIIASSKTHIGTLDLWQSAGLNIIAPPEGGYKNNNSNTQVINPPNNTQKTEIQPTQVIDGPFAGGKDTVVNINRINTNADGTIRVGGYKASLTTNAAHLHIGKGGVNLSNQASGRSLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGTDTKNGTATFNNDISLGRFVNLKVDAHTANFKGIDT-------------------------GNGGFNTLDFSGVTDKVNINKLTTSATNVNVKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKSGKKLVIDEIYHAPWNYFDARNITDVEVNKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSATGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDICVVRKNNTDDIKACGMAIGNQSMVNNPDSYKYLEGKAWKNTGINKTANNTTIAVNLGNNSAPTENGGNTTDLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDFGTIESVFELADRSKDIDTLYTHSG.................................................................................................. 917
9 2.000e-60UniRef50_A0A1C9ZX25 Vacuolating cytotoxin A (Fragment) n=1 Tax=Helicobacter pylori TaxID=210 RepID=A0A1C9ZX25_HELPX  ali  96  1..............................................................................................................................................................................................................................................................................................................................................................................AHLNIGEGGVNLSNQASGRSLLVENLTGNITVEGTLRVNNQVGGAAVAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTAYFNGNIYLGKSTNLRVNGHSAHFKNIDASKSDNGLNTSALDFSGVTDKVNINKLTTSATNVNVKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGVVSLQTGYSPAYSGGVTFKSGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSATGFYKPLIKINNAQNLTKNKEHVLVRARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNRMDICVV.................................................................................................................................................................................................................................... 387
10 8.000e-59UniRef50_A0A1D0A0F4 Vacuolating cytotoxin A (Fragment) n=31 Tax=Helicobacter pylori TaxID=210 RepID=A0A1D0A0F4_HELPX  ali  69  1..............................................................................................................................................................................................................................................................................................................................................................................AHLHIGKGGVNLSNQASGRSLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGTDTNNATATFNNDISLGRFVNLKVDAHTANFKGIDT-------------------------GNGGFNTLDFSGVTNKVNINKLITASTNVAIKNFNINELVVKTNGISVGEYTHFSEDIGSESHINTVRLETGTRSIYSGGVKFKSGEKLVINDFYYAPWNYFDARNIKNVEITNKLALDLKEALWGTSKLMFNNLTLGQNAVMDYSQFSNLTIQGDFTNNQGTINYLVRGGQVATLNVGNAAAMLFNNNVDSATGFYQPLMKINSAQDLIKNKEHVLLKAKII-----GYGNVSLGTNSISNVNLIEQFKERLALYNNNNRMDICVVR--NTDDIKACGTAIGDQAMVNNPDNYKYLIGKAWKNIGISKTANGSKISVHYLGNSTPTENGGNTTNLPTNTTNNARSASYALIKNAPFAQSATPNLVAINKH............................................................................................................................ 461
11 1.000e-57UniRef50_I0ER32 Vacuolating cytotoxin n=2 Tax=Helicobacter cetorum TaxID=138563 RepID=I0ER32_HELCM  ali  42  1..................................................................MDSTMLQGQWETRYDWGNASNYIVGRNGNKITYQGSWWDTYNTYRLSGFRNYV-GDMDIYSPTSNFQLGGYNGNSFTNYG----RTSNVKIAGNQIAINNFLEINNRIGSGLGSKPWYTNVTLKSERSLFSNEDGRIYVYDGGHLNLVAR---DVDLKGDVYLGKLQYNFEFARQAQVKLDASN-TGSLHMKKLIIGDQNATQAEMIGSSR---------------------GNNKIDYLNIWQDATLNFKAPSQELRVW-------------------SLSNLGESYIGGYNAQATLNADVKTLILDFVNLNNYTGGRRIFAQNIGGDLHIGNGQPANSNYSGPRLIGSSANMHFKAKND-----VTFHQNITFPAYTGLKVDTDGKLI--------------------MKNVDAGWGNNSLSASTLDFSGVKGTTTIENLTTSSTNLLAHNFTIKEWRIKTGDSPVGHYTNVGEDIGN-SKVGVVRLDYGRNANYQGGVRFVGGTKLTIDEFYHAPWNYFDARKVKDVEITKKLLFGAPGGIGNLSGLMFNNLTLAKGATMIYGKDLDLHIDGTFTNDQGTMIINAQGWNFATLNAK-EATMRFNTDIDPTTGFYNPLVRINNAEKLAKNHDFVVLKANKINYELVGSK-ATNNDLTPNSATIEQQFKDRMALYNGQNRMDICMVRKGDTSDIKACGQAIGDNDMVNNPNNYQYLAGKAWRNLGVGKTANSQQISVRLGDNTKPTENFND................................................................................................................................................................... 698
12 3.000e-56UniRef50_V9QLU7 Vacuolating cytotoxin A protein (Fragment) n=5 Tax=Helicobacter pylori TaxID=210 RepID=V9QLU7_HELPX  ali  88  1......................................................................................................MQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFIEINNRVGSGAGRKASSTVLTLQASEKITSRENAEISLYDGATLNLVSSSNHSVDLYGKVWMGRLQYVGAYLAPSYSTINTSKVQGEMNFRHLAVGDKNAAQAGIIANKKTNIGVLDLWQSAGLNIIAPPEGGYESKTKDTPQNNPKNDTQKTEIQPTQVIDGPFAGAKDTVVNIFRLNTNADGTIRVGGFKASLTTNAAHLHIGEGGVNLSNQASGRSLLVENLTGNITVEGALRVNNQVGGSAVAGSSANFEFKAGTDTNNGTATFNNDIHLEKPGNLSGDAHTAYFNGNIFSGENPPNFKSG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 371
13 1.000e-55UniRef50_J0JA73 Vacuolating cytotoxin n=16 Tax=Helicobacter pylori TaxID=210 RepID=J0JA73_HELPX  ali  75  55.....................GTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYQSLLSSKIDGGWDWGNAARHYWVKGGQQNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNISIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVNFNHLTVGDKNAAQAGIIASNKTHIGTLDLWQSAGLNIIAPPEGGYKDKPNNTPSQSGAKNDKQESAKNDKQESSQNNSNT..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 366
14 3.000e-55UniRef50_J0DKI5 Vacuolating cyotoxin family protein n=2 Tax=Helicobacter pylori TaxID=210 RepID=J0DKI5_HELPX  ali  83  55.....................GTVSGLLSWGLKQAEEANKTPDKPDKVWRIQAGRGFNEFPNKEYDLYQSLLSSKIDGGWDWGNAARHYWVKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNISIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLNGNVWMGRLQYVEAYLAPSYSTINTSKVTGEVNFNHLTVGDKNAAQAGIIASNKTHIGTLDLWQSAGVKNSN.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 325
15 6.000e-55UniRef50_A0A1Q2QJZ4 Vacuolating cytotoxin n=1 Tax=Helicobacter pylori TaxID=210 RepID=A0A1Q2QJZ4_HELPX  ali  80  1.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MSFNNDIDSATGFYKPLIKINSAQDLIKNKEHVLLKAKII-----GYENASLGTNSISNANLIEQFNERLALYNNNNRMDTCVVR--NTDDIKACGMAIGDQAMVNNPDNYKYLIGKAWKNIGISKTANGSKISVRYLGNATPAENGGNTTNLPTNPTN-ARFASYALIKNAPFAQSATPNLVAINKHNFGTIESVFELANRSDDIDTLYAHSGVQGRDLLQTLLIDSHNAGYARTMIDATSANEITKQLNEANSALNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRRHTNNIDSFAKRLQALKDQRFA 305
16 2.000e-50UniRef50_V9QN36 Vacuolating cytotoxin A protein (Fragment) n=2 Tax=Helicobacter pylori TaxID=210 RepID=V9QN36_HELPX  ali  95  1......................................................................................................MQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDSADRTTRVNFDAKNILIDNFVEINNRVGSGAGRKASSTVLTLKSSEKITSRENAEISLYDGATLNLVSSSNQSVDLYGKVWMGRLQYVGAYLAPSYSTIDTSKVQGEMNFRHLAVGDQNAAQAGIIANKKTNIGTLDLWQSAGLSIITPPEGGYESKTKDTPQNNPKNDAQKTEIQPTQVIDGPFAGGKDTVVNIFHLNTKADGTLRAGGFKASLSTNAAHLNIGEGGINLSNQASGRSLLVENLTGNITVEGTLRVNNQVGGAAVAGSSANFEFKAGADTNNATATFNNDIHLEKAVNLKVDAHTAYFNGNVYFGKTTNLRVNGHSPEFKK...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 378
17 7.000e-50UniRef50_I9RPJ7 Vacuolating cytotoxin n=4 Tax=Helicobacter pylori TaxID=210 RepID=I9RPJ7_HELPX  ali  83  55.....................GTVSGLLSWGLKQAEEANKTPDKPDKVWRIQAGRGFNNFPNKEYDLYQSLLSSKIDGGWDWGNAARHYWVKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFVEINNRVGSGAGRKASSTVLTLQASEKITSRENAEISLYDGATLNL---ASNSVKLNGNVVDGPFAIRGSVFGP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 271
18 2.000e-49UniRef50_UPI000833A2F9 S-layer family protein n=1 Tax=Cupriavidus sp. D384 TaxID=1538095 RepID=UPI000833A2F9  ali  1......................................................................................................................................................................................................................................................DNGGGINTDGNGSTNVSGNSTNGTGVDNGNGTINTGGNGSTNVSGNSTNGSGVDNGGGINTDGNGSTNVSGNSTNGTGVDNGNGTINTGGNGSANISGNSTNGSGVDNGNGSISTGGNGSTNISGNSTTGPGVDNGNGTVDTQGNGSTNVSGNSTNGTGVNNGNGTINTGGNGSTNVSGNSTNGSGVDNGGGINTDGNGSTNVSGNSTNGTGVDNGNGSIHTDGNGATNVSGNSTNGSGVDNGNGSISTGGNGSTNISGNSTTGPGVDNGNGTVDTQGNGSTNVSGNSTNGTGVNNGNGTINTGGNGSTNVSGNSTNGTGVDNGNGTINTGGNGSANISGNSTNGTGVDNGNGSIYTDGNGSTNVSGNSTNGTGVDNGNGTIDTQGNGSTNVSGNSTNGTGVNNGNGTINTGGNGSTNVSGNSTNGTGVDNGNGTINTGGNGSANVSGNSTNGTGVDNGNGSIYTDGNGSTNVSGNSTNGTGVDNGNGTIDTQGNGSTNVSGNSTNGTGVNTGGNGSANISGNSTEGPGVDNGNGSIDTDGNGSTNVSGNSTNGTGVDNGNGSINTGGNGSTNVSGNSTNGPGVDNGNGTVDTQGNGSTNVSGNSTNGTGVDNGNGSINTDGNGSTNVSGNSTNGTGVDNGNGTIDTQGNGSTNVSGNSTNGTGVDNGNGAINTDGNGSTNVSGNSTNGTGVDNGNGSINTGGNGSTNVSGNSTNGTGIDN.............. 728
19 4.000e-49UniRef50_V8CK08 Uncharacterized protein n=2 Tax=Helicobacter canis NCTC 12740 TaxID=1357399 RepID=V8CK08_9HELI  ali  17  95................................................................................................................................................................................GVGGKSGYISGTWNAKEVYLTAYLGAGNAEKTAGADLTFNATGDIKAEGLIVDMWSNTQSDQLILRSSGGNITLKNSDFKIHGADIAGAGSVLTLEAKNTLSADNFKLNMPTSTSRVNATFKAGEISFTNSNLNIEASSTSGVVSTTKFQAKNITFDDKTTANFRADHFEMKAGENITLNGTQAGGNTTDAYINLDAGKNLSLNTLNGKGQFIAKAGENLSIKN-LNLHGNV-GTAVNETYATFEANTNNSTDNAGAFVVKFIAKDSITLKDTNIKLTNQLEGVGSADYAVFESGGDLTHTGKLTTATAQQTWGGATFDFSKVKGKASVGDMEIVAANVRMKDFAAKSLVVQRRNANGGQGTKLWAQEGGKYKFDSITLNDGTDLASGGGNAFVKDSKLELGSLSVGVKGGFYASNIAHTTATNITLHSNS-----TASFHHLTLTPGGQIIMD-ATNTQLVLDNQFVNGKNEAGVLELGVSIK--------------DSHLHNGYGKPLLAITNAGSNLENIHFKFIDAGEIKYNFVDSNGASMIHCDGSEKEKCQSIKDLIGIYAGNMDLSAIGLKYEKVLTYNYIGIKVNNANNPYQIGDIRYYLYQKCGQECVEKIGSISNTATITQEVQTQLSGDGKQIYVYEYTDSSGKFCNSTDTEQCKKDNNITESSTTLTQSNATQVEDIFEWLNFLSIYDKGITWTGANVLNYDLDFFLHTANQL---------------------NNTLDQLASIDRKTSTAASTRLAADIARSNRLVKLSNFNTNNASSAFAALRAK...... 916
20 3.000e-48UniRef50_Q8G9S0 Vacuolating cytotoxin (Fragment) n=19 Tax=Helicobacter pylori TaxID=210 RepID=Q8G9S0_HELPX  ali  95  1..................................................................................................................................................................................GRKASSTVLTLQASEKITSRENAEISLYDGATLNLVSSSNQSVDLYGKVWMGRLQYVGAYLAPSYSTINTSKVQGEMNFRHLAVGDQNAAQAGIIANKKTNIGVLDLWQSAGLSIITPPEGGYESKTKDNPQNNPKNDTQKTEIQPTQVIDGPFAGGKDTVVNIFHLYTKADGTIRAGVFKASLSTN........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 188
21 2.000e-47UniRef50_UPI000D3582C9 S-layer family protein n=1 Tax=Limnohabitans sp. Jir72 TaxID=1977909 RepID=UPI000D3582C9  ali  13  2...............................................................................................................................................................................TNLGTTNVNGTLTATTGNIGTVNANVAGNLSAGNISTVGTLNAGATTLASANVTGGLNVVGATTTAGLTNTGNLTSTGTTQFNGATTANGSLTTTGAAVFNSTNGLVTANAGVTVANGNLAVSAGNLTVSGTGTVNGTVTAGNLTTAGTLNANGATTLGDTLSVTGQSTLANLNAAVTNLGTTNVNGTLTATTGNIGTVNANVATVAGNLSAGNISTVGTLNAGATTLSSATVTGNLSAGNISTAGALNVNGTLTATTGNIATVNATNVNSTNVSATNVNATGTVTAAAGNITSLTATTGNIGTVNANVATVAGNLSAGNISTAGTLGVTGQTTLGALTAGTTTLASANVTANLNAGNISTAGTLNANGATTLGDTLSVTGQSNLNSLNATVTNLGTTNVNGTLTATTGNIGTVNANVATVAGNLSAGNISTVGTLNAGATTLSSATVTGN----LVAGNISTAGALNVNGTLTATTGNIATVNATNVNSTNVSATNVNATGTVTAAAGNITSLTATTGNIATVNATNVTASNTVTAATGNLTTVNATTLTATTGNIATVNATNVTASNTVTAATGNLTTVNATTLTATTGNIGTVNANVATVAGNLSAGNISTVGTLNAGATTLSSATVTGNLSAGNISTAGALNVNGTLTATTGNIATVNATNVTASNTVTAATGNLTTVNATTGNIATVNATNVTASNTVTAATGNLTTVNATTLTATTGNIATATNVTASNTVTAATGNLTTVNATTGNIATVNATNVTASNTVTAATGNLTTVNATTLTATTSNIGTVNANVATVAGNLTA 811
22 6.000e-46UniRef50_H8H5S3 Toxin-like outer membrane protein n=2 Tax=Helicobacter pylori TaxID=210 RepID=H8H5S3_HELPX  ali  19  25......LMPLLISGFASGAYANNLWDLLNPKVGGEYVHWVKGSQYCSWWEF-GGCLRNVW-------------GANHKGYDAGNAANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGNLTINLGNSVV-LDLSGSNSFTSYQGYNQGKDDVTFTVGTINLNGALEVGNRVGSGAGTHTGTATLNLNANK---VNINSNISAYKTSQVNIGNANSNSVSLSGDTCSSLAKISGANCSTSGPSYSFKGTTNNTTFSNASGSFTFEENATFSGAKWNGGTFTFNKGFSATNNTAFNSGSFNFKGTNSFNGATFSNATYTFDNQATFQNSSFNGGTFTFNNTNPTNSTQHPQIQNSSFSGNATTLKGSVIFQQAFNNSNHQLTIQNASFNNATFNNTGKITINEGA---------SFNNTTFNTSVDANNMTIS--GGVTLSGKNDLKNDSTLDFGSAKVTLAQGTTFNLTS-LGDKNSVTILNSSGGITYNHLLNHALNSLTNALKTNESSSKPQSFAQGLWDMITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 527
23 1.000e-45UniRef50_A0A2X3B9U0 Putative vacuolating cytotoxin (VacA) paralog n=1 Tax=Helicobacter fennelliae TaxID=215 RepID=A0A2X3B9U0_9HELI  ali  14  38...................................................................................................................................................................................................TSNNTGNFYIENKRTWSAGDPSFTQSYTNGTLIFGNKAESKGDGTVWFGTNSWFSCGLGPCSGHINANFEAKEVYLT---GTIGIGNDWKSGGANLNFKANDKITLDSFSLKYKNTTRANNFTLNGGAGIDIKNSTLNVGGDLNLISTNGDIIFDDKSSLTVQSGGLTTDA-YINFEAKNITLHNINITATQGKAQVNFNLKLNFDLITAASYSNAIFEGKTINIK-NSSLKTTPGTSTKNANISFKAQGDITLDNVDINTHLGTSGNGGRVDFVAQNLKHTGTIVIGRLDSGIWGAVVDFSKVSGVVSIGHLKARKGVVHL-NKDFSALSLEIRRTTGNPTTDFDMPEGGSAKFGSINVEAGGGSGSGHNASFMANTTLTIGTLNLGKIAGFYASNIETSNIQNLILDHNARAEFYKLNIINNEMNATSSIGLSYFDVKVNQSNNSVNNYGRPIYITHAGKNLSNLTIEGNKTYRFIDAMEIKYIFTTASGNTQTFHCGDSGTQAQCDYIKNSIAIYEGAKVEPTINADGSIDYTQDRVDLAKLQAKLQAGLNNIGLRYEKVVDYSTIGIKINNPDNPYDINDIRYYIWQKGGKEYVAKIAAISPTTAR-QETITQTQNGQVVYTKYDEQKKEQVVCR---------DNTAGCSAHQVETSN----SDIFKWLQFVSIHSRGITFTGTNIMDYDIGFFEHTATQLY---------------------NTLEQLSSTERKSSTAEATKLAADIAKIQRLVKLSRVDSDNGIKFASLMQNKKRAHYA 818
24 2.000e-45UniRef50_O25063 Toxin-like outer membrane protein n=175 Tax=Helicobacter TaxID=209 RepID=O25063_HELPY  ali  20  28......LMPLLISGFASGVYANNLWDLLNPKVGGEYVHWVKGSQYCAWWEF-AGCLKNVW-------------GANHKGYDAGNAANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGNLTINLGNSVV-LDLSGSNSFTSYQGYNQGKDDVTFTVGAINLNGTLEVGNRVGSGAGTHTGTATLNLNANK---VNINSNINAYKTSQVNIGNANSGSVSLSGDVCSSLASVIGANCSTSGPSYSFKGTTNATNFSNASGSFTFEENATFSGAKWNGGTYTFNKEFSATNNTAFSSGSFNFKGVSSFNGTSFSNASYTFDNQATFQNSSFNGGTFTFNNQTNPTNNAHPQIQNSSFSGNATTLKGFVNFQQAFNNSNHQLTIQNASFNNATFNNTGKITIEKDA---------SFNNTTFNTSVDTNNMSVT--GGVTLSGKNDLKNGSTLDFGSSKITLAQGTTFNLTSLGSE-KSVTILNSSGGITYSNLLNHAINGLTSALKTNESLSNPQSFAQGLWDIITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 530
25 3.000e-45UniRef50_T2T780 Uncharacterized protein (Fragment) n=2 Tax=Helicobacter pylori TaxID=210 RepID=T2T780_HELPX  ali  20  26......LMPLLISGFASGAYANNLWDLLNPKVGGEYVHWVKGSQYCSWWEF-AGCLKNVW-------------GANHKGYDAGNAANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGNLTINLGNSVV-LDLSGSNSFTSYQGYNQGKDDVSFNVGAINLNGALEVGNRVGSGAGTHTGTATLNLNANK---VTINSNINAYKTSQVNIGNANSNSVSLSGDTCSSLAKISGANCSTSGPSYSFKGTTNNTTFSNASGSFTFEENATFSGAKWNGGAFTFNKGFNATNNTAFNSGSFTFKGTSSFNNATFSNASYTFDNQATFQNSSFNGGTFTFNNQSNPTNNAQHPFENSSFSGSATTLKGSVIFQQAFNNSNQQLTIQNASFNNATFNNTGKITIN---------ESASFNNTSFNTSVDTSNMTI--NGGVTLSGKNDLKNGSTLDFGSSKITLTQGTTFNLTSLGSE-KSVTILNSSGGITYNHLLNHALNSLTNALKTTESPSKPQSFAQGLWDMITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 530
26 7.000e-45UniRef50_V8CCL5 Uncharacterized protein n=1 Tax=Helicobacter macacae MIT 99-5501 TaxID=1357400 RepID=V8CCL5_9HELI  ali  13  41........................................................................................YELQNKSNESSGTFSVGSTRTWSTAGTQSYKNGTLIFGNTSQSPKTDSSIWFGGTDWQSGLVGYIKTKFEAKDIYLTGTIGAGNAWATGGGAELNFNASNSFKAESLDLKFNHAGLQYSNFFVSANDINIKNSQLN--------------ARSDGFKMHLSSSNGDITFDSSNANFGGE----LVITSGKNINLTGNSSLTSRGNVIRLKAQNGSITGNGNLNFSSGTPIYVGVIEILAKDKIELGTAKLQVNASSLVGSMDGRIEVKSENGDITFDKLELV------------GNNGISAFGTYAHIKAGGSISVKTNGAIYSNRGLNNSTDTAGRFTT---TIEAGKDITLNNT-----DIFLLNQLAGIGAPDSMKLIAGGSLTHTGTISFLTNQQTWEGAMLDISGVKGSAKLGNIIGSAFYINANKTLSADSITINARQTNGGFTQIWTKEGGSYTFKDINLADTNGAGGSGTNSFVKGSTLTIENLSLGTMAGLYASNIQNTNVKNISMSNLS-------TAVFHNLTLQEGGHITMDATSQI-------------QVKSRAYETNTTPTLGKVTLNVDASDSKPFLSIAYAGSNLENLNIQAGKTYRFIDAGEIEYKLKSGGSTETFHCT-DNKEKCNTIKNMVGVYAGGARSAKLGLQFEKVADYSTIGIKATAIDNPYDIDDIRYYIWQKGGNEAVAQIGGISKGAHTEQTTQTRLNSTISQNKDSQEITTNDKI--YTISGKGDFTQSELSSNTTLTEAEKASASDIFKWFNVLALHQKGVAWTAVNVIDRDLGFFEDTAKQL---------------------NNTLGQLVSTERKSNAATAVRFASDLAKAQRLVKLARIDNDEQEYRFANLLSQKR.... 906
27 3.000e-42UniRef50_A0A210QS37 Uncharacterized protein n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QS37_MIZYE  ali  10  3....................SGDIGTDTLSVVGGQMAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNV----NGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVN---GGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVA-GSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGSNVNGGQVAGS.................................. 921
28 4.000e-42UniRef50_A0A286P1F3 Vacuolating cytotoxin A n=13 Tax=Helicobacter pylori TaxID=210 RepID=A0A286P1F3_HELPX  ali  72  2.................................................................................................................................................................................................................................................................................................................................................................................NIGKGGVNLSNQASGRSLLVENLTGNITVDGALMVNNQVGGYALAGSSANFEFKAGVDTKNGTIAFNNNISLGRFVNLKASAHTVNFKDIDT-------------------------GNGGFNTLSFSGVTNKVNINKLITASTNVAIKNFNINELLVKTNGISVGEYTNFSEDIGNQSRINTVRLETGTRSIYSGGVKFKGGEKLVINDFYYAPWNYFDARNIKNVEITNKLAFGPQGSPWGTAKLMFNNLTLGPNAVMDYSQFSNVTIQGNFVNNQGTINYLVRGGNIETLSVGNAAVMSFNNDIDSATGFYKPLIKINSAQDLIKNKEHVLLKAKII-----GYENASLGTNSISNANLIEQFNERLALYNNNNRMDTCVVR--NTDDIKACGMAIGDQAMVNNPDNYKYLIGKAWKNIGISKTANGSKISVRYLGNSTPTDNGGNTTNLPTNTTNNARFARYALIKNAPFATNATPNLVAINKHDFGTIESVFELANRSKDIDTLYDNSGVQGRDLLQTLLIDSHNAGYARTMIDATSANEITKQLNTATDALNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRRHTNNIDSFAKRLQALKDQRFA 582
29 1.000e-41UniRef50_K9QQN8 Filamentous haemagglutinin family N-terminal domain protein n=2 Tax=Nostocales TaxID=1161 RepID=K9QQN8_NOSS7  ali  14  379.................................................................NLFLMNPAGFIFGGNASLNVSGAFTATTANGIKFGNDWFNAVGNNNYANLVNPTGFAFTMNQPGAIINLGVGTGQSLSLLGGTVVNTGQLSAPAGQIVVTSSLELPALTPDSSQPNSWTVAIASLPELLTVGNTNTGLTTNPDGSVKLTNSNVTIPTTPGTTIVSGNVNVSGETGGTVNVLGTKVGLVDANIN---ASGTNGGGTVLIGGDYKGGGTVPNATQTYINSNTVINADSLQNGNGGRVIAWADDATQFFGN-ISARGGANSGDGGFVEVSGKNFLTFQGQVDVSAPNGQFGT----LLLDPSSLTIIDATFGGTFDATFSGSILADTPDIGANTISWGALVSGSGANINLEATGDITIDNITENNLITLDSSNSGSFTLNSTNGAVRFVDTNDTIATNGGAINISGAGDILLGNGGGYASNITVTSSNGSINTGNLQTRPSDSPAFSSNEYGNVSLSAFGNISTGNIIAS--GDGYSPGNITVNSSNGAINLGNLDTRSIFEDGTITFIFDDSGDVTLSASGNISVGNIIASGDGYSP--------GNVSVDSSNGNINIGNLDTSVINQSDATAGTVTLSAAGNIFT-----GDINSYSDEGFDSGQGGA---VEITTSGGSITTGDINSYVFKNIGGDFTGTGGQVT--LTASNNIIV-------------GDIDASAEVTEIDGTAEAIGGNVTLQTTNTAGSIIRF--------NSINTSATTDEDSSIQAGNVEVLTNGLVQGTGTGNTINTGEFYVFDEIEQVPFTTPLSSGGTVTIQHDGGPGNVPFTVGNSSINGTAGAIYAGSASNNLSSGSF....................................................................................... 1189
30 2.000e-41UniRef50_Q9ZIE7 Vacuolating cytotoxin A (Fragment) n=61 Tax=Helicobacter pylori TaxID=210 RepID=Q9ZIE7_HELPX  ali  96  1...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................IDASKSDNGLNTSTLDLSGVTDKVNINKLTTAATNVSIKNFDIKELVVTTRVQSFGQYTIFGENIGDQSRIGVVSLQTGYSPAYSGGVTFKSGKKLVIDEIYHAPWNYFDARNITDVEINKRILFGAPGYIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDERVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGASYDNISAS.............................................................................................................................................................................................................................................................. 248
31 4.000e-41UniRef50_T1CN16 Uncharacterized protein n=2 Tax=Helicobacter fennelliae TaxID=215 RepID=T1CN16_9HELI  ali  14  234....................................................................................................................VFKNSNLTIDNSSTAGINSETQFISSNNISVDNTNNFNLHTEVINFTAGKNLELSGKTNISISTLTAKPQMTFKAGEKLINTMNMNVNLQALHTGGSTNINFEGKNMTIKDSELRVSSPGGNLSADRHNMNFTTTSGDMNFTNTKIIADGGRSTFKLSATGDNLTYTMGRGEFSNSSAWSANSIELKNSTINIAEASLAGQSSSATFNATSGDINFDKSTNATISTERVEFKATNDIKLLGTNTGGNTTNADIDFDAGGNIHLGATNGNGALNMKAGRDITIDGTIVVSLNPSYATFEAQNITINGGSTRGINNSTDTAGEFITTNGDINLKNVNITLANQLANVGSPDMIIFKGENLTHTGIFDTQTAQQTWEGATFDFSGVRKSASVGTMIVEAAKIKLNNFKADSLTIRTRETNGGSHNGTPGVGTVLFTKTDSNLKFGTITLNGGTNNFVKNSTLTVDTVKLGSESGFYASNIETSNIQNLILDHNARAEFYKLNIINNEMNATSSIGLSYFDVKVNQSNNSVNNYGKPIYITHAGKNLSNLTIEGNKTYRFIDAMEIKYIFTTASGNTQTFHCGDSGTQEQCDYIKNSIAIYEGAKGEPTINADGSIDYTQSRVDLAKLQAKLQAGLNNIGLRYEKVVDYSTIGIKINNPDNPYDINDIRYYIWQKGGKEYVAKIAAISPTTAR-QETITQTQNGQVVYTKYDEQKKEQVVCR---------DNTAGCSAHQVETSN----SDIFKWLQFVSIHSRGITFTGTNIMDYDIGFFEHTATQLY---------------------NTLEQLSSTERKSSTAEATKLAADIAKIQRLVKLSRVDSDNGIKFASLMQNKKRAHYA 1127
32 5.000e-41UniRef50_I9XLD5 Vacuolating cytotoxin n=21 Tax=Helicobacter pylori TaxID=210 RepID=I9XLD5_HELPX  ali  92  59.........................GLLSWGLKQAEEANKTPDKPDKVWRIQAGRGFNDFPHKQYDLYKSLLSSKIDGGWDWGNAARHYWVKDGQWNKLEVDMKDAVGTYTLSGLRNFTGGDLDVNMQKAT.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 164
33 2.000e-40UniRef50_A0A1H7K9P2 YadA-like C-terminal region n=1 Tax=Variovorax sp. YR750 TaxID=1884384 RepID=A0A1H7K9P2_9BURK  ali  10  58...............................................................................................................................................................................GGTTSNNNGVLVSDDGISTPTLTATSVSAGSVTANNGTINTLSSGSITSGTVAAGSITATRVTTTSLSTTSATATNLTSTSISTATLTAGTVSAGSVSAGTVSSTNVTATNLSAGSGTVNSLTSTSISTATLTAGTVSSTNVTTTNLSATSGTVSSLTSTSISTGTLTAGSITAGTVSSTNVTATNLSATSGTVSSLTSTSISTGALTAGTVSAGSITAGTVSSTNVTATNLSAGSGTVNSLTSTSISTATLTAGTVSAGSVSAGTVSATDVTSTNLSANSGTVNSLTTTSISAATLSAGTVSAGSVSAGTVSATNVTSTNLSANSGTVNSLTSTSISTATLTAGTVSAGSVSAGTVSATNVTSTNVSAANGTVNSLSSNSVTTGSISSVNGTIQSLTSTNIMATGITSTNVLATNVDATNVVTTNLTSNTGSISTLTSTNVSTTNVTASNGTINTLSSTNVSTTNLSATNGTINTLSATNVSATNLTASNGTINTLSSTNVSTTNLTASNGTINTLSATNVSTTDLTAANGTINTLSSTNVSTTNLTANAGTINTLSATNVSTTDLTANNGTINTLSATNVSTTNLTANAGTINTLSATNVSTTDLTANNGTINTLSATNVSTTNLTANNGTINTLSATNVSTTNLTANAGTINTLSATNVSTTDLTANNGTINTLSSTNVSTTNLTANNGTINTLSSTNVSTTNLTANAGTINTLSATNVSTTNLTANAGTINTLSATNVSTTNLTANAGTINTLSSTNVSTTNLTASRGTINTLSATNVSTTNLSAASATINALTA....... 856
34 4.000e-40UniRef50_T2SIH0 Uncharacterized protein (Fragment) n=1 Tax=Helicobacter pylori PZ5080 TaxID=1337394 RepID=T2SIH0_HELPX  ali  23  25......LMPLLISGFASGVYDGTDILGLSWGEKSQKVCVHRPWY--ALWNC------DKWEEKTQQYTGNQLITKT---WAGGNAANYYHTQNNQN--ITANLKNDNGTYFLSGLYNYTGGENNGGNSNATFNLGASSGNSFTSW--YPNGHTNVTFSAGTINVNNSVEVGNRVGSGAGTHTGTATLNLNANK---VNINSNISAYKTSQVNIGNANSGSVSLNGDTCSSLASVVGANCSTSGPSYSFKGTTNNTTFSNSNGSFTFEENATFSGAKWNGGAFTFNKEFKATNNTAFNSGSFNFKGASSFNNATFSNATYTFDNQATFQNSSFNGGTFTFNNQTNQS-AQHPQIQNSSFSGGAITLKGSATFEQAFNNSNHQLTIQNAFFNNATFNNTGKITIEKDA---------SFNNTTFNTSVDTNNMSVT--GGVTLSGKNDLKNGSTLDFGSSKITLAQGTTFNLTS-LGDKNSVTILNSSGGITYNHLLNHALNSLTNALKTTESPSKPQSFAQGLWDMITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 534
35 5.000e-40UniRef50_J0NZH4 Putative vacuolating cytotoxin (VacA)-like protein n=458 Tax=Helicobacter TaxID=209 RepID=J0NZH4_HELPX  ali  24  25......LMPLLIGGFASGAYDGTDILGLSWGEKSQKVCVHHPWY--ALWSC------DKWEEKTQQFTGNQLITKT---WAGGNAANYYHSQNNQ--DITANLKNDNGTYFLSGLYNYTGGEYNGGNSNATFNLGANSGNSFTSW--YPNGHTNVTFSAGTINVNNSVEVGNRVGSGAGTHTGTATLNLNANK---VNVNSNINAYKTSQVNIGSANSNSVSLSGDTCSSLASVIGANCSTSGPSYSFKGTTNNTTFSNASGSFTFEENATFSGAKWNGGAFTFNKGFNATNNTAFNSGSFTFKGTSSFNNATFNNATYTFNNQAMFQNSSFNGGTFTFNNQSNPTNSAQHPFENSSFSGSTTTLKGSVIFQQAFNNSNQQLTIQNASFDNATFNNTGKITIEKDA---------SFNNTSFNTSVDTNNMTIS--GGVTLSGKNDLKNGSTLDFGSSKITLAQGTTFNLTSLGSE-KSVTILNSSGGITYNHLLNHAINSLTNALKTTESPSKPQSFAQGLWDMITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 538
36 1.000e-39UniRef50_M3QTY2 Putative vacuolating cytotoxin (Fragment) n=1 Tax=Helicobacter pylori GAM93Bi TaxID=1159057 RepID=M3QTY2_HELPX  ali  23  28......LMPLLIGGFASGAYDGTDILGLSWGEKSQKVCVHHPWY--ALWSC------DKWEEKTQQFTGNQLITKT---WAGGNAANYYHSQNNQ--SITANLKNDNGTYFLSGLYNYTGGENNGGNSNATFNLGANSGNSFTSW--YPNGHTNVTFSAGIINVNNSVEVGNRVGSGAGTHTGTATLNLNANK---VTINSNINAYKTSQVNIGNANSNSVSLSGDTCSSLAKISGANCSTSGPSYSFKGTTNNTTFSNASGSFTFEENATFSGAKWNGGAFTFNKGFSTTNNTAFNSGSFTFKDTSSFNNATFNNATYTFNNQATFQNSSFNGGTFTFNNQSNPTNSAQHPFENSSFSGSTITLKGSATFEQAFNNSNHQLTIQNASFNNATFNNTGKITIN---------ESASFNNTSFNTPVDTNNMSVT--GGVTLSGKNDLKNGSTLDFGSSKITLTQGATFNLTS-LGDKNSVTILNSSGGITYNHLLNHALSSLTNALKTTESPSKSQSFAQGLWDMITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 541
37 3.000e-39UniRef50_A0A1Q2QJT4 Vacuolating cytotoxin n=14 Tax=Helicobacter pylori TaxID=210 RepID=A0A1Q2QJT4_HELPX  ali  87  59.........................GLLGWGLKQAEEANKTPDKPDKVWRIQAGRGFNEFPNKEYDLYKSLLSSKIDGGWDWGNAARHYWVKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSFKDSADRTTRVDFNAKNISIDNFF............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 201
38 4.000e-39UniRef50_Q9X414 Vacuolating cytotoxin (Fragment) n=24 Tax=Helicobacter pylori TaxID=210 RepID=Q9X414_HELPX  ali  87  1...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LITASTNVAVKNFNIKELLVKTNGISVGEYTNFSEDIGDQSRINTVRLETGTRSIYSGGVTFKSGKKLVIDEIYHAPWNYFDARNVTDVEINKKILFGAPGNIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQDLIKNKEHALVRARNIDYNLVGVQGASYDNISASNTNLQEQFKERLALYNNNNR.......................................................................................................................................................................................................................................... 240
39 5.000e-39UniRef50_J0S2R6 Vacuolating cytotoxin family protein n=8 Tax=Helicobacter pylori TaxID=210 RepID=J0S2R6_HELPX  ali  23  25......LMPLLISGFASGVYDGTDILGLSWGEKSQKVCVHHPWY--ALWSC------DKWEEKTQQFTGNQLITKT---WAGGNAANYYHSQNNQ--DITANLKNDNGTYFLSGLYNYTGGEYNGGNSNATFNLGASSGNSFTSW--YPNGHTNVTFSAGTINVNNSVEVGNRVGSGAGTHTGTATLNLNANK---VNVNSNISAYKTSQVNIGNANSNSVSLSGDTCSSSVSVVGANCSTAGPSYSFKGTTNNTTFSNASGSFTFEENATFGGVKWNGGAFTFNKGFNATNNTAFNSGSFTFKGTSSFNNATFNNATYTFNNQATFQNSSFNGGTFTFNNQTNPANSAQHPFENSSFSGNATTLKGSATFEQAFNNSNHQLTIQNASFDNATFNNTGKITIEKDA---------SFNNTSFNTSVDTNNMSVT--GSVTLSGKNDLKNGSTLDFGSAKVTLAQGTTFNLTSLGSE-KSVTILNSSGGITYDHLLNHALNSLTNALKTTESPSKPQSFAQGLWDMITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 538
40 9.000e-39UniRef50_UPI0009FE0394 T9SS C-terminal target domain-containing protein n=1 Tax=Salisaeta longa TaxID=503170 RepID=UPI0009FE0394  ali  23  65................................................................................................................................................................................................................................................................................................................TADGIPNDPGESVKIKEGDGLQILNSSFSIDDLTIENTDSDPTND----LIGVYQDSLVVNG-DLTLGGTIDMFDSFDGGGNLRV---TRNLTISGDLKVKSNSGGSLESGNTGVIKIGANFTNNGSFTSADGTVSLGSAQSLDGDFTANNPFYNVIIGNDGSTGDEKDPAEVDPDDTLTGSGTTEGSDVTFTGNSFEVNKVKFNPSSTNITVKGVVFSNVDVIDGTVLLEDTFEINGDLLVGST-GTLDISGGSSGAATGGITFSSGATQSVGGATGSDLN-LGNLTVTDDAGGNATTVNFPQV---SSALLVNNLTINGGSTLDLGRRLEVT--GDFTNDGGTFTFKSNTDETILFNGGGTQTI------SSTTGFNVESIEINNQRDQGLTPPDVTVEAGS................................................................................................................................................................................................................................................................................. 510
41 2.000e-38UniRef50_A8FE08 Collagen triple helix repeat protein n=46 Tax=Bacteria TaxID=2 RepID=A8FE08_BACP2  ali  10  955...............ATGITGATGPTGATGITGATGTTGATGITGPTGPTGSTGITGATGPTGATGITGATGPTGATGITGATGPTGVTGITGATGPTGVTGITGATGPTGVTGITGTTGSTGSTGITGVTGPTGATGITGSTGSTGATGSTGPTGPTGSTGITGATGPTGATGITGATGPTGATGITGATGPTGVTGITGATGPTGATGITGATGSTGATGSTGPTGPTGSTGITGATGPTGATGITGATGPTGATGITGATGPTGATGITGATGSTGATGITGATGSTGATGSTGPTGPTGSTGITGATGPTGATGITGATGPTGVTGITGATGPTGATGITGATGPTGATGITGSTGPTGVTGITGTTGSTGSTGITGATGPTG-ATGITGATGPTGATGITGATGGATGITGATGPTGATGITGSTGPTGVTGITGATGSTGATGITGATGSTGATGITGATGSTGATGITGATGITGSTGPTGATGITGATGITGSTGPTGATGITGATGPTGATGITGATGSTGATGITGATGSTGATGITGATGITGSTGGATGITGSTGPTGATGITGSTGSTGATGTTGATGPTGATGITGATGPTGVTGITGSTGPTGATGITGATGPTGVTGITGATGPTGATGITGATGPTGVTGITGATGITGSTGPTGATGITGATGPTGVTGITGATGITGATGPTGVTGITGATGITGATGSTGATGITGSTGPTGATGITGATGATGATGSTGPTGPTGATGSTGATGPTGATGITGSTGPTGATGTGGFTDTALYAANSSGPTIVTVAGGTNIPLPNFQNITGFTANGTSTVFTVLQTGKYYITYQVNTTTALLISTRLLLNGATTISGSVQSPVISTSFINNTVIVNLTAGSTISL...................................................................................... 1837
42 2.000e-38UniRef50_K4ISP8 Vacuolating cytotoxin (Fragment) n=40 Tax=Helicobacter pylori TaxID=210 RepID=K4ISP8_HELPX  ali  86  1...............................................VWRIQAGRGFNEFPNKEYDLYQSLLSSKIDGGWDWGNAARHYWVKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNISIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSRENAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYLAPSYSTIN.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 197
43 4.000e-38UniRef50_A0A1S4ELZ2 hornerin-like n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S4ELZ2_DIACI  ali  61...........................................................................................NTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTSPGTGSPNTDSYGSPSGNTPSGTGITTPGSASSPSGTGNTTPSGNAPNVTGSPNTDNSYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAP---NGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGNPNGSTPSGTGITTPGSGSSPNGTGNTTPSGNAPNGTSSPNTDNYGN........... 936
44 4.000e-38UniRef50_J0F5Q7 Putative VacA like protein n=3 Tax=Helicobacter pylori TaxID=210 RepID=J0F5Q7_HELPX  ali  19  25......LAPLLIGGFASGAYANNLWDLLNPKVGGEYVHWVKGSQYCAFLEFL-GCLKNVW-------------GANHKGYDAGNFANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGNLTINLGNSVV-LDLSGSNSFTSYQGYNQGKDDVSFNVGTINLNGALEVGNRVGSGAGTHTGIATLNLNANK---VNINSNISAFKTSQVNVGNANSGSVSLSGEVCSSLASVVGANCSSSGPSYSFKGTTNNTTFSNASGSFTFEENATFSGAKLNGEAFTFNKGFSATNNTAFNSGSFTFKDTSSFNGANFSNASYTFNNQATFQNSSFNGGTFTFNNQTNPTNSAQHPFENSSFSGNATTLKGSVIFQQAFNNSKHQLTIQNASFNNANFNNTGKIIIN---------ESASFNDTTFNTSVDTGNMTIT--GSVTLIGKNDLKNGSTLDFGSSKITLTQGTTFNLTS-LGDKNSVTILNSSGGITYNNLLNHAINSLTSALKTNESSSRPQSFAQGLWDMITYNGVTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 530
45 9.000e-38UniRef50_A0A0K2QTN3 Vacuolating cytotoxin (Fragment) n=1 Tax=Helicobacter pylori TaxID=210 RepID=A0A0K2QTN3_HELPX  ali  40  1...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ISVGEYTNFSEDIGNQSRINTVRLETGTRSIYSGGVKFKGGEKLVINDFYYAPWNYFDARNIKNVEITNKLAFGPQGSPWGTASFMFXXSNLRPQCGHGLFSIFKCNRSGAFHQQSRHYQLFGSRWACSDFKCG............................................................................................................................................................................................................................................................................................................................ 134
46 1.000e-37UniRef50_A0A0K2QTD1 Vacuolating cytotoxin (Fragment) n=16 Tax=Helicobacter pylori TaxID=210 RepID=A0A0K2QTD1_HELPX  ali  54  1...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ISVGEYTNFSEDIGNQSRINTVRLETGTRSIYSGGVKFKGGEKLVINDFYYAPWNYFDARNIKNVEITNKLAFGPQGSPWGTAKLMFNNLTLGQNAVMDYSQFSNVTIQGHFTNNSRHLSRYLSSRR................................................................................................................................................................................................................................................................................................................................... 127
47 7.000e-37UniRef50_A0A0K2QT48 Vacuolating cytotoxin (Fragment) n=1 Tax=Helicobacter pylori TaxID=210 RepID=A0A0K2QT48_HELPX  ali  59  69.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QQTCFWASREPLGHPLLMFNNLTLGPNAVMDYSQFSNVTFQGDFPKNQGAINLFVRGGLLDFLNSGHQASLKFNNXVDSAPGFYHPFIKITKAQNLSKKKEHVLGKGPNIDYNLGGVQGARYDNI................................................................................................................................................................................................................................................................. 193
48 4.000e-35UniRef50_A0A0E4BYK2 Vacuolating cytotoxin (Fragment) n=102 Tax=Helicobacter pylori TaxID=210 RepID=A0A0E4BYK2_HELPX  ali  60  20......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GGYTYFSEDIGSQSRINTVRLETGTRSIYSGGVKFKSGEKLVINDFYYAPWNYFDARNIKNVEITNKLAFGPQGSPWGTVKLMFNNLTLGQNAVMDYSQFSNLTIQGDFTNNQGTINYLVRGGQIATLNVGNAAAMLFNNNVDSATGFYQPLMKINSAQDLIKNKEHVLLKAKII-----GYGNVSAGTNSISNVNLIEQFKERLALYNNKK........................................................................................................................................................................................................................................... 226
49 5.000e-35UniRef50_I9QZK9 Vacuolating cytotoxin n=3 Tax=Helicobacter pylori TaxID=210 RepID=I9QZK9_HELPX  ali  75  34AFFTTVIIPAIVGGIATGTTVGTVSGLLSWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAARHYWVKGGQQNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKASADRTTRVDFNAKNISIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVDFNHLTVGDQNAAQAGIIASNKTHIGTLDLWQSAGLNIIAPPEGGSAQNNSNTQVINPPNSAQKTEIQPTQVIDGPFAGGKDTVVNIDRINTNADGTIRVGGYKASLTTNAAHLHIGKGGINLSNQASGRSLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGTDTKNGTATFNNDINLGRFVNLKVDAHTANFKGIDT-------------------------GNGGFNTLDFSGVTGKVNINKLITASTNVAVKNFNINELIVKTNGVSVGEYTHFSEDIGSQSRINTVRLETGTRSIFSGGVKFKSGEKLVIDEFYYSPWNYFDARNV.................................................................................................................................................................................................................................................................................................................................................................................................... 621
50 4.000e-34UniRef50_A0A060TC00 ARAD1B12870p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TC00_BLAAD  ali  1443............SNSGAASGSGSNTGAATGSESRTGVVXXXXXXXXXXXXNISGSGSNTGAASGSATKTGAASGSNTGVVSGSNTGAFSGSNAGSVSGSNAGAASATNTGAASGSGTNAGGASGSNTGIASGPASNTNTGAASGKTNVVSASNTGIVSGSEPASNTGAASNSGTVVASGSGSASNTGAVSGSNSGAVSGSASITGSVSGSNAGAASDSASNHEAISGSNTGAVSGSASNTGANSAAASASNTGAVSGSNSGAVSGSASITGSVSGSNSGAASGSASNISGSNTGAVSGSYTGSVSGSNTGAASGSNAGAVSGSASNTGTAPLSASNTNVVSGSGTAAVSNTGALSGSGAASGSMSGTASISVSASNINTASGFGSNTGSITGPITGAISGSGSKTATASASNTGVASNSGTGVASGSGLASNTAVTGSNTGAISGSASNTGAVSGSGTNSAASGSNTGAASGSNTGAVSGSGTNPAVSGSNTGAISGSNAGSASNTGAISGSASNTGAASNSGAISGSNTRAASGTKTGAVSGSATKTAAVSGSQTGVISGSNTGAISESSSNAGAASGVASNSGAGSGSVSNTGAVSASNTGAASGPVTGGESGSASNTAAASGSASNNGVISGSNTGAASGTNAGGASRSAFNTGSASGVASNAGAGTGSAAATNTGAALPEETDSASNGDDGSNTGTNXXXXXXXXXXXXXXDNGSGNGSNNSSDNGSGNVSGNGSDNGSGNGTGADSGHGSGNDSDNGSDTGSADVSNSGSGSGSDSGSADSGNGSGSGSDSGSGNGASDXXXXXXXXXXXXXXXXXXXXXXXPDGSRPVTSTARGGKVSGYFSGAGTTANGEESTQSASVLQSNNAGRLSGRAGLFATA................................................................................................. 2322
51 5.000e-34UniRef50_UPI00034D534F CHAT domain-containing protein n=1 Tax=Oscillatoria sp. PCC 10802 TaxID=1173028 RepID=UPI00034D534F  ali  17  302..........................................................................QVETGTLTLSAARNITLANTNLNATGTAQLQAGDTVRVRDTWVSAGGNLDIQGTAGIDLL--SELSSFISAGSNLNLISNGEIYAGHLSAGGDFSIRSLAGLGNFTSLDGSSISAQGKLTFGNYTGGSLSLYAGDSIKAGNITINPSERNLQPSLSLIAGVNPTANPATGSIDTGSITLSSSGGYVSLSAAGNLNTGSIGAGGSNVSLRNGSSLDTSSEKLDGRSIFISANGDTGDINAANTGGQGGVITIQSLYGGISTGTGTLSAGSVTGDAGLIDLRAAGNISTGNLNAASASEKSGSITLYSRAGAINTGSLNAGSQTGSGGAISLHATSGSASLSGSSGNINLYAGGNIATGDV-AGGDISLASQSAINTSAGSVAASGNITLHAAGDIAAASVTSTGGNVRMISSSGGINTAAGSVQTNGGKITLYAANVTAGDLASDGGDI........................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 760
52 6.000e-34UniRef50_A0A2N0DK84 Autotransporter-associated beta strand protein n=1 Tax=Pseudomonas baetica TaxID=674054 RepID=A0A2N0DK84_9PSED  ali  10  181...............................SIGGITLADTPVIGVYGGSQVNMTNSNTGVINGRIAFETSAAGNTFTNAGAITGGVSMGAGSTNTFTAVTGSSVQVGDGVQVSVGLGGLININLTFAPTGTVDGGLGGTNSLILQNPAGVGGGITGTGTASSATYVNFNNLTLNSGTWTLQGPLVSGATTLNGGIANFNNNATFGSGVLTSNGGILQASNAGLNISNLISVGAGGVTVQGGNATTLSGVISGSGGFTKAGTGQLNLSAANTYLGNTTLNGGTV--QVSNNQAFSSGSLNVTGATTLSAPGTISLANAISLGGTLTAGGTGALTLGGLITGSSGLSKTGTGSLTLSGANSGYTGTTTLSAGSLLVTNNNSLGSGALNTAAGTSLDSTANVTLANNIAMTGALNVLGSNALTL-GGVLSGTGGITKSGTASLTLTGNNTNAGNTLLNGGSLFVGSNTALGTGALNAAAGTTLDATTAVTLANAVALAGGLTVGGTLSGVVSGVGNLIKNGTANLNLSGNNTFSGGTALNAGTLIVGSNTALGTGALTTAAGTTLDASTAVALTNAVSLGGNLNVGGSANLTLGGIVSGSGGLTKNGAANLILNGANTFLGAIALNAGTITAGANAALGSGNITVGGVATLDSNAAVTLNNAVILNNSLGIGGNNALTLGGVISGASQLVKNGAANLTLNGTNTYSGGTMLNAGSLTVGNSAALGTGTLSVEGAGTLNSSSAVTLNNNVILNANLTAGGANALTLGGVISGANGLIKTGASSLTLNGNNTYTGTTANAGSLVVGSSTALGTGTLNASNGTTLDANTAATLANNVNLGGTLTLGGTNALTLGGVVAGIGGLVKNGAADLTLNGANTYFGNTALNTGKLTVGSNTALGSGTLNAAAGTTLDANTAVSLNNAVALAGALNVGGTANLTLTGLVSGAGSLVKNGTAN.............................. 1102
53 8.000e-34UniRef50_G8BAL7 Uncharacterized protein n=1 Tax=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) TaxID=578454 RepID=G8BAL7_CANPC  ali  1275...........................SGSGSESTGEPTGEPSGSGSESAGGSSTPGYSVSXXXXXXXXXXXXXXXXXXXXXXXKSDGSVETESGIVSGSDSSLTTITTFEPPSSSSGFGTESGLITDTNNESSAGSTGGASEPTGGASESTGGASEPTGEPTGGASESTGGASEPTGEPSGGASESTGGASEPTGEPTGGASESTGGASEPTGGASESTGGASEPTGNGSESTGEPTGEPTGGASESTGGASEPTGEPTGGASESTGGASEPTGEPTGGASESTGGASEPTGEPTGGASESTDGASEPTGEPTGGASESTGGASEPTGEPTGNGSETTGGSSTPGYSVSXXXXXXXXXXXXXXXXXXXXXXXSDGSVETESGIVSVSDSSLTTITTFEPPSSSSGSGTESGLITDTNNESSAGSTGGASESSGQATGGASEATGHSTGGDSSSSFDKSTASDDFSFSLLGSYSSGVESATTGGGAGAGQTTDSLLSMTTDSPSGFNPGPDGNNGSGSGDNGTGAGDNGTGSGNTGDNGTGSGNTGDNGTGSGNTGDNGTGSGNTGDNGTGAGDNGTGAGDNGTGSGNTGDNGTGSGNTGDNGTGSGNTGDNGTGSGNTGDNGTGAGDNGTGAGDNGTGSGNTGDNGTGSGNTGDNGTGSGNTGDNGTGAGDNGTGAGDNGTGSGNTGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGAGDNGTGSGNTGDNGTGSGNTGADNGSGAGDNGIGSGNTGSGSGDNGIGSGNTGSGSGDNGIGSGNTGSGAGDNGIGSGNTGADNGSGAGDNGIGSGNTGSGAGDNGIGSGN.............................. 2199
54 2.000e-33UniRef50_A0A2P1BHQ1 Uncharacterized protein n=20 Tax=Bacteria TaxID=2 RepID=A0A2P1BHQ1_BACPU  ali  10 1450............STGITGATGPTGATGITGATGPTGVTGITGATGPTGATGITGATGPTGATGITGATGPTGATGITGATGSTGATGSTGPTGPTGSTGITGATGPTGATGITGATGPTGATGITGATGPTGATGITGATGSTGATGSTGSTGSTGATGSTGSTGSTGATGITGSTGPTGATGSTGPTGPTGSTGITGATGPTGVTGITGSTGPTGVTGITGTTGSTGSTGITGATGPTGATGITGATGPTGATGITGATGPTGATGITGATGPTGATGITGSTGPTGVTGITGATGSTGATGITGATGSTGATGITGATGSTGATGITGATGITGSTGPTGATGITGATGITGSTGPTGATGITGATGPTGATGITGATGSTGATGITTGATGITGATGITGSTGPTGATGITGSTGPTGATGITGSTGSTGATGTTGATGPTGATGITGATGPTGVTGITGSTGPTGATGITGATGGVTGITGATGPTGATGITGATGPTGVTGITGATGITGSTGPTGATGITGATGPTGVTGITGATGITGATGPTGVTGITGATGITGSTGTTGATGITGATGPTGATGITGATGATGATGITGATGSTGDTGITGSTGPTGVTGITGATGSTGATGITGATGSTGATGITGATGITGSTGPTGATGITGSTGPTGATGITGATGATGATGITGATGPTGVTGITGATGITGSTGPTGVTGDTGSTGATGSTGPTGPTGATGSTGATGPTGATGITGSTGPTGATGTGGFTDTALYAANSSGPTIVTVAG--GTNIPLPNFQNITGFTANGTSTVFTVLQTGKYYITYQVNTTTALLISTRLLLNGATTISGSVQSPVISTSFINNTVIVNLTAGSTIS........................................................................................................... 2316
55 2.000e-32UniRef50_T5CIS2 Uncharacterized protein (Fragment) n=9 Tax=Helicobacter pylori TaxID=210 RepID=T5CIS2_HELPX  ali  73  1...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AVKNFNINELLVKTNGISVGEYTNFSEDIGNQSRINTVRLETGTRSIYSGGVKFKGGEKLVINDFYYAPWNYFDARNIKNVEITNKLAFGPQGSPWGTAKLMFNNLTLGHNAVMDYSQFSNVTIQGDFINNQGTINYLVRGGNIETLSVGNAAVMSFNNDIDSATGFYKPLIKINSAQDLIKNKEHVLLKAKII-----GYENASLGTNSISNANLIEQFNERLALYNNNNRMDTCVVR--NTDDIKACGMAIGDQAMVNNPDNYKYLIGKAWKNIGISKTANGSKISVRYLGNSTPTENSGNTTNLPTNTTNNARFARYALIKNAPFAHSATPNLVAINKHDFGTIESVFELANRSKDIDTLYANSGAQGRDLLQTLLIDSHNAGYARTMIDATSANEITKQLNTATDALNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRRHTNNIDSFAQRLQALKDQRFA 460
56 2.000e-32UniRef50_A0A1I8FTT0 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8FTT0_9PLAT  ali  11 3909...........ASGTTTTSSHIAASAGTSCSASKVASGASGTTTTSSYIAASAGTSGGASKVASGASDTTTTSSYIAAS--AGTSSNASTDASGASGNASTDASGASGTTTTSSHIAASAGTSCSASTDASGASNTTTTSSHIAASAGTSCSASKVASGASGTTTTSSYIAASAGTSGFASGASDTTTTSFHIAASAGTSCSASTDASGASGTTTTSSHIAASAGTSCSASKVASGASDTTTTSSYIAASAGTSCSASTDASGASSNASTDASGASNTTTTSSHIAASAGTSCSAASKVASGASGTTTTSSHIAASAGTSGDASTDASGASGNASTDASGASNTTTTSSHIAASAGTSCSASKVASGASGTTTTSSHIAASAGASGNASTDASGASNTTTTSSHIAASAGTSCGANASTDASGASRASDTTTTSSHIAASAGTSCASSNASTDASGASGTTTTSSHIAASAGTSGGASKRLASGASNTTTTSSHIAALRGTSCSANASTDASGASSNASTDASCASDTTTTSSHIAASAGTSCSASKVASRASGTTTTSSHIAASAGTSCSASKVASGASGTTTTSSHIAASAGASSNASTDASGASGTTTTSSYIAASAGTSGGASTDASDASGNASTDASGASGTTTTSSHIAASAGTSGGASTDASCASSNASTDASGASGTTTT-------SSHIAASAGTSGGASKVASGASNTTTTSSHIAASAGTSSNASTDASGASGTTTTSSHIAASAGTSCSASKVASGASDTTTTSSHIAASAGTSCSASKVASRASGTTTTSSRIAASSGASSNASTDASGASDTTNTSSHIAASASTSCSASTDASGASGTTTTSS.......................................................................................................................... 4757
57 2.000e-31UniRef50_A0A1B8J8V9 Uncharacterized protein n=1 Tax=Helicobacter sp. CLO-3 TaxID=211 RepID=A0A1B8J8V9_9HELI  ali  15  77.............................................................................................GSWNYTPNTNNSSSDIFYVKSGETYREGFGTFAFTTNYTNGTLIFGNDKKEQGSGQIHLGSGGGGGHTAYLNGTFNVKEAYFTGTLTTGNNTG--AGAGASLTFNANENITTQGFNANFWSNTQGATLALNSKKDITINSSTFTIDGSNSNFTAKANGKFSANGFTLSMPGTTESINANISAKEIDIKNGSLSTGTSSTAGVYSTTSFTSTGGDINFDASTTTNFKTENVIFKSTNGSINLAGTTVINSGELTTNANINF-NSDKNITLGNADIKINYGSGALNMKASENL-TIDKINLNFDLITAATYS-HATFEGANIDIKSGNITTTPGASTSNSQIDFKSSGSINLGTNIQLGTSGKGGRLNFSGASLTHTGKLIVGRDGEGTGEELLDSGIWGAVVDMSNVSGKVSLGDLYARKGTF-ITNSDFAAKSLYVRRTTGNPTTDINTQENSKLTIDTITIQGGGADNSGHNASLKAGSSLTSKNVTLNNLATINASNIETTNIQNLVLKYDAEAYFNQLNIIDAGSIVNSTINIKQSFSVDVKQSGNAVDNFGTPLLYVVNAGANMSNINIQAGTIHRFITASGGISYTFTTASGATSDGGADTLEKCTYIKNSIAIYEGDKVNPTTNTDGSIDYTAGRVDLATVGSN-------LGLRFEKVVDYSTIGIKADNPDNPYDIGDIRYYIWQKGGTEYVSKIAGISTTSLRNETIEQ--------------------------IQNGQKVLDSNGNAVMVEVAN----SDIFDWMQFLSIHSKGITWTGTNIMDYDIDFFYDTATQLY---------------------NTLGQVASTERKSSMASSTRLAADIAKIQRLVKVSRSNVMDRGDFAEYLKSLKGKRFA 925
58 4.000e-31UniRef50_Q52647 Outer membrane protein A (Fragment) n=1 Tax=Rickettsia akari TaxID=786 RepID=Q52647_RICAK  ali  35.......ASVLTLTNANAVLTGVIDNTTGVDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASV-LTLTNANAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASVLTLTNANAVLTGAVDNTTGVDNVGVLNLNGALS-----QVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASVLTLTNANAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTNAASVLTLTNANAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASVLTLTNANAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASVLTLTNANAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASVLTLTNANAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASVLTLTNANAVLTGVIDNTTGVDNVGVLNLNGALSTGNIGNTNSLATISVGAGTATLGGAVIKATTTKLTDAASQVTFTNPVVVTGAIDNTGNANNGIATFTGNSTVTGNIGNTAALATVNVGAGLLQVQGGVVKANAINLTDNVSAVTFTNPVVVTGAIDNTGNANNGIATFTGNSTVTGNIGNTAALATVNVGAG.......................................................................................................................................................................... 834
59 5.000e-31UniRef50_A0A150U922 Uncharacterized protein n=1 Tax=Bradyrhizobium sp. AT1 TaxID=574934 RepID=A0A150U922_9BRAD  ali  727.........ATVVGNGYGVTLAGTSEAVTLVGTGDVLTLSGNYITLSTSAASNVTLSGTGDTVTLGGNGLIVSLAGTSDSATLTGTGASVGVNGNQNTVSASGSTVGISTIANGTATVLGSSDTISVSGNQNSVTVTGNNDVVTVSGNGDRVTLTGDGTVSGTTDTVIVNGNNETIALTGTNGTLSLSGTGDVVTVSGTGAWGTITTTNAASFTLTNGWSGETLNTSGSNVAVNAYSNALTINGNGNSVSVNNTLDTVTLNGSNETVSLGASAYSALINLNGTGSTVSGAVSALAAAVVLSGTGSSATVIGNGYGVTLAGASETVTLIGTGDRLTLSGNYITVNTSAASNVTLSGTGDAVTLGGNGLILSLAGTSDSATLTGSGASVSVNGNQNTVSASGSTVGISMVANGTATVLGNSDTITIAGNQNLVTVTGNNDVVTVSGTSDRVTITGDNSTVTVNNSYDTVTVNGNNATLTLTGAAEVVSLSGTGDVVTLSGTGTYATVTTTNAANFTLTNGWSGETLNTSGSNVTVGAYSNNLIVNGNGNSVSVIHTQDTVTLNGSNEYVALGGSNNVVTSSGNSDTVVVSGNDDVVTLTGSYENIISSKAVTVTATGAYDDITINSGSGAGTSWVTLGGVSGIVQASLGTTLRISATTGSVNVNDIETIVFGNNTNTVTLANGTGTTLVGVASVTAALAGTTGNDTMTGTSGNDILDAKGGIDSVVGAGGDDAYVFHKGYGQLTINNYSASNNNSLGTLSFDSSVLTSDVLISRGGVGFGDLIIQIPSTGDQVTVSGGFGNSANGLRQVLFASGTAWNMAYLGAHAGYDVNVDGSTSTINASNVLIQMPANNATVTVNGSNDPITVTGTSDTVIVNGSNDTVTANATAVTVTGTGSAVTISGNGNAVSVAGTNDTATLVGTSDIVTVSGSNAVINTANAVTATVTGTGSSATIG............................. 1673
60 5.000e-31UniRef50_A0A1M5J1X8 Uncharacterized conserved protein, contains a C-terminal beta-barrel porin domain n=1 Tax=Bradyrhizobium erythrophlei TaxID=14373  ali  11  528...TIIGGTLALSGNGSIATSSGVSNNFGTFDISAASAGVSIQTLSGNGTVTLGANTLTLSNASSTYSGAIAGSGGLTLTTGTETLSGTLSYQGNTTVNGGTLHVTNAFTVLSTATLTVNNTGTYTIDQLLTNSGAIQVNAGGTLIATAGGITNNLGATIVNNGRIDDVLNNAGTVTNNLTYNADVATNTGTIANSATGTWTGNVITNASNATGISNAGTWVGNVQANTGMIANTGTWTGTVTSSGTFNNNSPGMVSGLLTNSGTAGNGGTLGGGLSNTAGTMTNTGTINGGATVSGGTLNTNTSTSAINGGLTNTATVNAQGQVNGSIANNAGGTFNATGDLTGNSTFTNANGANLNVNAGTYTSTGLVTNNGALAVANGATLTNGITNNATGTIGNSGTINALNLANYGAVTNNAGANYNSDLANESTGTVTNSGNWTGNLTSNANSHAGAINNSGNSGTWTTTTGFINGGTLTTTGTISGGLTNSATANALGTVGGAILNHGAGIFTVTAALAGNDTFTNNGTARLNVTGGDFTGI--TTLSNNSTAAAGIAIATGRTLSANSVVNSAGATIGNSGTLSSLNSAVSNAGTLNTDVATSIVNGGLTNTGTVTAAGQVDGIIANNGAGTFTVDGTLAGNNTFTNNGTAQLIVAAGSFTGITTLTNNSTAGAGIVNAAGRTLSANAIVNNAGATINNLGTITTNSMIDNGAITGAYAMADGWLSGIGSVQNLAVNGGTFAPGNGAPGSSMTVTGSLALQSGALFLVQINPAPASFANVTGTAYLGGATVGAIFAAGSYVSKQYTLVQATGTVSGTFNPAVVNTNLPSNFHTNLSYDTHDAYLNLALNFGIPGGLNGNQQNVGNALTNFFNATGGI.......................................................................................................... 1414
61 9.000e-31UniRef50_A0A2W5U632 Collagen-like protein (Fragment) n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A2W5U632_FLAPS  ali  146SFTTSNLTGATGAQGATGTTGNTGATGATGNGIVSTVNNGNGTYTFNYTDGTSFTTSDLTGATGAQGATGATGNGIASTVDNGNGTNYTDGSSFTTSNLTGATGAQGATGATGNGIVSTVSNGNGTYTFNYTDGSSFTTSDLTGATGAQGATGTTGNTGATGATGNGIASTVDNGNGTITINFTDGTSFTTSNLTGATGAQGATGATGNGIVSTANNGNGTYTFNYTDGSSFTTSDLTGATGAQGATGTTGNTGATGATGNGIASTVDNGNGTFTINYTDGSSFTTSNLTGATGAQGATGSTGNGIVSTVNNGNGTYTFNYTDGTSFTTSNLTGATGAQGATGATGNGIASTVDNGNGTFTINYTDGSSFTTSNLTGATGAQGATGATGNGIASTVDNGNGTITINFTDGTSFTTSNLTGATGAQGATGSTGNGIASTVNNGNGTFTINYTDGTSFTTSNLTGATGAQGATGATGNGIASTVDNGNGTFTINYTDGSSFTTSNLTGATGVQGATGATGNGIASTVDNGNGTFTINFTDGTSFTTSNLTGATGAQGATGTTGNTGATGATGNGIASTVDNGNGTITINFTDGTSFTTSNLTGATGAQGATGATGNGIVSTVNNGNGTYTFNYTDGSSFTTSNLNGATGAQGATGSTGNGIVSTVNNGNGTYTFNYTDGSSFTTSNLIGATGA.................................................................................................................................................................................................................................................................................................. 839
62 3.000e-30UniRef50_A3K1J1 Outer membrane autotransporter barrel n=2 Tax=Sagittula stellata E-37 TaxID=388399 RepID=A3K1J1_9RHOB  ali  2....................SQGSTGSSTFAGDAGGLVTVSAGTLTVDGASASTTSVRDRRRGRGGCGSVRTGTRWSIPVADVNAGDTLTSPVRAGSLGGGGSVTVNGVIDGALDVENTSTFDINAGGSVTGTATHASTGTSTLAGTVGNLNITAAGTVQVDGAAVSNGLSFVDGGGTLAVQAGASYTATGGPVNVGFDAGNTGSGTLSVADTGSVIGNIFVHNAGTVDINGTSGDATTEVTGALVLFATATGNSTV-AGDIGGAVTVNAGTLTVDGVSEFQSSLDVNAGSLVVSADLGVTGAAEASGGDVTVDAGATLTTATLTMSGDGALTLNGDLDGDLNITDTNNTVAVTHALNTPGGVTGTVTQNNANSTITTGDAGNTQFGTLVNTLGTVTVN---TGTLQLNNASSNAGTMNVNSGTAVILNTADFTNTGTFDLNGQMGNVSLADTFTNDGGVVTLANNLAAQYVQTGAGAQTTIDGNTLVGTGTTGATMAINAGALTIDAGQTLTYGALTLADGATMTVNGSMAALTDTTTNINGAATYNDGSALNDNGSINIGATGSVTFNTGGTGIVFDADQDNNAVGTITSDGAITVNGTGNVSFGTDGDDNFTNQGSATVALLNTSSVSDIDVLTNSSTANGATAGTTAIFLASGTSLGFTTLDSSAGTIVSAGTLDGDVNLTGTAGLDLNDGTITGTLDNQSGTAITLDGTITGAFTQQGAGTQTTVDGTSSFGSTVDVDSGTLTVDADTTVTGATTVDDATLTVNAGDTLTATGNVLAGGSGGAGTVVVDGTIDGDVTAQNTATVTVNGSVDGNLQTQNTASFDINGTSGAAPAEVTGNVTQAGTSALNTTGAGTITVDGDAIVTGLVNIDAGTLTVAGGATLDATGAGVDVAAGAFGNVNATGEIDGSTTNAGTFQNDGTMDGVTNSGGFTNTGTTAGVTNSGTFTNN............................ 941
63 5.000e-30UniRef50_C7G008 Uncharacterized protein n=1 Tax=Dictyostelium discoideum TaxID=44689 RepID=C7G008_DICDI  ali  10  575..............................NSIGGLTTAGVTTVAGVTTATASTVAGVTTASTVAGVTTNSIGGVTTGRGTTGAASTTGRSTTGRGTTGATTANSIGGLTTAGVTTVAGVTTATASTVAGVTTGRGTTGSASTTGRGTTGAASTVAGVTTANSIGGITTATASTVAGVTTANSIGGLTTAGVTTVAGVTTASTVAGVTTASTVAGVTTNSIGGVTTGRGTTGATTANSIGGVTTGRGTTGATTANSIGGLTTAGVTTVAGVTTATASTVAGVTTATASTVAGVTTANSIGGLTTAGVTTVAGVTTVNSIGGATTANSIDGATTATASTVAGVTTANSIGGITTATASTVAGVTTNSIGGVTTGRGTTGAASTTGRSTTGRGTTGATTANSIGGLTTAGVTTVAGVTTATASTVAGVTTANSIGGLVTTVAGVTTVNSIGGATTANSIDGATTATASTVAGVTTANSIGGITTATASTVAGVTTVNSIGVTTASSIGGLTTAGVTTVAGATTANSIGGLTTAGITTVAGATTVNSIGGLTTAGITTVAGVTTANSIDGATTATASASTVAGVTTANSIGGITTATASSVAGVTTASVGGLTTAVASTVAGVTTAASIGGVTTATASTVAGVTTASTVAGVTTNSIGGVTTATASTVAGVTTAASIGGLTTAGLTTVAGFTTAASVGGLTTAGATTVAGSTTSPASVGDLTTAGATTVAGVTTAASVGGLTTAGATTVGGLTNANSIGGVTTATASTGGVTTATASTVAGVTTAASIGGLTTAGLTTVAGVTTASVGGLTTATASTVAGVTTAASIGGLTTAGITTVAGSTTTVAGVTTAASVGGLTTAGATTVAGVTTAASIGGLTTAGATTVAGVTTAASIGGLTTASLTTVAGSTTSSSSVGGLTTAGATTVAGVTTAASVGGLTTAGITT....................................... 1500
64 6.000e-30UniRef50_A0A1G6W8E9 Uncharacterized conserved protein, contains a C-terminal beta-barrel porin domain n=5 Tax=Burkholderiaceae TaxID=119060 RepID=A0A  ali  484ASLTNTMFIGASGSGSRAVYVGTSGSIGSFDNSGTVTAEQFGVYTRGAIGSLGNTGAISGGSAGICNTGTLGTLTNSGLLTSASYALYNLSSGVLGTIINSGTITGNTGIVNAGTIAATNVDGGVIGDAANPGSGISNNGTIGALTNNAGGTIAGQWTGIANWGGTIGTLTNSGTILSNSNGVVDLNGSIGTLTNSGLISGGANGVAEGGSIALLNNSGTISGGTIGVNNAYQALAPIDTLDNSGTISGGRTGIYNGDGDSIGTLTNSGLLTGASYALYNLSGGVLGTIINSGTITGNTGIVNAGTIAALTNADGGVIGDATNPGNGISNNGTIGALTNNAGGTITGQWTAIANWGGTIGTLTNSGTILSNLNGVVDLNGSIGTLTNSGLISGGANNNSGTISGGTIGVNNAYQALAPIGTLDNSGTISGGRTGIYNGDGDSIGTLTNSGLLTGSSYALYNLSGGVLGTIINSGTINGNTGIVNGGTIAALTNADGGVIGDGTNPGNGINNSGTIGALTNNAGGTITAIANWGGTIGTLANSGLILGTINGVVDLNGTIGTLNNSGLIIGGVNGIAEGGSIALLTNSGLIGGVTAGIYNGYQAYGPIGTLDNSGTILGERTGIYNGNGDSIGTLTNSGLLTGSSYALYNAASGVLGTITNSGTIAGNIANLSSSDLNINGGSGSVFGTLTGVDGAIGTIANASSNVVFGSGNLLLNDAINVGSNTVNNVGATLQVNAPMTITGNYSQGAGATLLSGVTSASNYGELMVTGNTTIASGSSVGLRSQSYAFTDGQRYLVVDTAGTASYNEATLNYSANGYGGTIVGQRVTVGGHTALELCLETCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPATTPNAIASLTGVLSYTGFNANLMNLQNAVLAVNASGSTAQANHAGGQLA................................................... 1429
65 1.000e-29UniRef50_A0A257PGE0 Uncharacterized protein (Fragment) n=1 Tax=Rhodospirillales bacterium 20-64-7 TaxID=1970566 RepID=A0A257PGE0_9PROT  ali  10  15..............................................................................................................................................................................AAGVSLIALTAMLGATAAHAAPPPSPATVTFGTDTAVAFATGGSTQSNAALITATLNNAVGNSSVTGTPGTTSNGTFNVAANALSASAVGNTATVTIDTQAIGSNGTTANGLASLSTQTNGTGSSLTATVSNSTLSDVITNVGTPTTLSLASNSVNATVTGNSANSQVSGVIPVSYTSTNAVGGSLTSTSGSGNIVVASNQSNTGTGASASTLLNDTALLSVTSTGTGAQTVGLNTSETGNSLGSTFTGNTASNGINIVSTNGVTTGQGALNGSLVVANVQSNAPTGGFSASNTGSAVQTAIVGGTGAPINFTGTSTQTGNSISASATGNSTGTGVGSGNFITLGVNLTGVTALAPDTVTTGTTPSIAQTGDLIVGNHQSNSGLTLASSLTGGQITTVIDGTTGATVTTANNSVSSAAQGNTAANGIVSSGTLNNISGLAALANLQTQTGGSDTATSSTNAITATAGNATLAEGVSGSTMAVSGNSVSATAGGNNVSNSVNLAASAVSAQAVGATPAPASLVYASPGSSTNNAGAAINNQQTNADNASATASTNTIQGTATGDTLTLAGNNISASSTSNNASNSDVVSGTTTLAGSLGLLSGQSGTGTSSATASGNNVIADYLANGTATPLTGNTGSVTGTTIDAMATSNNASNTVSATGGALSNGA--TGASVTGTTTTFSADAALLNEQASGGSTSATNSNNTIKTAASATGAVSGTSFSVSGAASGAAADLAQALGNVATNSVTSAATTSSTDTAGLGNTQTNSGGTSATLSG............................... 793
66 3.000e-29UniRef50_UPI0004708A9E PPE domain-containing protein n=1 Tax=Mycobacterium genavense TaxID=36812 RepID=UPI0004708A9E  ali  10  173.....................................................................................................................................................................................................TTNQNGQTDQARAVAQATANTTSTQTQTLTQQLSSTANSGTTTTISDGQTLTIVSGQTYTIGAGDTVIVESGSSFTVAGSLTVDGTLNNGGILTDYGTVTLSDASTLTNGGSLTVTDSGTLTIDGTLTDRGALTIDSGTVTIDSGGTVTVDPTGTLTISGTIGILTDGGTLTDYGTVSINSGGGLTVSSGGTLTVADGGTLIDSGTLASSGTVTINSDSTLTINSGGTLTDSGTLTVYSGGTLTDSGTVAVGDGSTLTDSGTLTVNAGGVLTDSGTVTVDSGGTLTNDAGITVGGNINTGGILTVGADGTLTNNDILTVGADGILTVNSGGTVTLNADSGLTVGPSGTLTINGGGVLTDSGTLTINGGGVLTDSGTLTVDAGGVLTDSGTLNVDAGGTLMDGGTLTISGGGALTNSGTLTDSG-TLTVSSGGALTDSGTLTINSGGTLTDLGTLNVSSGGALTIDSGGTLTDSGTLTVNAGSTLTDSGMLTVNASGSLTDSGTLNVADGGTIANSGGLTVNGALNVADGGSVTNSGVVTVNTGGALNDSGILTIQSGGSLSVQSSTPGESGGALTINGGILNDAGILTVHDGATLTDGGTLNVQSAGSLTNSGTLTVNNGATLTDSGALTNNGALNDYGAVTVQSGGTLSDYGTLTVESGGTLGNDGTVTVQPGGTLANAGSVNVNPGGTLTDSGTLTNAGTFNNAGAVSIDSRICASLINNGNLTNTGTLDNAGTLNLNSGSTLINSGSLTDSGSLNDYGTLTITDGGNFNVSPSSYLNVN.. 957
67 5.000e-29UniRef50_A0A1C9ZXG4 Vacuolating cytotoxin A (Fragment) n=35 Tax=Helicobacter pylori TaxID=210 RepID=A0A1C9ZXG4_HELPX  ali  77  1................................................................................................................................................................................................................................GNVWMGRLQYVGAYLAPSYSTINTSKVTGEVNFNHLTVGDKNAAQAGIIASNKTHIGTLDLWQSAGLNIIAPPEGGYKDKPNNTPSQNPPNSGQKTEIQPTQVIDGPFAGAKDTVVNINRINTNADGTIRVGGYTASLTTNAAHLHIGKGGV............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 183
68 1.000e-28UniRef50_UPI0009419305 S-layer family protein n=1 Tax=Paraburkholderia phenazinium TaxID=60549 RepID=UPI0009419305  ali  11  176..............NGGGIVTGSVGDNLNILGVNVTLNASGGQYSLTGTGEVANTTGAQFDLGANTQVSIAGSDNTTILTGTGNSVSVTGDNNVTTTALSGNALTYSGTDNQGSGSSVTLAENSISDVVGDANTVFALNNSSGTINGGGNTISGSGSISGNTFTLEGTGTNADTVNLAGATDVSVLLGDTTTDVGFVSTSATVSSLNGGGIVTGSSGDNLNILGVNVTLNANGGQYSLAGTGDSASVSNSTVSIASGNQATLSGSDNTVTASTSDSITLDGIGDTVTAGTGSTIDVSGQSDSVTASGSTIDLAADSQATISGTGDNVAAASGDVIDLSNATITLTADSSVTIEGSNDTVVGAASDNITIDGGSDSVSADSGSSITIAGLSNTIDASQTTVALDGNTSVNINGSADAISETTGDSAGVYGAGNSINTTAGALVYISGTNGDADTVSGNGDQFGGTAANGQGTGILLAANSQANITGSDDGISETTGDSMGVKGGGNSIDTGAGALTYITGTNGDADAVSGNGDQFGGTTANGQDTGIVLTADSQANITGSDDGISETTGDSMGVAGGGNSIDTVAGALTYITDTNGNYDDVTASNDAMGGTTANGQQTGIVMTSDSQANIFGNGDGISESAGDSAGIYGGGNSIDSTAGALVYISGTDGSDDTVHASDDAMGGATANGQQTGIVMTSDSQANIFGNGDGISESTGDSAGIYGGGNSIDSTAGALVYISGTDGSDDTVTASNDAMG-GTTANGQPTGIIMTSDSQANIFGNSDGISESAGDSAGIYGGGNSIDSTAGALVYISGTDGDADKITANDDDSGGTTANGQPTGIVMTGDSQADIYGNDDTTSGGDDTSVMADGSGDTLNGQTIADDSTADLSSSGSFSDTDDGSGNTGDPSXXXXXXXXXXXXXIDDPVILNLTGGQVQTTSVTGSTTY..................................... 1106
69 3.000e-28UniRef50_A0A257Q1G9 Uncharacterized protein (Fragment) n=1 Tax=Acidocella sp. 20-57-95 TaxID=1970301 RepID=A0A257Q1G9_9PROT  ali  10  2............GNTGVVGNATIGTLSNSGLITGTKVAGIDVFLIDSLTNSIGGVISGGSAGIAGFAIGALSNSGSIIGSKLYGVAEFGFISLSNSSGALIKGGIGGVYATNVGTLSNSGTIIGVNGNGVNAVSVTALNNQNGATILGGLTGVSITGSVASLVNMNGALIQGTTGNGISLGSVGTLTNEYGGAIIGGQTGVNVAGSIGNLLNTNDALIQGSGNNGVSAGSIGALTNEFGSTILGNTGDGISASGIGSLSNHSSALISGSLTGISNTGSIGTLNNYNGGIVVGLQGDGLSTGAVGVINNYQAGSIIGGNTGISVTGALGTLSNSTGGLISGNLKDGLKAGSIGGLSNNTGGSLFGGNTGLYSAGGIGTLSNSGYIIGTAHDGIVIGGGFSGGLTNSGVIKGGSIGIYNAGSLAGISNSNGLIYGGVAGIYNLGTIGNLSNTGSGSIASVLNETGGTIGVGVAVALLNNATIGAIS-NASKAFILGSMTAIGGTGSVGTLSNSGTIIGTLNAGVQLAGIGSLTNSGGLISGGNYGVHDVGSIALLANSGTITAGKTGIYTSAGIGSLSNSGAIGGGSNGVFVAGSIGLLSNLGSITGGALGDAIYAQGGIGSIGNGIGGVISAGNTAISTSNIGTLSNSGTIKAGGDGVVVNGNLGSLNNNAGGVIAGDQVYG-----IDVVGSLGALSNSGSIISGAGFGVYAGNFGSIVNGIGALISGQSNGIYSAGSIASLNNSGSISG----TNNAGVYAAGVISSLTNTNGGSISGSHSGVHSAGSIGALSNSGTIKGTVFYGVQAAGIGSLTNSTGALISGGYAGIDSATGNIGSLTNNSTIYGGTIGIEAINISSLLNSGTIAGGFTAIKSSGSIGTLSNTGTIIAYDPNAIVVAGSLGPIYNPGYISGNIGSGVGDIAITGGSGSIIGTLTNGTINAATGNVNLSGN............................ 932
70 3.000e-28UniRef50_Q9LB83 Vacuolating cytotoxin (Fragment) n=30 Tax=Helicobacter pylori TaxID=210 RepID=Q9LB83_HELPX  ali  94  1................................................................................................................................................................................................................................................................................................................................................................................................................................................................VDAHTAYFNGNIYLGKSTNLKVNGHSAHFKNIDATKSDNGLNTSALDFSGVTDKVNINKLTTAATNVNIKNFDIKELVVTTRVQSFGQYTIFGENIGDKSRIGIVSLQA-YSPAYSGGVTFKSGKKLVIDEIYHAP............................................................................................................................................................................................................................................................................................................................................................................................................. 135
71 5.000e-28UniRef50_A0A2S8S9G5 Uncharacterized protein (Fragment) n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A2S8S9G5_9BACT  ali  10  415ASITNLSGLSTLTATNISGTLTTAAQPNITSVGILGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTANITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLSTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLSTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLSTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTL---GNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLSTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATSANITNLSGLNTLTATNISGTLTTAAQPNITS.......................................................................................................................................................... 1241
72 5.000e-28UniRef50_Q52708 Outer membrane protein A (Fragment) n=1 Tax=Rickettsia conorii TaxID=781 RepID=Q52708_RICCR  ali  10  1..............................................................................................................................................................IGNTNALRTVNVGAGIATLEGAIIKATTTKLTNAASVLTLTNVNAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNALATISVGAGKATLGGAVIKATTTKLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTVTGN---IGNTNALATISVGAGKATLGGAIIKATTTKLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATISVGAGKATLGGAIIKATTTKLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATISVGAGKATLGGAIIKATTTKLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATISVGAGKATLGGAIIKATTTKLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGGSTVTGNIGNTNAL---ATVNVGAGLLRVQGGVVKSNTINLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATISVGAGKATLGGAIIKATTTKLTDNASQVTFTNVVVTGAIDNTGNA-NNGIVTFTGGSTVTGNIGNTNALATVNVGAGLLRVQGGVVKSNTINLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGDSTVTGNIGNTNALATVNVGAGLLRVQGGVVK-SNTINLTDNASQVTFTNPVVVTGAIDNTGNANNGIVTFTGNSTVTGNIGNTNALATVNVGAGIATLEGAVIKATTTKLTNAASVLTLTNVNAVLTGAIDNTTGVDNVGVLNLNGALSQVTGNIGNTNA............ 804
73 8.000e-28UniRef50_A0A257R081 Uncharacterized protein n=1 Tax=Acidiphilium sp. 20-67-58 TaxID=1970291 RepID=A0A257R081_9PROT  ali  477..LTTALGAGTVSGSTLSVNGNASLAQATGNIASANNLTVTGTNLVDASQTAAAPT-------TAPVSYNGTTASVNTGFSVVNTQTASATVSATQSQTGADLSLGGSGAVSNATLQAQGNNFNAAATTNSASNNLVVGTAATPVAVLTSSVGGLNVQNITSGGGTSATIGNAGSPAVTSTTGLTGSYTGSTISTTSNTLSVPAGQTISFSTTGTGLTPAQLASVISASGTGTVTYSGSTVTLTSGTSASTFSFPTGTTFSISSGAKTVATAGTITVPALNTTPFANIQTGGNLTNSTLSVTGNNYGAVAQGNVGNTTVAVTADTVNGGALAGTQSSATVTSTSQTATADLSAVNAQTNASATTASAYGGAQITSSATLPTISGSTLSVSNNALNATAQANTATTALTVNGTISQNSQGTYAASGALISSQNATGDVTAT---AGTVATSSTTSSSVGQTISAPGAIGSNSSLALNGNTTTATANANSANNTLTANATTLDNATTAAASITTNLQTVNAAYALNNTQTSSGATNGVTAQANSNVYNNDTAGSSGLQSSTAVLNGNTTTASAIANTASNTLNLGGSTVNAPAAILNNQTNSDSVAAAGTSNVQFSLTGSSATTAAASGSSIAVTNNALNVQAAGNSAVNALNALPTANFGTQAAGASAGGTTPVTAQYVALNSQTNSGSVSATSAAFGATAPTSQFSVALNGFAGGTTQVQNTSVTVTGNAVNVNAFGNSAQNTLTLSGLNSGNATNALQNAQTNTGNVTATASYNAFGATTGAPGATGSTVNVGNNSIIARATGNSAINTVVA........................................................................................................................................................................ 1277
74 1.000e-27UniRef50_A0A267GC59 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GC59_9PLAT  ali  164...............ATGATAGTGSTPATGATAETGATAGTGSTPEAGATEATGATAGTGSTPGAGATAETGATAGTGLTSATGAIAETGATAGTGSTPGAGATAETGATAGTGLTSATGATAETGATAGTGSTPGAGATEATGATAGTGSTPATGATAETGATASTRSTPRAGATATGATAGTGSTPGAGATETTGATAGTGSTPATGATAETGATAGTGSTPGAGATEATGATAGTGSTPGAGATEATGATAGTGSTPGAGATETTGATAGTGSTPGAGATEATGATAGTGSTPATGATAETGATAGAGSTPGAGATAETGATAGTGLTSATGATAETGATAGTGSTPGAGATEATGATAGTGSTPATGATAETGATASTRSTPRAGATEATGATAGTGSTPATGATAETGATAGAGSTPGAGATAETGATAGTGLTSATGATAETGATAGTGSTPGAGATEATGATAGTGSTPGAGATEATGATAGTVSTPGAGATEATGATAGTGSTPGAGATAETGATAGTGLTSATGATAETGATAGTGSTPATGATAETGATAGTGSTPGAGATEATGATAVTETTTRTDSTSASGVSDATGSTIVTATGTQEAGSTFRTGVTSGTGTAETTGTEITGITVISTLPGGATTVPGGATTVPGEATTVPGGATTAGLEPTTVPGGATTLSGEATTVPGGATTVPGEATTVPGGATTLPGGATTVPGGATTVPGGATTVPGGATTVPGGATTVPGGATTVPGEATTLPGGATTVPGGATTVPGGATTVPGEATTVPGGATTLPGGATTVPGGATTVPGGATTVPGGATTVPGEATTLPGGATTVPGEATTLPGGATTVPGGATTAGLGGTTVPGVTTVAERTSITSTVSTVVTTETSTIPPTTTPGFITMTNVSLLSDVFGDNAFRNSTEPYTYNASTNQFTVGSAS........................................ 1090
75 1.000e-27UniRef50_A0A2V5AVM8 Autotransporter-associated beta strand protein n=1 Tax=Pseudomonas sp. OV286 TaxID=2135589 RepID=A0A2V5AVM8_9PSED  ali  11  13.....................................................................................................................ISALSVAIRLGVAGLVIGLASPQALAACLPASPSAGDSVTCTGTATIFQDNTFSSAVDNLTVGVGVGSTINALLGGTAMALSGNNITLNNSGTIDPSILGLVTLLSNGTVIGSGASGAVNVTNLATGIMKGTSGLLSGSLGTLSGMALNINNGATGTTTIINNGAIGSTALLGLSLFSSDAPVIAVRGGSQVNMTNTGTVTGRMAFEASAGGNTFFNSGNIAGGLSMGAASTNTFTAVTGSTVSAAGGIGLNLGGLIGINLGFAPTGQIDGGLGGSNSLILQNPLGVGGGTSGASTASSANYVNFNNLTIDSGGSTTLNGGVAQFNANGTFGTGVLTSNGGSIQASNAGLTLSNLMTLGTGGLSILGANGMTLGGVLSGTGPLIKSGTGQLILNGANTYSGGTTLNSGSVQVGNALALGSGSVTVAGTSTLAAPGTVSLANTFTLNNQLTTSGTGALTLSGNLTGAGGLNVNGSGGLTLSGNNGVYTGPTGLNAGVLTLGSANALGSGTLSVNGAAGLDTTAANNNVTLNANLTTVGSNPLTLVGVISGIAGIIKNGLGTLTLTGNNAQQGPTALNGGTLLVGSNTALGTGVLTAAGGTILDATTGVTLTNAISLDGDLTLGGSQAMTLTGVVGGLGGLVKNGAGALTLSGNNGFAGNTTLNAGSLILGSNNALGLLGSLNTANNTTLDTNGAVTLGNAVNVTGNLNLGGSGNLTLGGAIGGTGGLTKSGAANLIINGANTFLAGTVLNGGTLTVNNNSALGTGNLTVSGAGTLDNAAGIALANGIDLNADLTLAGTNGLTLGGVIDGANQLIKNGTGTVTLNANTFQGGITLNAGGLNLGNGAALGTG............... 875
76 1.000e-27UniRef50_A0A1X0KDP5 Uncharacterized protein n=1 Tax=Mycobacterium scrofulaceum TaxID=1783 RepID=A0A1X0KDP5_MYCSC  ali  10  863...TGGILTVGADGTLTNNDVLTVGADGILTVNSGGTVTLNADSGLTVGPSGALTINGGGVLTDGGTLTVDAGGVLTDGGTLNVDAGATLIDGGNLTISGGGALANSGTLTDSGTLTISGATLTDSGALTIDSGATLTDSGTLNIGAGGTLTDSGSLTVNTGGALSNGGTLTNSGTLTVNTGGTLSNSGTLTNTGSITADPGSGFFDNATLINSGSLDNAGTLYVNHGATLINSGNLTDSGALNDYGTLTITDSGSLNVSPGGYLTVNPGGTLTLDGGTLTDTGGVVTDAGTLTVSGNGYLNVTGYGSLTVTHGAALNDYGTITIQPGSTFYDVGSIGSTVTVQPGGTFTNSGIVTVNSGSTFTDSGTVTVNSGATFTDSGTVTVNSGATFTDSGTVTVNSGATFTDSGTVSINSGATLTNSGTFTVNNGGAVSVESGGTLTDSGTLTINGGGTLSDSGALTVQPGHILTDSGTLTVNSGGTLTDSGTLTVNNGGVVSVEPGGTLTDSGALTINSGGTLSDSGVLTVQPGHILTDSGTVTVNSGGTLTDSGTLTVNSGGTLTDSGTLTVNSGGVLT----DSGTLTVNNGGVVSVESGGTLNDYGAVAVESGGTWTDYGTVTVDAGGSVTVQSGGTLSIEPGGTLSDYGTLSVESGGTLNDAGALSVESGGTVSDYGTLTIDGGTLSDYGTVIVNADGTVTVESGGAVTLDDGGALTIESGGATTLNSGSILTVGDDGTLSINSGGYLTVNAGSTVPVESGGTLTVGPGDIVSV............................................................................................................................................................................................................... 1630
77 2.000e-27UniRef50_U1H5S6 Autotransporter-associated beta strand (Fragment) n=1 Tax=Bradyrhizobium sp. DFCI-1 TaxID=1230476 RepID=U1H5S6_9BRAD  ali  10  10............................................................................................................................LASTALTVTGYAARAQTAAWSTTPTGGNYANAANWNGGVVPNGETATAVFGASTQSNLVITPGTPTTYAIAGWTFSAGAPNYTFNLNNNATLGFWGTGITNNGTGTIAVTNNGNVNFFGSSTAGPATTTITNGSSGYLRFYDTSTAGGANITNNNYMWLYGNSTAGSATITNNFGLTFFNSSTAGNANITNNSYLYFQNSSTAGSANVTNTGTLRFYNNSTGGSAAIITGAGATTDFSTSTGPNGDGKLSAGSIAGGGSYMLGSNQLTVGSNGLSTEVTGVISGTGSLVKTGSGTLTLSGINVYSGGTTINGGTLQIGTAANTGAVSGAVTVNAGSTLNVTNAITSWITGITNIGTTNFQTGTSASSIAFGNSGYLNFYGTSGAGSAVITNSGYLYFYGTSAAGSATITNNNGLAFV----DASTASGANITNNFGLVFKNASTAGSATITNNGYVQFFGTSTAGSAAINNSNVNATVDFSNSIGPNGDGKLSAGSIAGGGSYALGANQLTVGSNNSTTEVSGIISGSGGSLVKVGTGTLTLSGA----NTYSGGTTINGGTLQLGTAVSAGAIQGAATVNAGGTFNVVNADTSGIATITNSGITFFRNGTSAGSATVTNNHYLYFLNSSTAGSANITNNFGLFFNDSSTAGGSAITNNGGLNFNNTSTAGNATITNNGGLNFNNSSTAGNATITNNGNLNFNNTSTAGNAAVANSAVAVTDFSSSFGP---NGHGKLSAGSIAGGGTFNLGANELTVGSNNLSTVVSGVISGSGGSLVKIGTGTLTLSGANTYTGGTTISSGTLQVGNGGASGSIVGDVLNNGVLAFNRSNTATFSGAISGSGA............ 843
78 2.000e-27UniRef50_A0A0F5RQB1 Collagen triple helix repeat domain protein n=35 Tax=Bacteria TaxID=2 RepID=A0A0F5RQB1_9BACI  ali  10  204............NTGVTGSTGPTGSTGSTGVTGPTGNTGATGDTGPTGSTGSTGNTGXXXXXXXXNTGVTGPTGNTGVTGPTGNTGVTGSTGSTGSMGATGNTTGSTGVTGNTGATGSTGVTGNTGATGSTGATGTTGATGNTGPTGETGVTGSTGPTGSTGATGSIGPTGETGVTGSTGPTGSTGATGSIGPTGETGVTGSTGPTGSTGATGSIGPTGETGATGSTGVTGSTGVTGSTGVTGNTGPTGNTGSTGNTGTGSTGPTGNTGATGETGVTGNTGSTGNTGPTGETGSTGTTGATGETGVTGTTGPTGATGAAGSTGPTGSTGVTGSTGATGSTGATGSTGATGNTGPTGSTGVTGNTGATGDTGPTGSTGATGNTGPTGEAGVTGSTGPTGSTGATGSIGPTGETGATGSTGVTGSTGVTGSTGVTGNTGATGETGVTGSTGPTGETGATGSTGVTGSTGPTGNTGATGNTGPTGSTGPTGSTGPTGNTGATGETGSTGTTGATGNTGATGETGATGAAGSTGVTGNTGPTGSTGVTGVTGSTGPTGSTGTTGNTGVTGDTGPTGATGVSTTATYAFANNTSGSVISVLLGGTNIPLPNNQNIGPGITVSGGNTVFTVANAGNYYIAYTINLTAGLLVSSRITVNSSPLAGTINAPTVATGSFSATIIANLPAGAAVSLQLFGVVALATLSTATPGATLTII................................................................................................................................................................................................................................................................................ 910
79 4.000e-27UniRef50_E2F3P4 VacA (Fragment) n=2 Tax=Helicobacter pylori TaxID=210 RepID=E2F3P4_HELPX  ali  77  1............................................................................................GGQWNKLEVDMKDAVGTYKLSGLRNYTGGDLDVNMQKATLRLGQFNGNSFTSFKDSADRTTRVDFNAKNISIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSNKNAEISLYDGATLNL---ASNSVKLMGNVWMGRLQYVGAYFAPSYSTINTSKVAGEVNFNHLTVGDRNAAQAGIIASKKTYIGTLDLWQSAGLNIIAPPEGGYKDKPDNTNSQNPPSSGQKTEIQPTQVIDGPFAGAKDTVVNINRINTNADGTIKVGGYTASLTTNAA...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 295
80 5.000e-27UniRef50_UPI000A1C1FEF putative uncharacterized protein DDB_G0282133 n=1 Tax=Boleophthalmus pectinirostris TaxID=150288 RepID=UPI000A1C1FEF  ali  10  790............NNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSS----LNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNNASTLNRSNNPSSLNRNNHPNTLNRNDNPSTLNQNNNPSTPSRNNNPNAKGDV.......................................................................................................................... 1635
81 5.000e-27UniRef50_UPI000CF02973 toxin n=1 Tax=Helicobacter cetorum TaxID=138563 RepID=UPI000CF02973  ali  16  36......LAPLLLSGFVKGLADENLWNELNSKIGSVYTHWVKGREYCAWWEF-AGCARTIW-------------GAGHQGYDVGNVAHYWTSQDYKPISIG---NNENGIFTLNNLVNYAGGNLTINLGSATLKLSGTNSFTSYQGSSYGDGKDDVSFNVGTLDLSGMLEVGNRIGTGAGTHTGTATLNLNANE---VNINSNISAYKTSQVNIGNTNSGSISLNGNVCSSSVNWVGANCSSTGPTYTFKGTSTSTNTTFSSGSFTFDNNANFSGAKFNGGTYTFKQSFSATNNTNFNNGSFTFEGISSFENANFGNLQYNFHNQATFQNSTFNGGTFTFNKTDTQHPQILFENSSFSNTNSPINIQGGVTFKNSFNNQNHNLTIQNARFENASFNNSGKLMIENNATFNNTSFNTS-----------INSQNTDIKGSVTLSGKNELKNNATLDFGNAQITLNQGVSFNIANLG--SGKTTILRSSKDINYNSLLSHLLNSYTDALKETSGSQNTKTSTQG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 526
82 6.000e-27UniRef50_A0A081NYD8 Uncharacterized protein (Fragment) n=1 Tax=Paenibacillus tyrfis TaxID=1501230 RepID=A0A081NYD8_9BACL  ali  3....................................................................................................................................................................NFNVFNLNPNDLRILIFGQDATGTARPINTDSGGSILNIPIGGTIDVIQHVTAATIVGGTINAITGTVTAVVPSTTITGGTLTTIQSVLGATVTAGTLTTVESVLGTTITAGTVSATILGGTVSATLLGGTLTNLLDGTLTNVLGATITAGTLTTVESILGATITGGTINAITGTITAVVPSVTISGGTISVVESVLGATITGGTVSTTILGGTVGATLLGGTIDNLLNGTITSVLGATITAGTLTTVGSVLGATISGGTLNAILGTLTAVVPSVTITGGTLTAVESVLGATITAGTISATIVGGTVSATILGGTVGATLLGGTIDNNGTITSVLGATITAGTLTTV-GSILGATITGGTLNAILGTLTAVVPSVTITGGTLTVVGSVLGATITAGTLSATIVGGTVSATILGGTVGATLLGGTIDNLLNGTITSVLGATITAGTLTSVGFVLGATITAGTISATILGGSVSATILGGTINNLLNGTITSVLGATITAGTLTSVGSVLGATITAGTISATILGGTVSATILGGAVSTTLIGGTIDNLLNGTITSVLGATITAGTLTSVGSVLGATITAGTISATILGGTVSTTILGGTISNLLNGTITSVLGATITAGTLSTVGSVLGATITAGTISTTILGGTVSTTILGGTISNLLNGTISSGATITAGTLTSVGSVLGATITAGTISATILGGTVSATILGGAVSTTILGGTIDNLLNGTISSVLGATITAGTLTSVGSVLGATITAGTVSATILGGTVSATILGGAVSATILGGTINNLLNGTITSV.......................... 796
83 1.000e-26UniRef50_UPI000D68C281 uncharacterized transmembrane protein DDB_G0289901 n=1 Tax=Ricinus communis TaxID=3988 RepID=UPI000D68C281  ali  160..............................................................................................................................................................................................................................................NTTGGNATGGEADGGKAIGGSATSGEAQGGNGVGGDAISGVVDGGKATGGSARGGDTQGGNATRGNDIGGATEGGKATGGSATGGDAQGGNTIGGNATGGAANGGKATGGSARGGDAQGGNGTGGNAAGGTADGRNAIGGSATGGDAQGGNATGGNAITENVTGGTGNGGKATGGSATGGDAQGGDATRGNAIGANVTGGTADGGKATGGSATGGDAQGGKATGGNAIGGTADGENATGGSATGGDAQGGKATGGNADSGNATGGSATGGDAQGGKATGGNVVGGTTDGGNTTGGNATGGTAEGGKASGGSATGGVAQGGKATGGNANGGNATGGSATGGDAQGGKATGGNAAGGSADGRNATKGSATGGDAQGGNAIGGNAISGNDTSGTADGDKATGSATGGDAQGGNAIGGNATGGTADGRKATGGSARGGDAQGGKATGGNAVGSIADGGNVIGGNSTGSTTDGGKATGGSAIGGDAQGGKATGGNANGGNATGGSATGGDAQGGKATGGNTDSGNATRGSATGGDAQGGKATGGNADGGNAIGGSATGGHAQGGKATRGNVVGGTADGGNATGGNATGGTADGGKASGGSATGGDAQGGKATGGNANGGNATGGSATGGDAQGGKTTGGNANGGNATGRSATSGDAQGGKAIGGNATGGTADGGNATGGSATGGDAHGGNAIGGNAISGNDTSGTPDGDKATRGSATGGDAQGGNATGGNATGGNATG.......... 893
84 2.000e-26UniRef50_A0A0F2Q3Q0 Uncharacterized protein (Fragment) n=1 Tax=Hoeflea sp. BRH_c9 TaxID=1629712 RepID=A0A0F2Q3Q0_9RHIZ  ali  317..........IFNTGGTGLSVDTKGAGTDFQLTGGGSGTIDTTTGAALFLDPLATDLTFGTVSSTGSGTTGVTFDVVTGVGAGSNAVTIATLNISGATDAGVLVSNSSGSFSLGTATITGGSSTGINIAGGSAAVSFGAGSSLSQTANAAAVSVSGGHTGSLAYSGAINATNGTGLQFDNADGSSYSFNGTVTLNGGDAGVDIVNGSSAGFTFTNTNITSPTGAAFNIDSSNITALTFGGSITQNNAAAAFASNGGTGGIHAISAAISASTSTANAITIASTGTYNFSGDLGLATTSGAGFLASGGGTMSITGTNTSINTTSGQILGWNGVIVGAGGVAFDTLAASGTVVADAISLINVDGATFNGGAVTVNSTSGGTSDGSGGSSATFNFAGATINNTGGDGIRLDGANGVVTIATVNIDNAAGDGIDIAGNTNAININGGTIDTSTGAAVRINAGSGNVTTVASITNATGALIDIAGRTGGTVTFSNTVAGTGGTGISITGNTGGAIQFNGATTLNTGANDAITLNGNNGASITFANVNIDTTTGNGIDATGINTDINVSGTVDVATAGSRAFEFTATSGDYDYSGVTSTQSGISAQAFGATHGGTYRLGSHTVTSPGVNALTMASTTLDLTYASFTVAGTNPTGAAILIDDTSGSLTINGGTIRSDDRGIDLQNDGGVLNAFVLTTANVQFDVGNDAVFAETTTAGSTLNVNVSGVTVASNIGAQFVEIEWDDGSGMAVIANNTVDSGDSTFGLIEIDQGGTGTTSVTLDNNIIASNPTGEGIDIRTISNNTVTSSATEAIRLEAEGTSNLQATVTNNIVGAVTTGSGIYLQVSTATATACLNATGNSDGVGGPPAFGLGGDSFNLDNTAGGLLLISQADVAALGAANNTAGVASTGTITGNVV.......................................................................... 1225
85 2.000e-26UniRef50_E6NCN3 Putative vacuolating cytotoxin-like protein VacA2, N terminus (Deletion of central part) n=7 Tax=Helicobacter pylori TaxID=210 RepID=  ali  22  25......LAPLLISGFASGVYANNLWDLLNSKVGGEYVHWVKGSQYCAWWEF-AGCLKNVW-------------GANHKGYDAGNAANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGNLTINLGNSVV-LDLSGSNSFTSYQGYHQGKDDVSFNVGAINLSGALEVGNRVGSGAGTHTGTATLNLNANK---VNINSNISAFKTSQVNIGNANSGSVSLSGDICSSLASVVGANCSTSRPSYSFKGTTNATNFSNASGSFTFEENATFSGAKLNGGAFTFNKEFKATNNTAFNSGSFNFKGASSFNDTTFNTS........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 322
86 3.000e-26UniRef50_Q135L0 Outer membrane autotransporter barrel n=2 Tax=Rhodopseudomonas TaxID=1073 RepID=Q135L0_RHOPS  ali  10  408............GASATLGANTSTSIVITTPSGTAGARDVVVTTAGGSVTSTGGFTYIAAPTIGTISPSSGPTGGGTSVTITGTNLSGVTSVTVGGASATLGSNTSTSIVITTPSGTAGARDVIVTTAGGAVTSTGGFTYIAAPTIGTISPSSGPTGGGTNVTITGTNLSGVTGVTVGGASATLGTNTSTSIVITTVTTAGGSATSTGGFTYIAGPTIGTISPNSGPTAGGTSVTITGTNLSGVTSVTIGGAAATLGSNTSTSIVITTPAGTAGARDVVLTTAGGSVTSTGGFTYAAAPTISTVTPSSGSTGGGTSVTITGTNLSGVTSVTVGGTAATLGTNTSTSIVITTPTGTAGARDVVLTTAGGSVTSTGGFTYILSPSISTISPNAGPSAGGTSVTISGTNLSGVTSVTIGGAAATLGTNTSTSIVVTTPAGTAGARDVVVTTSGGSVTAVGGFTYAGPPTIGTISPSSGPTGGGTSVTITGSNLANITNVTIGGAAASLGANTSTSIVVTTPSGAVGAVSTAGGSVTSTGGFTYVAAPTISSISPSSGLAAGGTSVTITGTNLSGVTSVTVGGAAATLGINTATSIVITTPAGTAGARDVVVTTAGGPVTSTAGFTYISAATVTAISPAVGPISGGTSVTITGTNFTGATAVTIGGAAATGVSIVNATTITATTSAHAAGNVDVVVTTPGGTATGSGLYSYVSGPVVTSISPASGPSAGGTSVTITGSNLAGATAVSFGGAAATAVSVTSATTITATTPAHAAGAVDVTVTTPGGSSTGAGLFSYIVAATTTTLTSSHNPSEAGQPVSFTATVTANGSVPTGTVTFTDGGVVIGSVGLSGGAATLTTSSLTIGS......................................................................................................................... 1270
87 4.000e-26UniRef50_Q17WG6 Vacuolating cytotoxin 7 n=26 Tax=Helicobacter TaxID=209 RepID=Q17WG6_HELAH  ali  71  1...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MSAGKCSPFSGDIGDKSRITTVRLETGYSPLYARGVKFKSGKKPVIDGMCHAPWNYFDARNTTGVETTKKILFGALGNLAGKIGL--NNLTLGHHASMDYGKDLDLTLQGHFINNQGVMDLFVQNWRAATLNASHQASMLFNNMTDNTTGFYKPLIKINNAQNLTKSTEHVFG..................................................................................................................................................................................................................................................................................... 171
88 5.000e-26UniRef50_UPI000695DA0E autotransporter outer membrane beta-barrel domain-containing protein n=1 Tax=Hyphomicrobium sp. 99 TaxID=1163419 RepID=UPI0006  ali  10  50...................................................................................................................................GSIAATKNCTNLNYVPNNTIPTLQNGGIEYTPTGAQNPFTLNIGNGTTPTGVVSQDITGVANLAAAAALNRPIAGNGVTVANYTLGLVSGGVPTDVVVNVNQLASINAQRDGVFVWTDGTGNDATINNSGLVTAGGVGLNAVAGNPLASPTGSGDAKVTNNANAAVQSVGNSINVWSESGNATAINNGTLVSTNGSGIVTTDSLTGLVPTGGKATATNNFVINANSGIIVASQGTATGTNSATGNITATNGIGISALSIGADATATNDGTIKAGGSGLVV------GAATTGTATNTRTVTAGGSGAIVLSGDNSTVTNSGTLTANGGIGASATSLNANAVATVTNSGTLTSTTNIGAISTSLGTGGNAVVTNSKTINAQTGGVVALGANDATVTNTGGTITTATGTGVSATALGNDSRVDSATGTVTSNNGSGIIALAGHDAIVNSGTVTATNGLVGVAAIGANSGTATLSGDVGGASFGVAAGSGGAGDATIQTAVGADVVVNAQDVGLLAVGTGTGNSVISGDHITTISQGTGVVGLALGAGNVNISAGPVTANNGAGIFGLALGGGVTINGDGPITATNGDGATGIAINGASNVTTNQLVTVTNGNGVTSTSIGNNATATNNDKVSVTNGLVGVSSLAIGGDANTNINADITGPGPLVGGSAIGTNATVTVADNTTVNATGLGLNALSAGGDAKIQGANSIVNSGGAGGLSTALGGNSTIDLGAITADNGSAAVSTAIGGDSNVTTHGAVKATNGSGLISTAIDGNANATSYNTVSISNGLAGVGAFAINGDATATNNAEVSVSNGFVGVGALSIGGNATATANANIDPPF............... 879
89 5.000e-26UniRef50_J3HXN8 Uncharacterized protein (Fragment) n=1 Tax=Bradyrhizobium sp. YR681 TaxID=1144344 RepID=J3HXN8_9BRAD  ali  297..MTGTRSSATIGGSGHAVTVTGSSDAVTLTGTSDTVTVSGAAATVTTSNATSVTLIGTGSSATVNGSGNTVAITGTSDRATLTGNNAVVTISGLSDTLVVSGSNASVTTTSAATITVSGTGSSATVSGNSNKVSITGTSDQVTLNGTSDSVTVSGVGTSLTIGSGSASVTTTSAASIAVAGSGVSATITGSGNTVSIAGSSDVLTVTGSNAVVSITGTGDTLTVSGSNASVSATHAAAITVSGTASSATIGGDGNAITIAGGNNTAVSITGTAATLAVSGSNELVTTSHAAAITVSGAGSSATVTGNGNTVSITGSSDQVTLTGTSDSVSITGASATLALSSGSASVVTASAAAITIAGTGSSATISGDGNSVAITGTSTVAGNNAAVTITGGNDTTGSNDTVTTSSGAAITVSGAGSSAVIDGDGNAVAIVGASDTVTLTGTGDSLVVSGSNAIVNASSALAVTITGAASSATIGGDGHAVTINGT--SDAVTLSGAGDTVTVTGSSATVSTTSAASVTVTGTGSSAAISGDGDTIAIAGDSDQVTVTGNNETISIGGAGDALVINGSNAAVSTTSAASVTVTGTGSSAAISGDGDTIAIAGTSDQVTVTGDNEVISIGGAGNTLVISGSNDTVIATSAAAVTLAGTGSSLTLGGDGNAVSITGTGNQITLTGNGDTVAIGGSNGIIIASGTNELYLADRGTGQVTIDNATA........................................................................................................................................................................................................................................................................... 1020
90 6.000e-26UniRef50_A0A1H3DI92 Uncharacterized protein (Fragment) n=1 Tax=Hydrobacter penzbergensis TaxID=1235997 RepID=A0A1H3DI92_9BACT  ali  10  119...................................................................................................................................................................LTNQGVTAINGRIGSITIAGDTTNTITLSKTGNNITIAAANTVALWNANLMGKNIASANPSAGQVMMWNDTTQLWVPSTIIKLNNLTVTGVINAGSVNGTLTTAAQPNITTVGTLGNLTATNATITTANITNLSGLSTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITNLNGLSTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLSTLTATN-ISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGLNTLTATNISGTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLSTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNISGTLTTAAQPNITSVGTLGNLTATNASITNLSGLNTLTATNISGTLTTAAQPNITSVGTLGNLTATNATITTANITNLSGVGTLTATNI................ 923
91 8.000e-26UniRef50_Q9LB82 Vacuolating cytotoxin (Fragment) n=10 Tax=Helicobacter pylori TaxID=210 RepID=Q9LB82_HELPX  ali  94  1...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................GKTGLCLNNLTLNSNASMDYGKDLDLTIQGHSTNNQGRMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKEHVLVRARNIDYNLVGVQGASYDNIFASNTNLQEQFKERLALYNNNNRMDICVVRKNNLNDIKACGMAIGNQAM................................................................................................................................................................................................................ 162
92 9.000e-26UniRef50_A0A1D2X1A8 Uncharacterized protein n=1 Tax=Methanosphaera sp. WGK6 TaxID=1561964 RepID=A0A1D2X1A8_9EURY  ali  19..............................................................................................................................................................................................................GLSNVSANDTSTMDVVTNTVDHQNMQSTHDTTTTSKILEQNTTSNIKTTNKTLKTATVIVNTYSALRNQIANGTADTIRLNTTRKYTGSTTLTISRNVTIDGRNAVLNTTGLITINSNVTIKNLTINPRIIVSSNGNLTLTNTTHANKTITTNGAAIYNLGKLTINNSIFTNNKATTSGAAIYTTGNITINNSTFTNNKATTSGAAIYTTGNITINNSTFTNNKATTSGAAIYTTGNITINNSTFTNNNAPSGGAIHLNNGTLTVKNSLFTKNNATSGGAIHFNNGNLTVYNTTFTYNNATSGAALFTYRNGTINNSTFINNTATNGAAIYNRRTNTVNNSTFINNTAKELGGAIYNYEVIKVTQSTFINNIASNAAAIYNYVNLTVTNSTFTNNTASNDGAAVYNRANTTITDSIFTNN---------KATRNGAAIYTNATITINNTIFTSNTATNYGAAIYNNGISIIDNSNFTSNTAQAGAAIYNNANNTLNNSVFTHNNASIFGGAIYNAKNSTITNSNFTSNNAIAMGGAITNTGNSTITSSIFTNNTSNSMGGAITSTENITITNST-FTSNNATNGGAIYNGKTLIINNSTFTNNNITGNGSAIYNSNGNCNINNTLFTNNNAAMGTIYNNNLVINNSNFTSNNATYGGVIYNNANSIVNNSVFSNNNASRDGAGIYNNKTITVDNTVFTNNNAQSDGGAIYTRNSTIINNSNFTSHNATYGGAIASLANTTLIVNNSVFTNNNARNIGGAIYALNST......... 775
93 9.000e-26UniRef50_A0A1Q2PML7 Toxin-like outer membrane protein n=1 Tax=Helicobacter pylori TaxID=210 RepID=A0A1Q2PML7_HELPX  ali  21  26......LAPLLISGFASGVYANNLWDLLNPKVGGEYVHWIRGSQYCAWWEF-AGCLKNVW-------------GANHKGYDAGNAANY--LSSQNYQAIFVGSGNETGTYSLSGFTNYVGGNLTINLGSSVV-LDLSDSNSFTSYQGYNQGKDDVSFNVGAINLNGALEVGNRVGTGAGTHTGTATLNLNANK---VNINSNISTFKTSQVNIGNANSGSVSLSGDTCSSLASVVGANCSTSGSSYSFKGTTNATNFSNANGSFTFEENATFSGAKLNGGAFTFNKDFSATNNTAFNSSNFNFKGASSFNNVNFSNTGK-----ITINEGTSFNNTAFNTSINTNNMTITGSVTLSGFNGNIMHSLAN..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 369
94 9.000e-26UniRef50_A0A1Q7TM61 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon 13_1_20CM_4_64_14 TaxID=1805139 RepID=A0A1Q7TM61_9EURY  ali  13  150..............................................ASWSFVAPITFNSSASRTMTFGNPTLEFAGNVTFNSGASTVTFTMAANSLDVGGTLTIAGGAGTT---TLNTSGSNLAINPATLVVNAGGTVTSMDTHLGTFTVGASTVVVNASGGSINVTQTVNNLTVTPAVSTTFTGSLTWTGTLAFTNSVAFGTNSLTSSGAATFTFASATITMSSGNWDTSSATTFTATSSTVTFSGTGNLRVGGSASFGALTVSGGTRTLQSQLTTSGLLTLSGGTLAGTNALTANAGITMSGGALTSTSGAVSITGNVSIAAASYIVFGSETGSWTDNSTSASWSIGTATVAFNASSAQTMTFAALPGNAPEFYNVTFNSGASTVTLTMTTNALAWSGILTVQGGGGATTLATSNLGLTGGAIVVGNAGVLAANASVSISGLTMIGGTSGTLTLTTGSWAVSGNWNTSGAGSAFSKGTSTVTFTGAGQTVSILNASNGFY----NLAVSGTVTQSTAIDVTNSLTVSGTLTTGGFNITGGSNLSVPDGGTLAAGTSTSTFTNVTMTISGTITLTGAWTVSGSWDSTGAGSVLNPGTSTVTFTGTSQTISLAAGQTFYNLTIGGTVSINSSVTAAATLT---VNNGAVLTKTGQTIAFNSLTQNGTGSI....................................................................................................................................................................................................................................................................................................................... 782
95 1.000e-25UniRef50_A0A2N4X0H1 Uncharacterized protein n=1 Tax=Novosphingobium sp. TH158 TaxID=2067455 RepID=A0A2N4X0H1_9SPHN  ali  11  771..FANTAGTIDVLGTGTINANQYGVFAYSTGASAVNVLNTGAITSGGTGILAGSNGGNVTVAPASSVFSGGGSGIDTFTNGAGNISITTVGLVTGNGGMGIRGINDAGTITIANGAGVNASNTGIYAGSTTGDIKITGAGNISSGVDALTAGSIDVLGTGTVNSAGTGIRAVSSGLGNVTVSGTGTVLSSLGTGIDARSSGGNVIVAPASTVTGTQGWGIIAGTTGAGTVSVTTVGQVTGGSWATSDAGSITVANGAGIKGQLNGVLAVSNTGAIQITGAGSTVGTTNAGISATTAGTIDVLGTGTVNGGTDGINAISTGASAVTVSGTGGLNGIRASSSGGGAVTVNANANVTGTLAASDGIDASVFGGNGTLTITQKAGTTIQGAATGITTSHTTGNTVITVAGTVKASTAAGTGIKSSSTSGSITTNVLAGGFVDPAVGIDDTTATGAMTVNNAGLILGDVTAIKMTATGTGSGTVNNSATITGGTNAVLGTMNGGAFTITNSAGATLNGAVNVTGSAGATSVFTNAGTWNTFGSNTFSGSWSNSGTTNIANGSSITVTNGSTNTATGLMNFAGNATLVTNLTNLGLMEARNGTAGNNAITLTGNYVGGGRIGVDTKISTATTDTLTISGTGSATTKVELNLIGPQAILPGGFLTVVTVNGGAPAGTFFSNSLPATGFTQNPANTKQFGILQTFDPGVTQVTGLQTLAGSMSALLDDPLSAYITDRKGADNQFGLWIRGGGGNFDQNLSSTFTATGFTGGAAERVNTSFHTVQGGLDYGVLGLGTGNFNLHFGITGGTFGGTAKGATGRTEIDGDFIGGYVALTGNGLTFDATI................................................................................................................................................ 1618
96 1.000e-25UniRef50_UPI0005A75054 hypothetical protein n=1 Tax=Paraburkholderia heleia TaxID=634127 RepID=UPI0005A75054  ali  10  85......LSPAYAAALPTGGVVAAGSASISTPSSSNMVINQTSQNAIVNWQSFGIGSGASVQFLQPNSSSATLNRVLGSSVSEINGSLTANGRVFIVNPNGVVFGNGAYVDVGGLLATTKNISDSNFMSGNYQFSGSGAGAVINNGTINSAHGFVVLLGNQVSNHGTIEANGGQVVLGAGDAATLTLNNGQVVNVTIDSPTAQALIENTGTIKADGGMVLLSARGDTTVLDSVINVSGLVSAQGGSVDIDGGSSGAVMLNNATVDVSGGQAGQTGGTALIQGQYIGLVNGTHVNASGAAGGGHIILGGDTLGMLPGQNVTFAQGVVVDGTSSLDASALVSGNGGTIETSGHSAWIDGNVTAAGAGGGGAGHWLLDPTNITIDNNTTSVNVSNGVAGLFNGTGSSGHVSNVTIANTLDTGTDVTVTTASNGTDAGNLVVAASIYKTAGGNTNLTLNSNGSLTIQRNVNITSTAGTLNLTENVGGGSAAFAGNNTISLNGGYLVVNSTNAGSSDAITFNGSNVLVAGGINLTGTATTGAGVNFNANNVTLASTGDVNIVANSTSGTGLNQAAGGTANISSSAGNVSISASTSGNAISTSGTMFNVSAAQNVNISGTSTANTNTGVLFADTTTQISAGNNVSITGSGATGVSAQGNRNLNISAANVTITGAGTSARGIALDYNVSITANSGNVTLAGTSTNSYGIEMLDSGNISAAQNVVLNGSGSYGTVVDYGLNVSAANNVSIGGTASSNSGVSFGASGGASTIVASNVTIAGTSSGSGAGVQLSTTNISAVGNVSVSGQSSSGSGVYGAGSVLNITAGQNISITGNSSGSGYGVYLGSTQTNLNASQEVVINGASTSGTGVYTAGSFAGIVAGGNISVVGSNYNNVNDGMNLTDTNTVLSAGQSVILYGRGSNAVEVTGTNFNVTAGNISISGDGTVYGLYAHGKSSNLTATGGDVTLAGSATTGTGVSLNGQTNI...... 1056
97 1.000e-25UniRef50_A0A099VFQ6 Uncharacterized protein n=8 Tax=Helicobacter TaxID=209 RepID=A0A099VFQ6_9HELI  ali  14  40.................................................................EIFYSNNMGTTYTGWAWGKDFTQTYENGTLIIGNISKDPNANNMHWFGRGGDIGFINATFNAKEVYITGTLGSGNSLRTGGGANNANSNLTLDNAYIHINRAGTQNSTTSLNGQTNSEFNIENINGGGINIGSANTNNIILDNTHIKMDGGQINVIAKNSKLNFGAINIVNGTLDLTQANY-TELTTHSINMTNSSFRSNELNMLGDIVNGRFVPTQTPAYGADPLQNLGNSGQDFTADSVVIDDNNSTLKAVNATIGELSFKGAALSGATKTISGKLNITTLTNPYHWAGVGFTSELDVKEASEVNIGTINHQNYTSGSTIRVN------TENKLVVENISFSTDGISGSNGRVELNSSN---------------GDVVVRNVVGCNGSCTGGLGIRPLNILKISGKNFYGGNIEAIGLTTAGSNSTLDLTGVMGTKFIDIFSIRSGTLKASDFHINNFVVYKG----NSYSVVDQNIG-KSFINYLSMELGTSDTADGADFTGGGEILNFNVIDARPTSFIHMSGAKKINYVNTNIMNIKEAEVNLHNGIFNTIVSQKGQT-AIASNTKIVANALNVNELLHIKDSSKHSGVMNIELSGNEAVNQDFSKYLNVNVDSEELKNMSGSEIA---DLINKAQENSNANVTDYKNASGTYVTTSDGKHYLILPNIDASNGN............................................................................................................................................................................................................................................. 702
98 1.000e-25UniRef50_Q3LAD1 Vacuolating cytotoxin (Fragment) n=24 Tax=Helicobacter pylori TaxID=210 RepID=Q3LAD1_HELPX  ali  93  1........................................................................................................................................................................................................................................................................................................................................................................................NLSNQASGRTLLVENLTGNITVDGALMVNNQVGGYALAGSSANFEFKAGVDTKNGTATFNNDIHLGKAVNLRVDAHTAYFNGNIYLGKSTNLRVNGHTAHFKNIDATKSDNGLNTSTLDLSGVTDKVNINKLTTAATNVNIKNFDIKELVVTTRVQSFGQYTIFDGNIGDKSRIGVVSLQTGYSPAYSGGVTFKSGKKLVIDELYHAPWNYFDA....................................................................................................................................................................................................................................................................................................................................................................................................... 214
99 2.000e-25UniRef50_UPI00081488C5 mucin-22-like n=1 Tax=Pygocentrus nattereri TaxID=42514 RepID=UPI00081488C5  ali  169..............................NGNTIISATNASLNSSVSPTVSFNTTFNIASASTPTLMTATGNVDNTTVISPTTSQNTTVSPTAIINTSITVALVSTGTKNTTIGNVNNTTIVATTANLNTTVTPTTRVNATVSLGSGSNANELYTAGNVSTTTISATTASLNTNVTFSINFNTTVSTAGAITPTLITTTGNVNNTTTISTTASQITTVSPTAIVNTTVSLSSGSTATMNSRIGNVENTTFSATTVNLNTTVTPTVSVNTTITIASGRTETVNITSGHVDNTNTSVTNASLST----TFTPTAMFNSTVVFASGSTSYVNTTTGNFNTTTISASTASQNITVSPSARVNTTMTLANASTVSDNTTTNNVNNTNASPTTASQNTNTSTPAFVNNTITLVGVSSAIVNSATGNGHTTISATNASLSTTITTAMFNSTVVFASGSTSSVNTTTGNFNTTTIRASTANQNITVSPSAMVNITMTLASVSSATVNSTTGSGNTIISATNASLNSSVSPTNTTTGNVNNTTIIATTANLNTTVTPTTRVNTTVSLGSGSNANEPYTAGNVSTTTISATTASLNTNVTSTINFNTTVSTAGAITPTLRTTTGNVENTTFSATTAYLNTNVTTTASVNTTITIASTTGNVDNTNTNVTTASLSTTITPTAVFNSTVVFGSGSTSYVNTTTGNFNTTTISASTVSQNITVNPSAMVNTTMTLASVSTVSXXXXXXXXXXXXASATTASQNTNISTPAIVNTTITLAGVSSATVNSTTGSGNTIISATNASLNSSVSPTVSFNTTFNXLMTATGNVDNTTVISPTTSQNTTVSPTAIVNTSITVALVSIATTANLNTTVTPTTRVNTTVSLGSGSNANELYTAGNVSTTTISATTASLNTNVTSTINFNTTVSTAGAITPTLITTSGNVDNTTTISTTASQITTVSPTAIVNTTVSLGSGSTATMNSRIGNVEN....... 1133
100 2.000e-25UniRef50_A0A2D5FCB4 Uncharacterized protein n=1 Tax=Haliea sp. TaxID=1932666 RepID=A0A2D5FCB4_9GAMM  ali  10  260....TAVGSLALDANTTGANSTAVGYAALSNSTADNNTAVGYGSLVANTSGTQNVAVGALALDANTTGGRTTAVGYRSLTSQTTGSENVAVGSYALDALTTGTQNTAVGEAALNANTTADNNSAFGHDALKANTTGTNNTAVGSAADANTAQSNSTAVGANALTLSTANNNTAVGSGAASGTTSGTKNTAIGTEALDQNTTGSFNTAVGYLALERNTVASNNTAVGNSALEENTTGATNVAVGSLALDANTTGSNNVAVGTNALGSNTTVNNNVAVGHNALLSNTTGTQNVAVGSLALDANTTASYNSSVGYAALGANTTGSENTALGRIALQDNTTGNRNTAVGSGALENNTTANDNTAVGRDSLKDNITGYNNTAVGTFALTNNTAQNNTGVGKNALKVNTSGGENTAVGTHALDANTTAHNNTAVGYDALTANTGGGQHAALGAYALASNTTGNRNTAVGYTALYSNTTGDNNTAVGQQTLYYNTASQNTAVGRNALVNNTTANNNTAIGYLALELNTTGTENVAVGSLALDANTTGGNNTAVGSQSLGNNTGGGNTAVGRASLNANTSADRNTAVGWNAMLDNTTGSKNTAVGALALDANTTASFNVAVGYEALGATTTGQDNVAVGYQALDANTTGIRNVAVGTSALGAQATGSENVAVGFYALVNNATGGQRNVAVGNEAMSQNTTGDNNTAVGHGCLDANTTGSNNAAVGRDAMGANTTGELSAGFGVNALRDMTTGNSNTAVGYSALEACTTAIRNTAVGRNCLLLSTTGTRNTAVGAFAGDSV--TTGGYSVLIGEGAGAAITTANGNVCVGYAAGDTITTGASNICIGDTADVDNDGRNNSITIGASINSLGSNYFTFGRSGHRVYNLFTSNASWTRDSDVRLKKDIQTNT................................................................................ 1155
101 2.000e-25UniRef50_A0A267GVH4 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GVH4_9PLAT  ali  506...............ATGATAGTGSTPEAGATAETGATAGTGSTPAAGATEATGATAGTESTPGAGATEATGATSGTGSTPGAGATAETGATAGTGSTSGAGATEATGATAGTGSTPATGATEATGATAGTGSTPGAGATEATGATAGTESTPATGATEATGATAGTGSTPAAGATAETGATAGTGSTPGAGATEATGATAGTGSTPGAGA--TAETGATAGTGSTPGAGATEATGATAGTGSTPRAGATAETGATAGTGSTPGAGATEATGATAGTGSTPAAGATEATGATAGTGSTPGAGATEATGATAGTGSTPAAGATEATGATAGTGSTPGAGATEATGATAGTGSTPATGATEATGATAGTGLTPGAGATAETGATAGTGSTPGAGATEATGATAGTESTPATGATEATGATAGTGSTPGAGATAETGATAGTRSTPAAGATSETGATAGTGSTPGAGATAETGATAGTGSTPAAGATEATGATAGTGSTPGAEATEATGATAGTGSTPGAGATEATGATAGTGSTPGAGATAETGATAGTGSTPGAGATEATGATAGTGSTPAAGATEATGATAGTGSTPGAGATEATGATAGTESTPRAGATAETGATAGTGSTPGAGATEATGATAGTESTPATGATEATGATAGTGSTPXXXXXXXXXXXXETGATAGTGSTTRTDSTSASGFSDATGSTIVTATGTQEAGSTFRTGVTSGTGTTETTRTEITGITVISTLPGGATTVPKGATTFSGGATTLSGGATTPGGATTAGLEGTTVPGASTGATTVPGQATTVPGGATTVPGEATTLPGGATTADLGLTTVPGGATTVPGGATTVPGEATTLPGGATTVPGEATTLPGGATTVPGEATTLPGGATTAGLGLTTVPGGATTLSGGATT.............................................................................. 1394
102 2.000e-25UniRef50_A0A2E0API3 Uncharacterized protein (Fragment) n=1 Tax=Cyanobium sp. NAT70 TaxID=2024872 RepID=A0A2E0API3_9CYAN  ali  2...................................................................................................................TSITATELNLLDQNTSGIVDASGITTIVGLASDANTAYASSGISGLGNEWVTLTDSTLAASILNTLNGYTSFDIDASSVNTLTGTTSDLKTVYNASGSGINNLGNEAITLTDTSLNASDLNDLDGLTTGTINAASINTFTGTYSTLHTAFQSSQINNLGNTAVVISNSVSVTEANTIAGLTSGIVTATISDGGMSTLNGLNETGHAYSITITDTSVDVSALNTLDGKTSVAINASNITTLSGTAADSNTAYGSSGINNLGNEAVTLSDTSLDAAVLNSLDGHTSGTIDATSINTLSGTTSDLNTTYASSGISNLGNEAITLSDSSVAAADLNTLDSRSSGVINAASINTLSGSYSDLNALFTANSNGAISGLGNEAVSISGSASVAEANTIAGFTSGVVTASLSDGDMATLAGLNETGNAYSITISDSSVSAAALNTLNGKTTTAINANAINTLTGTAADANTTYSAAGSSINGLGNEAVTLSDNSLAVSILNTLDGNTSGSINAASINTLSGAAADLNTAYASSGISGLGNETITLSDNSLAVAVLNTLNNNTSGIINASNLNTLSGAVADLNTVYAASGISGLGNEAITLNDSNISVDALNTLNLNTSGLINAASVNTFSGRALDLNTAYASSGISNLGNEAITLSDTSLIASILNTLNGHTSGTINAASINTLSGSASAVVSTYSGSGISNLGNEAVTINSGTASTSQANTLSAATSGVVTATLSDGDMATLAGLNETGNAYTI----------TITDNTVAASALNTLNGKTTVAINTNNINTLTGAASVLNTTYGSSGINNLGDETITLSDTSLDAAVLNSLNANTTGTINASNINTLTGTAANINTAYSAPNS....... 850
103 2.000e-25UniRef50_A0A2P7NVJ2 Calcium-binding protein (Fragment) n=1 Tax=Nitrosomonas sp. APG5 TaxID=2116706 RepID=A0A2P7NVJ2_9PROT  ali  958..LSDMVNTAVAITTVNALVAAGATLTLSNVANSGVLTFNGAAEADGNFNITGGTGNDIITGGSGSDIITGGNGNDSMTAGLGNDTLSGDAGNDTFTFAAVTGLTSADIVDGGAGTDTVALTGNTAFTATNDFDNVQNTLGNTNTAVTITTQDTLVAAGAILTLSTANTGGLTFNGAAETDGAFNITSSGLSNDTITGGAGADSIVAGTGTDTIAGGGGNDTFTFAAGTGLTSADVVDGGAGTDTVALTGTTTVAATNFDNVSNIEIISVTHTTTNVAITTKDALVAAGAVLTFQAISLTTGVLTFNGAAETNGAFIITGGGANDAITGGAGNDTLSGGNGNDSITAGLGNDTLSGDAGNDTFTFAAVTGLTSADIVDGGAGTDTVALTANTAFTAANDFDNVQNIETVTLGNTNTAVTITTKDTLVAAGATLTLSTANTGGLIFNGAAETDGAFNITSSGLSNDTITGGAGADSIVAGTGIDTIAGGGGNDTFTFAAVTGLTSADVVDGGAGTDTVALTGNTAFAAATYFDNVQNIETITVGNTNKAVTITTQDTLVAAGATLTLSNAANSGILTFNGAAETDGAFNITGGTGNDIITGGAGNDTLIGGAGNDSLTSGAGTDSITGGTGADTITLGSSGNDNIQQTVIYSSTSDGAAAGASSGADTITQFDANANTGTDDLIKITGTFRTLLDDNSDGILDYSVSDGVDLGNQAIIGGANQEATVLLDAELEVVLADFTTVGLANLIAELGEEIDFTAIATGEEHLFIMNFSPTQTALVLYTAGIGGDDIIVSTDIQILGIVTHNDGTGLAAN....................................................................................................................................................................... 1773
104 3.000e-25UniRef50_A0A1G8MJ97 Autotransporter passenger strand-loop-strand repeat-containing protein n=1 Tax=Paraburkholderia phenazinium TaxID=60549 RepID=A0A  ali  106.....................................................SSGGVAYGATLLATSANQTVSAGGVASNTVVSGGKQAVSSGGAAYGTVVSSGGSLYVSSGGTAISAGVLAGGKIVVGSTSGGGVTSNTTVQSGGQEVLSSGGVASATEVMSGGSLVMSGAGSSYATTVFAGGTEKVASGGTAVDTVLSGGTLGLALSGVASGTTVGGGVNSGGTAVTGQLNVSASAGSAGSALNTTGGSVQVISGAFVSGTVVNSGGSVSLQWGVASGTTVNSGGIQTVWDETSTASAGTSLATVVNSGGLEVVSSGGSAVGTNLSGGTQSVSLGGSAISAAVDAGGVQQVAAGGAVAATSVNAGGSEVLSSGGVANGTTVNGSGTQNVLSGGVASGTVVTSGGELSVQAGGSATGVVQSAGAALVANTADTVSGSYVSSGSTATFSISNNTASNVVAEDGGNLAVLAGGSSFDTLVNSGGSEVVSSGGVASGTTINSSGAQDILSGGSAIGATVNNGGAQNVARLGTALDTLVNSGGSVVVSSGGAASGTVLSSGGALNVQAGGSATGVLQSAGAAV---------DVNTSATLSGTYVSGASSSTDSIANNTASNVVLENGGNLSVLDGGTSLNTVVNSGGSEVVSSGGVASGATINSSGTQAILSGGLAVSATVNNGGTQSVANGAVASGTVVNAGGTQNVNSGGSAVGGAINSGGQQNVANGGTAIGTAVNSGGTQNVASGGTVTSGVVNAGGTQNVTSGATVSDVVLDGTENTLLPPAVLPNQSGGAVQDVSSGSNVSGTVVNSGGTQVVSSGGVAGGTLVNSGGVLNVQTGGSATGVVQSAGAALIANTAETLSGTYVSSSGSTSNAFSILDNLASAVVVEDGGSLSVLSGGSSLRTVVNSGGSEVVSSGGVATSTTINTSGAQNVMSGGLALSATVNCGGTQTLL.......................... 1001
105 3.000e-25UniRef50_X2H8Z4 Uncharacterized protein n=4 Tax=Snodgrassella alvi TaxID=1196083 RepID=X2H8Z4_9NEIS  ali  96.............................PGEEDKKIEAIGKNKVKKVINVNGESTLEATNIKTTSKGNSSDASALAIAGNSKVTIDRNLEANSSGNSANVIANSDGSVLNVAKGKDYKGSIKITDTSNNGFTNGIKNDNGEIYVNGDITITSKTEASNSNSSIDNINGGSITADNITIDQGGKNYAIHQTSKNSSITVKNNLTITSGNIPEGNSAITIEGGSIEVKGKTDITTHVDSETIEEPENVSAISITNGKYTANGGADIKIKDDDEDNFKDATGVIIGNEGIFENNGTLTVNNGQNTVISTDTKLGENATFTNEAAGTTTSNVDTIVHNSSGILKVTNSGKLISESDKNSVLKNNKNGIINVDNDGTGTIAGNITNIDNGTVIINNSGNIQKKIETSDNTQSKTEISDNTQSNTEPNKIENSGTGLIDITNTDTGTIDSDILNKDNGKVIIKNSGDIKKKKIENSDNTQSKTEISDNTPPKKIENSGTGLINITNTGTIDNDILNTNTGTISITNNDNGTLNGSITNTGDEIKVNDPNAEIPANIFID------------NKKNLNGNINNEGNGSIVVNNNTASSVINGNITNAKDGNIAINNSGKANSSKITNSNAGKIDITNNKDGNVNSEITNENTGAIKITNDGTISGSITNTGNASTVAANNIDITNNGVLNSDINNKDNGNIAINNSGKTDSSKKITNSKDGKINITNTAVGDFQSAIDNDATSTGIITLDNKGTVNSTITNRNTGAINITNNDNGNLGGSITNTGNAGTIHIINNDKGTLGGSITNTGDQINDTTANILIENNNDLNSTINNDGNGTIALDNKEAGTVNSTITNQNTGAIKITNTGTIGGYIKNKGTGSISLTNNNIIDNNTFGTFDGYIENNGTGSISLINNGIISGSITNTGTKNNVDNILIDNNKELKSTIENLNGSIVVNNNKKGSSFTGDIHNNSGFNTGKITVNNNEEN.. 1033
106 3.000e-25UniRef50_A0A2S7SRK9 Collagen-like protein (Fragment) n=1 Tax=Chitinophagaceae bacterium RB1R16 TaxID=2077091 RepID=A0A2S7SRK9_9BACT  ali  51................................................................................................................................................................................................................GDTGVQGAQGVAGTNGNVWLSGSGIPSPGIGTDSDYYLETTTGDVYVKAGGSWTILANIKGPTGATGPIGVAGTNGINGLAGATGLTGATGLTGAAGTNGLTGATGATGPIGPIGLTGAAGINGIDGVTGLTGAAGPIGPIGLTGSTGLTGAAGTNGINGATGLTGPIGATGTGAAGSNGATGATGLTGATGPIGLTGAAGTNGATGAIGLTGVTGPIGLTGAAGTNGIDGATGLTGATGLTGAAGTNGIDGATGATGPIGPIGLTGSAGANGSVGATGPIGPTGLTGSAGANGIDGAAGSTGLTGAVGATGPIGLTGAAGINGIDGATGSIGATGPIGLTGAAGTNGTTGATGLTGATGPIGPVGLTGAAGTNGATGATGLTGAAGIGPIGLTGAAGTNGIDGATGSTGLTGATGLTGAAGTNGIDGATGPIGLTGTSGTNGIDGATGSIGPIGPTGITGATGLTGDAGTNGINGATGPIGAIGLTGAAGTNGTDGATGATGLSGATGPIGPIGLTGAAGTNGAIGLTGATGPIGPIGLTGSTGGIGLTGATGPTGPIGLTGAAGTNGIDGATGATGPIGPIGLTGSAGTNGSAGANGIDGAAGSNGLTGAVGATGPVGLTGAAGTNGIDGAIGLTGAAGTNAIDGATGLTGATGPIGPTGLTGATGPIGLTGAAGNNGIDGATGSTGPIGPTGITGATGLTGAAGTNGINGATGLTGAAGTNGIDGATGLTGAT..................................... 788
107 4.000e-25UniRef50_Q0BS96 Hemagglutinin-related protein n=6 Tax=Granulibacter bethesdensis TaxID=364410 RepID=Q0BS96_GRABC  ali  2830.FATNSATGLVQGGNYGIGMYSGTVSNAGSINASNAQYGMGVNIFSADNSNLLNNTGTITGGNSAVWMGGGSITNAASAVLSGATVGIVFVTAAGTGLVNNSGSIKGGNIGISAAGSLIVTNQAGGTISGSLQAIIGSGGASINNSGTITGSNAISISGGFVTITNNSSGFIQTTDPASHAIDASGTTNNYIVNNGTISGFNDGIHTYGTGSLYNTGSIISSSNSNAGAYLTGNTTNNYATNSSTGSISGGWAGLGMDAGTIINAGTLVGTNVAYGKGVVFQNVNASNLLTNSGSITSASTGVVMGAGSIQNMGASAIIVGNSIGVQFTGTTLTQSILNSGTIKGGAFGITAAGNANITNQVGGYISGGTTGIVSALAGTVANYGTIIGSSGPAIALQGSGINLVQLGVSSQITGSVTANSAGTNTLELLSGASAGTISGIGTQYLGFQNATVDAGATWSFAGSNSIASSTVLTNSGTINNTGTLAGVITMTSGAALTNAVGANIGNGTFSPAIVSTGTSVNVVNNGTILGGQPQSTLISLGASSTLSNGGLLQGSGANAIIIAAGLNASITNSGTIIANNTSNTAVQMVSGTFNNAGLLRSDFAFSNGISASGIATVSNSGTISAAGAFGQAIVLTAGGTVINTGSVAAQIVAGVTRTAINFGAGNSRLAITSGSSIRGNVVAAGTGNVLELDGAGTTLSGFGTQYTGFQTINVKGDGWVLADTLTNTNILMQTNGTVTVSQTLDSSNTITLGGTSSAGVGSGNIIISTPGTALAATVSDFGNGESITLMGLASQASDVVDVVSNGGN............................................................................................................................................................................ 3637
108 5.000e-25UniRef50_Q8RRE3 Vacuolating cytotoxin (Fragment) n=39 Tax=Helicobacter pylori TaxID=210 RepID=Q8RRE3_HELPX  ali  55  1.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PWNYFDARKVQEVEITRKLASSTPENPWGTSKLMFNDLTLGYNAVMDYSKFLNLTIQRNFINNQGTINYLVRGGRIETLNVGNAAVMRFSDSVDSATGFYKPLMNINSAQDLIRDKEHVLLKAKII-----GYDNISAGTNSIGNVSLIEQFKDRIA................................................................................................................................................................................................................................................. 152
109 5.000e-25UniRef50_T5LPX9 Uncharacterized protein (Fragment) n=1 Tax=Helicobacter bilis ATCC 43879 TaxID=613026 RepID=T5LPX9_9HELI  ali  16  41..............................................................................................................................................................................................................................................TARPYYSVNTSPILHNLNLTNNSTDNRFQTPQNTIYQAGLNDDIQGFTGFRQARSGCEANKVVGGDNETCNYTSKIETLTFQGSRWVWGGNRKLTLQDVSGKKVEIGTLTNPYHWSGKGFSAELKVDGASEVV-IDNIHHQNYTGGSWIHVN------VDNKLVVGNIQFATDGIAGSQGHVELKSS----NGDVIVKNAAGCGNAC-----------TGGLGIRPLNFLKIDGKNFYGGNIEAIGLPTAGSNSTLDLTGVSGTKFIDTFSIRTGTLQAKDFHVNNFIVYKS----NSYSVVDQNIG-KSFINYLSMEIGTSDFADGADFNGGGEILNFNFIDARPTSFVRMGGINHVNVNEMKIKEAEVNIKNG---IFNTIVSQKGQTAITNGASKITANALNVNELLHLKDSSKHSGVMRIELNANGNIDQKFDKYLNVSVDSKDLK--NMSGSEIAELIKKAEANGSNGSTTDYKNASGTYITTSDGKHY......................................................................................................................................................................................................................................................... 505
110 7.000e-25UniRef50_A0A1C2EDR5 Uncharacterized protein n=3 Tax=Phyllobacteriaceae TaxID=69277 RepID=A0A1C2EDR5_9RHIZ  ali  305.FAGSTGTATVDGAGSTWTNGGGLAVGYGGIGTLTVSNGGAVNNGGNLVVGTLGTGTVTISSGGAVKNDTGYLGFLTGSAGTMTVTGAGSTWNNNTDVVVGHSGAGTLNIQGGGTVSAGSNGYIGNLAGSTGTATVDGAGSTWTNAGGL----GVGVQGAGTLTVSNGGAVSNGGTLAVGIQAIGTVTITSGGMVGNDTGYVGFAAGGAGTVTVTGAGSSWSNAGNLYVGYDGAGDVKITNGGVVTSNIGYLAYGTGSAGTVTIDGAGSAWNTLTGIAVGTSSVGTLSITNGGKASGDAGIIGAIAGATGTVTIDGAGSLWTATQRLFVGAGGNGSMTISGGGGAISDEGDIGFSAGSSGVATVTGAGSFWTNSGALFVGRDGAGTLNIRSGGAVTSSSGYVGDAAGSNGTATVDGAGSTWTSSGSLSVGIDGTGSLIVSNGGSNTTGFLGVKQGSIGSATVDGAGSTWTSSGSLAVGLDGSGTLTVSNGGTVNNDVGFLGVNQGSNGKATVDGAGSAWANTGSLGIGFDGSATLIVSNGGKVSSTTGYLGVNLGSIGSATVDGAGSTWANSSGLFVGAGGTGTLTIANGGTVSTGGVAMIALQPGSVGTLNIGGASGSAATGAGTLSATSVVFGSGTGTINFNHTDTNYIFAPGISGAGTINQIAGNTNLTADSSGFTGATYVTRGRLAVNGSIANSAVTVSGSGILGGNGTAGSVVANAGGIIGPGNSIGTLTINGNLTQAAGSTYQVELTSTGQSDRINATGAATIGNGALLDMIKLDAAPYVIGTHYTVLQANGGVSGTYTLTGNTKLSAFIGLVDSYDPTHVYLDVAQTKSFTSAGLTPNQIATGGGA................................................................................................................................ 1154
111 7.000e-25UniRef50_UPI000806B04E S-layer family protein n=6 Tax=Epibacterium mobile TaxID=379347 RepID=UPI000806B04E  ali  379..LTNSDGTFTNTGTVTGTSTITGGDLVNSGTLGGNVSVAAGAELSTSGTING--TVSNSGVTTVTSGTVAGLDNSGTATVTGGSVSDFDNSGTATISDGVVADLDNGGSGQLTIEADGEVTVLANAGTASNAGEIGTLTNTDGTLTNTGTVTGVSTVSGGTVENSGTLTGNVDVAAAGTLNTNGTVGGTIDNDGTVTIGGGTVAGLNNTNTATVNDGVVAALTNSGTGQLVINTNGNVT---TLSNAGTASNAGTVGVLTNSDGSFTNTGSVTGDATISGGSVTNSNTIAGATVLSGGSLDNSGTLGGAVTNNATLVSTGTINGDLSNQGNATANLSGTVSGAITTQDSASVTVNGDLDSVTSITHGGSGTFAINSGTTTLAGAGTVTNSGSFTLASATDATGDAVFANTGFANLSVGAGGNLDMDLNNDGTVQIADGGSVGGTLQNGSGGSVNLDGSVGGNLSNAGTLDLSGSVAGTLGNTGMLTVDGASTVTGTLTNAGSMFVNDTLAHGNLTNSASGPAWSDTMLVTDAVLRVSGSGALTSGTLTNSSSIGLSDGATITSAVINSGTIIADGNVTGAGDFTHQTGAILDLGDDAGDDVFMIAGDAVLNGTIELDITLEGEELVGDQIQVAGAVSGNATFNFNLTDADAVDLLGTVNVLSYGSGQLDSYSVNGLPNSGAAVFALVNNTDADAYQLQSGANPAVGGLATGLALTQSLIGSVVNRPTSPFVTGLAVPGDEPCGFGTWSRATGGRATASGSSETALGTYNSELTANYHGMQIGADYSCFGGAFNGWDLSFGGVAGYNGGTTTQPVYFFDANTGQVNTDVLTSTNRTSFSQSYGSAYIAASRSFANSGRVLFADVQVRGDKTAFDLDNSVNAAA.................................................................................................. 1255
112 1.000e-24UniRef50_A0A1C7P9J0 Pep-cterm motif n=2 Tax=Akkermansia glycaniphila TaxID=1679444 RepID=A0A1C7P9J0_9BACT  ali  11  696............TGTVNSANLSINSGASLSMNSATYTLGAGGAINIGNTGTSGTGTLNITGSSTVNGSTGTIKIGNATGTSGLLNIGNTSVVNTAGIVINNGSITLSDTATLNLGSTGISGTGTINFNGGTTIGSSADWSSASGVTYAVNGSTASTFNTNGH---NATLNGNITGSGILTKTGSGTLTIGGSSKTFSGTLNINLGTVYLNLSAGSNLAGTVNIASSTTLQVNGSTYSGTLGITGSGALVFDNSAASITLKEGTGATALSHNITFGNVASTLTLDPTLTTLQGTLSAGSDLTLNGSQFTTANGAVNITGKLTLGLAGDAAHATRTFNALVTAGSLTLQAGTSTIASAVNFAQDATITGALTAQGYANLSTGTGSIGGHNTVAGRLNLSGDAVISGLNDVWTGTVNSANLSINSGASLSMNSATYTLGAGGAINIGNTGTSGTGTLNITGSSTVNGSTGTINIGNGSGTAGSLNIQNTSVVNTAGISINNGSITLSDTASLNIGSSGVSGTGTVNFNGGTTIKADADWTSASGVGYAVNGSTSSTLNTNGHNVTLNGNISGSGRLYKTGQGTLTISGGDKSFTGTTTAAQGTVHVNANMYGTGNSYVAAGGTISISNTGSICTGGSSQATSTVQVTAKAAGTNATLSNANVTASGIVSVDTTGTVKAALNNAKVTINRTGATIDHAILNNTTVSLAQNASVTLNDVVLGTGSQITAAAGATATLNLQNTKLQIVNANITGTLSSKTVAPVVSAN........................................................................................................................................................................................................................... 1451
113 1.000e-24UniRef50_A0A0D6JB38 Hep_Hag repeat-containing protein n=2 Tax=Filomicrobium TaxID=119044 RepID=A0A0D6JB38_9RHIZ  ali  196....NTIFGDLSGSANGNNFANNTIIGNASGSGNGADFDNNTIIGNGSGNLGGDGVNNNTVIGDLSGNGYGDGASYNNVVGNLSGNGVSGSSNNAFGNASGNLVEGNFNSALGTLSGNDVSGDGNTAIGFGSGNFVGSSNNIAMGVLSGNVISGDNNIAFGTLSGNFVTGNNNQAAGLIVGNFVEGENNQASGTASGNGVTGNNNQANGTLS-GNDVTGNSNLASGTGTGNAVEGLGNQAAGIASGNFVAGVGNQAAGILSGNGVEGVGNQASGIAAGNIVQGDNNQTSGTLTGNGVFGNDNQSSGFASGNGVIGSNNQASGQGVGNLVFGEGNQASGTGSGNLVVGDDNQASGALSGNAVFGDANQASGFGSGNLIAGIGNQARGILSGNAVFGDGNQASGTASGNVVIGDGNQANGTESGNVVIGNDNQASGNGSGNVVVGDGNQASGTDTGNLVIGNDNQASGAFSGNGVLGIANQADGLAVGNLVAGVGHQASGVLSGNGVVGINHQASGLAVGNGVSGFNNQSSGFASGNFVSGANNQASGALSGNNVTGDNNIAFGTNSGNNIAASNTIAMGTNAQAEGNSSIAIGNGAFAAGPGDTAVGQNANVQANNSNAFGNGATVNAGHVNSTAVGTGASTTNNNQMMFGTSSQTYTTPGITSNLSKNRQSGPLEVVTSDAAGNLATDGGSI................................................................................................................................................................................................................................................................................................. 882
114 1.000e-24UniRef50_X7XPS5 PPE family protein n=5 Tax=Mycobacterium kansasii TaxID=1768 RepID=X7XPS5_MYCKA  ali  11  190.............................................................................................................................................................................................................................................................................................................TSFAGPAQAVVDPLGRAGLNLGFANAGSGNVGNGNIGSFNIGSANIGSANIGSGNVGSTNLGFGNTGPSLTAASRNIGWGNTGSTNIGFGNTGNANIGFGNTGDGNI-GIGLTGDGRAGLGGLNSGTGNVGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGIGNSGEANTGVFNSGVANTGVANAGNYNTGSYNPGSTNTGGYNGGSYNTGLLNRGNYNTGVANTGNADTGALISGDYSNGLLWRGNYQGLMAPGFGNSTSSGFFNTGSGSASGIANSGANNSGFFNASDVGISGYYNTGALESGVVNSGNTVSGVFNESLLDVAVPAVVSGVLNTGSDLSGLRGGPSSLNLGFANHGGANIGNANIGDSNFGSGNVGNSNIGRGNVGDTNLGSGNIGSTNIGNGNIGDGNLGFASIGIDNFGSGNLGDYNIGPGNIGAHNRGFWNAGSSNIGFANAGDFNVGFANTGSNNIGVGLSGNGEVGFGALNSGSANIGLFNSGTGNIGLFNSGTGNIGIGNSGTGNWGIGNTGTGNTGIDNSGSLNTGVVNAGSTNTGVSNAGSYNTGFVNAGSTNTGSYNTGQHNTGGFNPGNYDTGYFNSGNVDTGAFNTGNYSNGLFVTGDN......................................................... 814
115 1.000e-24UniRef50_A0A1Q2QN58 Toxin-like outer membrane protein n=2 Tax=Helicobacter pylori TaxID=210 RepID=A0A1Q2QN58_HELPX  ali  23  2...................YANNLWDLLNPKVGGEYVHWVKGSQYCAWWEF-AGCLKNVW-------------GANHKGYDAGNAANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGDLTINLGNSVV-LDLSGSNSFTSYQGYNQGKDDVSFNVGAINLNGALEVGNRVGTGAGTHTGTATLNLNANQ---VNINSNISAFKTSQVNIGNANSGSVSLSGDTCSSLARVVGANCSTSGPSYSFKGATNATNFSNASGSFTFEENATFSGAKWNGGHSLSIKSL..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 257
116 1.000e-24UniRef50_A0A1Q2QTW4 Vacuolating cytotoxin n=5 Tax=Helicobacter pylori TaxID=210 RepID=A0A1Q2QTW4_HELPX  ali  89  1.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MIDSHNAGYARTMIDATSANEITKQLNTATDALNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRRHTNNIDSFARRLQALKDQRFA 88
117 1.000e-24UniRef50_G0Y7C7 Vacuolating cytotoxin protein A (Fragment) n=7 Tax=Helicobacter pylori TaxID=210 RepID=G0Y7C7_HELPX  ali  89  1................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................QHASMDYGKDLDLTIQGHFTNNQGTMNLFVQDRRVATLNVGKTAAMKFNNYVDSATGFYKPLIKINNAQNLTKNKEHVLVKARNIDYNLVGVQGA...................................................................................................................................................................................................................................................................... 95
118 2.000e-24UniRef50_A0A1F6S2V9 Uncharacterized protein n=1 Tax=Candidatus Moranbacteria bacterium RIFOXYB1_FULL_43_19 TaxID=1801649 RepID=A0A1F6S2V9_9BACT  ali  10 1206...TGTLTNNSATANKTFTGDVTLNSGAVWNETAATAVYFGGSLTNNATTFTASTGTHYFTGSGKTISGSTTTASVSVSGTVTNSGTMTISTALAGAGGFTNGNGTSGTLNFGGT------TIDITTFTANAANSTMSYNASAIQTVRAVSYNSLVLSGTSAKTMTGVTTIGGDLTISGSATMTSNAAFTLTGTFNYDSSGSTTLAGSTNISIGKYDQTAGTLADNGVTITVSGTGATIWAKSGGTFTATGTVIFTGAAPEIGASGTTFNNLTVSVGTSATITSALDVNGNFSQTTGTFNCNSQNQNIAGDFSLSNGTTWTSGGTLTFDGTNSKLLTDSNGTKQNLGTVVVGDGTNAKTLSLNGTAARVTNLTVANNATFSHNGAN-DLNMTGNLTLNTGAQGSQYTKGGTLAFDTSGTSTVTDSNGTSRDLGVVSVTGTNKVFSTASSVKLTSATLQGSDDTLNISDDTLTITGTGTPLTLNGGTFTVTNSSVIYTGEGSTNISSTTYNNLQLAPASTGRTYTLGTSGSQTINVSGNFVVNDGSGTETVIATAATYNPILNVNGDFTINNYSTFTGGSQTITVGTDGQALGDFTLESGSTWNAGSGTLILDGGDDTNLVYFNDKNSTKQNMGTVQIGASPATTNMSSDMTADSLTVSTGDLNTKGYDLNIATFITVNGTLDGTQATSGNGTNINLGTTWTVGASATFTAEESETYPTTVIFDESSSGNLSPGGTDESHDFYNIQFSKSASATVTMQAAIDVENDLTISNSNSTLSAAGYAINIAGDWSNSSGTYTASSNTVTFDGSGAQSLSGTMTSSSAFYNLTITNSAGPTNGVTFSDDCAVTGTFADNTQDSKLIFTTTKTFTFANIDIDGASGHNVILTSTNGTPGT......................................................................................... 2090
119 2.000e-24UniRef50_Q9LBA9 Vacuolating cytotoxin (Fragment) n=4 Tax=Helicobacter pylori TaxID=210 RepID=Q9LBA9_HELPX  ali  95  1...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................FGENIGDKSRIGVVSLQTGYSPAYSGGVTFKGGKKLVIDEIYHAPWNYFDARNVTDVEITKRIFFGAPGYIAGKTGLMFNNLTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNVVDSATGFYKT........................................................................................................................................................................................................................................................................................................ 146
120 3.000e-24UniRef50_A0A1I7KZI8 Autotransporter-associated beta strand repeat-containing protein n=4 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A1I7KZI8_9BRAD  ali  51..............................................................................................................................................................................................AAANGTWLTSPGSNDYGNGANWDGGFVPVGTASFGTSNTTSLAISSASVGGWTFNAGAANYVFDVSGQLNFTGAGITVNGGSVTINYNVSFSTSTFTGSSTAGDATLNVNSDLAFYGNSTAGNATINNNSQIEFFTTGPLTAGSIAGSGVFDLGGNQLTVGSNNLSTVVTGQIVDGSLVKIGTGTLTLSASNTFGGGVTLSAGTLGLANNNAVGTGALTIYGGTVAYADGIAIGNAIDLRGSATL--DVTTGSATQAGAIGQTGGAFGIVKTGTGTLILSGANTYTGGTTVNGGLLQLGSAGGVGSIVGTVNVGANGRFSVVNADTSGITDISNAGLTVFQNANSAGSATISNSSTLYFSDTSTAGNASITNSSFGGLGFAGFATAGNASITNNGGISFVGNSTAGSATITNGSGGLLSLFDNATAGSATITNNYNMFFYANSTAGNATITNNASLNFNDHSTAGGATITNSATGNVYFNNSSSAGSATITSDNNYLYFNDTSTAGSANITNSVNSRAIFQGNATASNATITNGAYLYFYGSSTAGNAAITNNNWLSFNDTSTAGSATLTNNRWLYFYNDSTAGSAAITTSNLLVFRDNSTAGNASITNSNTINFVVSSTAGSATITNNAGGTTSFQDNSTAGNAQLINNAANAVFDFSGSTGPNGDHKLSAGSIAGNGTFSLGANELTVGSNNLSTAVSGVIADGGASGDTGGSLVKTGTGTLTLSGANTYTGGTTFAGGTVSVSSDANLGDLAGSLTFNGGALQVTGTAFTATTRTIN........... 828
121 4.000e-24UniRef50_A0A2N1ZBP2 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium HGW-Gammaproteobacteria-11 TaxID=2013793 RepID=A0A2N1ZBP2_9GAMM  ali  532.......................SSAALTVSSGDTMTVSSLTNTTGSVINLQTNASLVGTGNTTNNAGTVNVAGGGSLVELTGDYNNLATGVVNFNDAAAKDFDVQAGVINNDGTLNFNAGTTTVNSGGGAIQNNATGDINIADGATLNASGDTITNAGSIDMAGTSSSLTVGTLTNNTGGTVNAQGTLTGTVVNQGSGDFNITGNMISLSLDITNTDTATLDAGAGTITIMRNLTNTTTSGTGVTVATGAGL--NAAVIQNGLANGSAASLITNNGGLYSDTSITNHAGATLNSNTANSLVAYENSLTNNGTVNMQGRIGGQSVINSGAGATFNVVGNLNAINTNPLNAFTNQNSAVLNVSGGTFWVDALTNTSGGTGTSLSTAGVGGLVVAGALNNNAVGTLNNAGSINADSITNAVGSTLVSSGTLDTTSAASNAINNLGTMNIGATGVALGGLDNSGTLTSTGELNEGLINSGTATLSNQVLGAVQNNTGGQLSVAGDLSMDNSLTNAAGALIDVDTGTLSGITALTNRGTGSGNGAGTAGFEIDAGATVSAADVLNTDNATLYVAGTLVSGNAILNSAGAQLASIGALEGDLSNNSILSLQGLLDGDLINDGGLTTITGALAGTGGADTGTVTNRNAGSLVLNNGSSFTFDWLDNDALSSVTLNGATLAGNVINTGTLFGAGVITRQLNNNGTVDLVNGVTGDELRINGGLSGAGTYNLDLDLTSATPGVDRLVITGDTTGDLALAFNLLPGTPALLNSSLVIVDVDESANNDFTYSTSGLPQGSGAVALFASQATPNGDIVISGGASPTLGALMEGVAQVESLTRLSTGRLGLYETDICANTGVSARVSSGETTTDASTVTAQQSAD............................................................................................................ 1384
122 4.000e-24UniRef50_W8RIE2 Uncharacterized protein n=32 Tax=root TaxID=1 RepID=W8RIE2_BACPU  ali  1519..ITGSTGPTGATGITGSTGPTGATGITGATGPTGVTGSTGSTGATGATGITGSTGPTGATGITGSTGPTGATGITGSTGDTGATGITGATGATGATGITGSTGPTGATGSTGPTGPTGATGITGSTGATGATGITGSTGPTGATGITGSTGATGATGITGATGATGATGITGSTGPTGATGSTGPTGPTGATGITGSTGATGATGITGSTGATGATGITGATGPTGATGITGSTGPTGATGITGSTGATGATGITGATGPTGATGITGSTGPTGATGITGSTGPTGATGITGATGATGATGITGSTGPTGVTGSTGSTGATGATGITGSTGATGATGITGSTGPTGATGITGSTGSTGATGITGATGATGATGITGSTGATGATGITGSTGATGATGITGATGATGATGITGSTGATGATGITGSTGSTGATGITGSTGPTGATGITGSTGATGATGITGATGPTGATGITGATGPTGATGITGSTGPTGATGSTGPTGPTGATGITGSTGETGATGITGSTGATGATGITGSTGPTGTTGSTGATGATGGTGPTGATGITGATGASGPTDTALYAGNTTGPTIITIAGGTNIALPSNQNINGFTPNGSNDTFTVQQTGKYYITYQVNTTTALLVSTRLWLNGSTAIPGSIQSSAVSTTFMSNTVIVNLTAGNTIS................................................................................................................................................................................................................................................................................................................ 2193
123 6.000e-24UniRef50_A0A228Q9C4 Autotransporter outer membrane beta-barrel domain-containing protein n=3 Tax=Burkholderia TaxID=32008 RepID=A0A228Q9C4_9BURK  ali  10  821..LSGVAGTSVNLGANALTLGGTASGTFGGVIGGTGSLTLSGTGTQTLNGANTYTGGTNLDSGSLVLGNNGALGTGAGGTATLDTNAALSVGNAVNLGTGAALTLGGSNSLTLGGAISGAGSLVKDGAATTTLTGASTYTGGTTINAGTLALGTGGSLASTGAMNLAGAGATLDLAGATGAQTIGTLTGAAGTNVNLGTNA---LTLNGATNGTFGGTIGGAGGVTVAGTGTQTLTGANTYTGGTTINGGSTLALGAGGSLASGSAVNLAGTGATFNLSGATGAQTLGTLTGAAGTNVNLGANALTLNGSGNNTFGGTIGGAGGVTVAGTGTQTLTGANTYTGGTTINGGSTLALGAGGSLASTGAVNLAGTGATFDVSGATGTQTVGALSGAAGTNVNLGANALTLNGATNGTFGGTIGGTGGVTLAGTGTQTLTGANTYTGGTTINGGSTLALGAGGSLAATGAVNLAGAGATFDVSGTTGTQTVGALSGAAGTNVNLGANALALNGSGSSTFGGTIGGSGGVTVASGTQVLTGDNTYTGGTTIAAGGALQLGNGGTSGSVAGNVVDNGALIVDQSGNVTIASVLSGTGSLTQAGSGQLTLTGTS---TLSGPTSVSAGTLAVNGSLGQSTVTVQNGATLTGTGTIGGLVVQGGATAAATQPGASLNVAGNVTFQPGSTFQVAATPQQSGSLAASGTAMLNGGTVQVFANQGSYQPSTTYTILTASSGVQGAFAQVNANYA.............................................................................................................................................................................................................................................. 1558
124 7.000e-24UniRef50_A0A1Y6CTH5 Hemolysin-type calcium-binding repeat-containing protein n=1 Tax=Methylomagnum ishizawai TaxID=1760988 RepID=A0A1Y6CTH5_9GAMM  ali  10  390..........LNGENGNDTYTIDSLSDSVSDSGSSTSEIDTINAAISSGTGTYSLGTGIENLILTGSAAIGVTGNTLNNSIVGNAATNSLTGGTGNDTLDGK----------GGKDTMVGGTGNDVYVVDVSTDVITESNGTTDGIDEIQTGITYSLASLSAIEKLTLTGTTAINGTGNAAANTIVGSAGANILDGGGDDGVVDSLDGAGGNDTYNVYDNLDVISDSGNNATSKDTISISQTTGSYTLTDASNVENLTLTGNGDVNATGNSLDNLITGNNGNNSLVGGDGKDTLNGGAGNDTLDGGVGNDSLNGGTGSDTYLVDSASDTISDSGTSTADVDTVIATLTSGTFNLSSITTIENLTLGGSANINGTGNLLNNTITGNAGANILVGSSGNDVLYDAASTAANSSTGADTLNGGVGNDTYYVTNSAATVSEAKTVGGETVVGSGTDIVFASVGFTLTDTSGIENLTLTGTGSNAGTGNSLNNVLTGNNSANTLTGNNGNDSLSGNNGNDSLDGGAGNSLDGGSGTDTLDGGAGADTLLGGANNDSLLGGNDNDSLDGGSGNDTMDGGNGSDTYSVDSLSDSVSDTGTSGTDTLNITLNSGSGTFNSGSGVENFNLTGTAAIGITGNDMANIIIGNSASNALSAGSDALNDSLRGKGGNDTITLSINAGGSDTVVFEDTAVNNGQDAISNFTAGSIAGGDKLDFNLFFGSSTTISLTAVKADTDTTPLTVQSTSTVGNVLRVDDTGAAITTGAGVAALIGDTSLGTQTTPFQDNIGDASVERYVVLTVNATSGTSIWYVDTSLDSDSSDLTSNDVTLVGTIAGVTGAALFASAN.............................................................................................................................................. 1209
125 8.000e-24UniRef50_A0A2S9NTX3 Uncharacterized protein n=33 Tax=Burkholderia cepacia complex TaxID=87882 RepID=A0A2S9NTX3_9BURK  ali  43...............................................................................................................................................................................................TGTTTVSCTGASTSYSNGTNNLNLTVQPGATVSVVPLLGGTALSLTGSGVTLINNGRIDPALSGLSIVSNGTVVGNSASASIVNVTNASSGVMMGSTSSLLNGPALTVYNGIGGTTNITNAGTIGTTGLLGFGAGPAAQVVTTSGGAQANFTNASGGVINGSVALAPSGTPGAGNTFTNAGAVTGNVSLGAAVGTSNTFNALTGSSVGLGVDAGLGGNNTLNLQLNTATGGATNGAIAVDTFGNFNNLAVQGGTWDITGASTATNASLTGGTAIVHGAGALGTGTIVGGGGTLEAGAAGINLLNNVTLTGGLTVDGANGLALSGAIGGGGALNVSGTGTLALNGVNSFTGGTNLTGGGGLLVGTSGALGGGALNVTGAGGTLGTSIGGTVLGNAVNLGAGVTLGLNGSANLGLGGTIAGNGGLAQTGTGTTTLLGVNTFTGGTALSGGGLIAGNGAALGAGELHVTGAGGSLATNVGGTLLGNAVNLDAGATLGLNGAAGLSLGGTIAGNGGLAQSGTGTTTLLGANTFSGGTALSGGGLIVGNGAALGTGSLNVSGTGGTLATNVGGTVLGNAVNLGAGATLGLNGTADLGLGGVIGGGGHLAQTGSGTTTLLGANTFTGGTVLSGGGLIAGNGAALGTGALNVTGIGGTLATNVGGTVLGNAVNLGAGATLGLNGAADLGLNGTISGAGGLALGGTGATTLSGANTFTGGANLTGGGSLIVEGGTALGVGGALNSGLGGSLSADLAAGAALANGINLNGASLTLNGANN................... 814
126 1.000e-23UniRef50_A0A124SPL9 Uncharacterized protein n=13 Tax=Burkholderia cepacia complex TaxID=87882 RepID=A0A124SPL9_BURCE  ali  2051..........................TGATTINSGTLAIGAGGSLAASSPVNLAGAGATFDVSGATTPQTTGTLSGVAGSTVNLGGNNLTLGGSGSGTYGGTIAGAGGSLTLSGTGTETLTGNNTYTGGTNLTGGGTLIAGSGSALGTGTLNTSGAGGTLGTSVAGTTLANAINLGSGSTLTVGGANNLGLGGAISGSGNLAVTGPSTTTLTGAGTYTGNTTIGNGSTLAVGAGGSLSSGSAIDLAGAGSTLDVSAATTPQTTGTLSGVSGSAVNLGGNTLTLGGSGSGTFGGTVGGTGGLTLSGTGTETLTGANTYTGATTINSGTLAIGAGGSLSGSSPLNLTGAGATFDVSGATTTTGLSGVAGSTVNLGGSNLTLGGSGSGTYGGTIAGTGGSLTLAGTGTETLTGPNTYTGGTNLTGGGTLVAGSNTALGTGALNTGGAGGTLAAGTPGTTLVNAVNLGSGSTLTVSGTNSLGLSGPISGSGTLALGGPATTTLSGANTYSGGTSVTGGGTLVAGTPTALGSGTLSVGGNGGTLGTSVPGTTLGNAVTLGTGSTLTVGGANNLGLSGPISGGGNLAVSGPSTTTLTGASSYTGNTTIGNGSTLAVGGSGSLSAGSALTLAGNGATLDVSGTTTPQTASALSGAAGSSVNLGGNTLTVAGPTGGSFGGTIAGTGGFAVQGGGTQTLTGANTYTGGTTVGSGSTLALAGAGSLAPTSPVILAGSGATLNLAAAAAPQSIGTLSGTTGSNVNLGATPLTVNTAGTSSFAGTLSGTGPLTLAGTGAQVLSGTNTLSGPTTVTGGTLAVTGSLASSPVTVGSGATVTGTGTIGGLVVSGGGTASVLQLGQPLKVAGNATFQPGSTLHVGATPQQNGGLDVTGSATLNGGSVQVVAATGQYQPGKLYTILNAGAGVQGQFSAVNST........................................................ 2952
127 1.000e-23UniRef50_E1ANQ2 Vacuolating cytotoxin (Fragment) n=102 Tax=Helicobacter pylori TaxID=210 RepID=E1ANQ2_HELPX  ali  69  1................................................................................................................................................................................................................................................................................................................................................................................................................................................................VDAHTAYFNGNIYLGKSTNLKVNGHSAHFKNIDASKSDNGLNTTTLDLSGVTDKVNINKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWNYFDARNIKSVEITNKLAFGPQGSPWGTAKLMFNNLTLGHNAVMDYSQFSNVTIKGDFVNNQGTINYLVQGGNIETLSVGNAAAMRFNDSVDSETGFYKPLMNINSAQNLIKNKEHVLLKAKVI-----GYDNVSLGNNSISNVSLIEQFKERLALYNNNNRMD........................................................................................................................................................................................................................................ 299
128 2.000e-23UniRef50_A0A2N3PM51 Uncharacterized protein (Fragment) n=1 Tax=Telmatospirillum siberiense TaxID=382514 RepID=A0A2N3PM51_9PROT  ali  1196............GGYVASTLNGTNDIIAVTGNNEIIVANGTPYGSVLVSGTNDTVTINAGGSGTLQVTGTRDLVNVDDTAVTLLATTSSVTVVGSSDTVTVLGTGDSVTVSGTADSVAASGTAVTLTGTGSSATVTGIDAIVVTGTNDTLTAGGGTIALDATGAMVTTTAVTDVALADDIAATLDAGGFADRVTLGSNDSLTLINAATGAQVTVDGTGDTLSVDNVQVTLSASSAKLAVTGSSDTVVVTGTNDTVTLSGSSNSLTGSSTSVTLTGVSSSAVVSGISDAITVTGTND---TLTAGGGTIALDATGXXXXXXXXXXXXLADGVAATVDADGFADQVTLGSNDSLTLTDATASNITVAGSGDVITADNAVITLSASSAAVTVIGSNDTIIVTGTDDVVTVSGSSDTLTASSSTVTLTGDGSSAVVSGSSNAITVTGTNDTLTAGGGTITLDGTGAVVTTTAAAALTVADGVTATVVAANGSADQVTLGSYDSLTLTNAVAGTAILVAGTGDSIVADNVAVTLSASSASATVTGISDSIAVSGINDAVTVSGASDTVTANSATVTLTGDSSSLVVNGTSNVIAVTGANDTLTVGSGTVSLNGTGSMVTTTASTALTLADGVAATVNADG--SADQVTLGSGDSLTLTGDTTATNVTVAGSGDAIVADMTAMTLSASSASATVTGISDSIAVTGASSSVVVTGAANVLSATGSNDTLTAIGDANTLEGGSAATTLIGEGNQNIYLVGSGDTTISNTSTTGSASGEIDLQGSTSSSNLWFALSGNNLVIDVMGTDQQITVTDWTSAGNETQDIAAGGQKIDTSGIGTLIQAMASYSENNASFDPTTVSQIPTDSSVAIAVNQTW................................................................................................................. 2047
129 2.000e-23UniRef50_A0A2S9JAT8 Uncharacterized protein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A2S9JAT8_9RHIZ  ali  11...................................................................................................................................GSNTTANGTVDGGSGTWNATGTNWTTANGGTNSTWTSAGTAVFQGTAGTVSIAGQQNIGGLTFKTDGYKLSDQVLGNASLNLSNPTNIVTADPGVTAVINTKITGNAGSQFVKDGAGTVVLGGDNSYAGGTDVRGGVLQLQKGLFPSLDGKLGSTTGTTSVSGGTLDLGTTTQQQQALNVTAGSVINGTIKVDTATISGTGTVASNSTIDAATSVTQTGGTMGGTAKTVDYSLSGGTASGTITASNGLTQSGGNLTGSAGAKDYTLSGGTLSGTVTATNTATISGTGSVAGTGTIKAGNKINQTGGTMGGTADTLYDLSGGEMSGKIINATDVTQTGGTLSGTAATGTYELSGGVLSGSVTATDKATISGSGSVASNGVITATNAISQTGGTMGGTANTKSYDLTGGTMSGTIKNGLGTSDVVTQSGGILSGTAATSSYELSGGVLSGSVTATDKATISGSGSVTSTGVVTATNTISQTGGTMGGTADTPLYNLSGGEMSGKIINATNVKQTGGTMGGTATTVDYSLSGGTASGTITASNGLTQSGGNLTGSAGAKNYTLSGGTLSGAVTATDKATISGSGSVTSTGVVTATNTISQTGGTMGGTAKTVDYSLSGGTASGMITASNGLTQSGGNLTGSAGAKDYTLSGGTLSGTVTATNTATISGTGSVTGTGTIKAGNKINQTGGTMGGTVDTPLYDLSGGEMSGKIINATDVTQTGGTLSGTAATGTYELSGGVLSGSVTATDKATISGSGSVASNGVITATNAISQTGGTMGGTANTKSYDLTGGTMSGTIKNGLGTSDVVTQSGGILSGTAATS................................ 829
130 3.000e-23UniRef50_A0A2J6MKY1 Uncharacterized protein (Fragment) n=1 Tax=Burkholderia sp. WAC0059 TaxID=2066022 RepID=A0A2J6MKY1_9BURK  ali  10  792............GGLASGTQVSSGGQENVSGNGEAETVHMGGSQTVYAGGADSGSGGQQTVSSGGVADGAQLEGAGSLQTIYGSASSTTIDSGGTQAVSSGGVAESTVTGSAGGTLIDSGGTQDVLTSGTASGTQVSGGGTQDVLGTASGTIVSAGGTQLLDTDGTAVSATVLSGGRQIVSSGGT------DSGSTLSGGSQTIDSGGHADGTVVDAGGSQTVSAGGSATSATVNDGGTQTVLASGTASGTQIESGGTENLAGSGYGETVFTGGSQTIEAGGIDTSATLSGGSQTIDAGGNATSTTVGSGGLETVSSGGVASGATVDADGTQTVDARGVASGTQVESGGTENLAGSGYGETVLTGGSQTIEAGGVDSGALVSGGLEVVGSGGSAISTTVNDNGTQDVQAGGVVSNTVVGSSGTENLYGSGYGETVNNFGYLAVYSGGVDSGATLNYGGNELVSAGGIADDTRINSGGFQILYGSASGTVISNGGLQWVPTGGIAEDTQVSDGGVQDVLSGQSVNTQISGSSSTQLVEAGTASATTVGSGGTQIVYYRGT--ASGTTVLSGGQQILSSGGTDSGATLSGGSQTISASGTADGTIVSAGGSQTVLAGGTASGTQVSGGGIESLAGSGVLAGGSQTVEAGGIDSGATLSGGSQTISSGGSAVDTAVSSGGMQSVASGGAASGTTVDAGGSQTVSASGSATSATVNDGGTQTVLAGGIESGTQVESGGTENLAGSGAGETVFAGGSQTVASGGIDTGATLSGGSQTISSGGTASDTTIDSAGSQTVSAGGSADGATLSGGWQTVSSGGVASGTTVDALGIQNSGGVASSSTIAYGGWQSVSSGAIADGTIANSGGTQAVASGGTARDTTLSGGTQGVLAGGTASGTQVESGGEEAVAGSGYGETVYAGGTQLIDSGGVDSGATLSGGSQTVRAGGLASATTV................................. 1737
131 3.000e-23UniRef50_A0A0N1BSH0 Uncharacterized protein (Fragment) n=1 Tax=alpha proteobacterium AAP38 TaxID=1523418 RepID=A0A0N1BSH0_9PROT  ali  39...................................................................................................AADITISSSITTGTVWSGTGNPGSNLTVTNTGTINTANAYAVTITGTVGSQLGTLLNNGLINDSAANGRAVFIQAGSVSALINTGTISATTYALWNAGSLGTMSNSGLINGRLVNQSTIGAFTNTGTLTYTSFTWDNESQIRTFTNSGLIYGDRAVYSQGTIGTLINTNTGTIQGTINAITITGVGGINSIANSGQIIGNVLNSGTIMPTISGGTLTTIGTLTGTLGSVGTITSANAGLLFSSGKLYLNDFINVGTNTVTNAGASLSVTSLLSITGTLMQSAGTIQINPSAGRLVVNSLTGGTVVAGLNSISNYLVGDYTIIAGAAGSDYTGLSLVTSTVTGQSAVSSISGNNIITTARNNYIGGTLTTLSNSGTISGSNTATATGSVGTLSNTGTLSGATRGIFMNFSAQVGTITNSGRIVAVGGAGAAGGIANAGTIASIVNTGTIISGASSGIGLNQNVSSIGQITNSGLISAATGGIYDQGTIGTVNNSGQILGAQGISINGGTLGLLNNSGTISGSSRGIYLSGVLGSVNNSGTLSGPAALYAASGSSVGPITNSGLIAGSIVNLSSSALTISGGTGATIGTLTGQTVTNKGSIVNTLSNVVFAGGNLLLNDNINATGRTVSNIGASLRMDSIINIAGGFNQSSGTLVIDPTRAGVIATGAVSITGGTILSNFSSTGNYLAGAYTLVGGSSLNLTGATVSINNVTGLYKSTSTVGTGLLLNVNNYYVGGTLTTLNNSATITSASTGVYVATTGQVGTLTNSGTLGGAQFGVNNRGTIGTLSNSGRITNNNFTALWNQGSIGLLTNSGTITNSSWAILNSSTIATLTNSGVLLGSGNAIQNNGVMTLINNSGTLSGGSNAMAGTFGTIINS....... 919
132 3.000e-23UniRef50_A0A1X9N993 Uncharacterized protein n=1 Tax=Oceanicoccus sagamiensis TaxID=716816 RepID=A0A1X9N993_9GAMM  ali  10  4................................KKTLLASSIIAAQASIVPVAIAQTTITNTVTAEQSSQPGGLTIGNTGVIDIFSVSGFDVGVRVTTPTGDITNNNIIEIVQDVPNSTSGGDGIYLEGVNYTGTITNNGSIDSDISGIALDNQAV-MTGNIINTATGIITGDKAGLGAAAIRIEQRVDPTCDMSCGSELTGGLPNQPVLNGSITNSGVIQANTGNAIDIVVGQVTGGISNSGASGLITSTSGVGINIESGQLSGGINNAPASVIRGSSGIVVSVNNTYFHPSTLDGGINNAGTIEGTLNAAIAIINGGVLNGGISNNAGGNIEGGPVGILADNAQLNGGISNAAGGLIRGDIDGIYMTFSNLTGGIDNSGDIDGDNGIGVLLEDGVTLTGGITNNLGGTIAGLAGVQLVDTTVDSISNAGSIVASGVPSTTESSSTGLSLLSGSTVTGSITNTGSISSSIGTAVLLADSTVNGAINNAAGGSIAGVEGGMTVFQSTVTGGISNSGTISSPGPETGEFVGYGLDVQLSSVGAITNTATGTITG----GFILDESAMTGSFTNAGTLQGAMAGGDGYVLRGANSTQGELINSGTITGDGGISVEDGAVFTSAITNSGTISGSDAAIALDNGSGITTLNNTASGIIQGGSFGAIIVLDTLSSITTINNDGTINGQTNFGAGGGSFNNTGTAGDLLGVGAVVNSGTLGNVQFAPGGGSFVSTAGTVGNVTDVIGAVSNAGTVGNVAFGAAGGTFTNTGGDIIDADAVINTGAMLGDVNLVTTGGSFSNGSGSVGNVVNVNGDVSNGGGLASLTYMMGGSGTVTNTGTITGNLSGTTAVINSGNLGDVFMAPAGGSFTNNAGTVGNVSNVIGAASNAGTVGNVDFGMAGGSFTNTGSAGDIINANAVTNTGATLGDVTLVMAGGSFSNGPGTVGNVSNVTGDVINDGVLASLSYVDGGAA................ 933
133 3.000e-23UniRef50_A0A1Y5DX61 Uncharacterized protein n=1 Tax=Methylophaga sp. 41_12_T18 TaxID=1856284 RepID=A0A1Y5DX61_9GAMM  ali  11  3............................................................................................................................................................................................................................................................TAFANIVIDDDATEGATTTIIAPNNHIQAVDFSDNSGAAIRINDSNGANGLLTINGGVTVSSSDLEAVVVGGGGTASVSITNAGTLSSVLNGLLVQDGAELTAFDNTGGIIEATGTGAGLYLQEDQDNAITNAGIIRNTANGDGLKLDSEAQTQDFTNTGTISSNSGIAINADTAMAGATNGFVNTGTISGGGAAIDAEAAFTLTNSGTVTGNIEHATSGALIISQTAGAITGNITSTADAAHSLNLTGGSITGNITLNGTTANTF---VLDGATINGNVDLGDGAANSVTLTTGSLLGSLDIGTGTTAVSINTGVGDAITVTTFDTLTSTVSMSGAGTFNSTTFSVNGTLNQSAGTLSTADFNIGDNDTVTQTGTGVINSTTTRLGSGATLTLKNQGSGQIQGGADDRGNVIFSGNYNTDAALGISTN-TLASVTVNTGQVLTLDQNADVLTFNNNGTVNQSAGTANITTLNIGDNDTYTQTGSGVL----NTTTTKIGSGATLTLNNQGTGLIQGTADNQGALVFSGNYNTDAALGTVANTLASVTVNGGSTLTLDQNSDVTTFTNNGTVNQTAGTLAATTLNIGASDTLTQTGTGVINSTTTNIGAGGSLTLLNQGTGLIQGTADNQGALVFSGNYNTDAALGTAANTLASVTVNTGQTLTLDQNADVTTFNNNGTVNQSAGTANISTLNIAAGETITQTGTGILNTTTTKIGSGATLTLNNQ... 720
134 4.000e-23UniRef50_A0A0K2QT61 Vacuolating cytotoxin (Fragment) n=2 Tax=Helicobacter pylori TaxID=210 RepID=A0A0K2QT61_HELPX  ali  56  60...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NIKKVEITNEFAFGPHGSPWGTAKLMFYNLTPSPNAVMDYSQFSNVTIHGDFINNQGTIYYLVRDGNIETLNVGHAAAMIFNNDIDSATGFYKPLIKINNAQDLIKNKEHVLLKAKIIDYDYVSVR-----TNSISNANLIDHFN..................................................................................................................................................................................................................................................... 199
135 6.000e-23UniRef50_Q54JT4 Uncharacterized protein n=1 Tax=Dictyostelium discoideum TaxID=44689 RepID=Q54JT4_DICDI  ali  316.............................................................................................GSQSTGVSTTITSGSQSTGASTTATASGSQSTSASTTATASGSQSTGASTATTSGGSTGFISGASTTSMSTTTATGSIPTTGSQTSTSGSYTTTGSQTSTSGTYTTTGSQTSTSGTYTTTGSQTSTSGTYTTTTKPSTTTGGGSTGFLSGASTTLGGGSGSSTSSQSGQSSTGIISGVISGGNSVAGGSGSVGNSGSITGLTTTTGGISGGNFIAGVTTSNSIAQTGSVTGLIANGIAGSVGGLTTANSLTGVGSIGNIANAISTITTSKPTISSTTTTISSQATSGFISGAGSIAGGLSIGNSGSVAGITTQSGSLTGANTVAAVTTANSIGSKTSITGVSSIGAISGSIDGLTTANSLTGVSSIAGITNQASSIANAISGGNIAGVTTSQISTGIISGVIAGGSGSITSPQSITGQSSTSITSGVISGVISGGNSVAGGSGSVGNSGSITGLTTNGGISGGNAIAGVTTSNSIAQTGSVTGLTANGIAGSVGGLTTANSLTGVGSIGNIANAISTGLVGQITTSKPTVSSTTTTSSQGTSGFISGAGSIAGGLSIGNSGSVAGITTQSGSLTGANTVAAVTTANSIGSKTSITGVSSIGAISGSIDGLTTANSLTGISSIAGITNQASSIANAISGGNIAGVTTSQSSTGIISGVIAGGSGSITSPQSITGQSSTSIISGVISGVISGGNSVAGGSGSVGNSGSITGLTTNGGISGGNAIAGVTTSNSIAQTGSITGLIANGIAGSVGGLTTANSLTGVGSIGNIANAISTGLVGQITTSKPTISSTTTTSSQATSGFISGAGSIAGGLSIGNSGSVAGITTQSGTGANTVAAVTTANSIGSKTSITGVSSIGAISGSIDGLTTANSLSGISSIAGITNQ...... 1204
136 6.000e-23UniRef50_K9WJ83 Uncharacterized protein n=1 Tax=Microcoleus sp. PCC 7113 TaxID=1173027 RepID=K9WJ83_9CYAN  ali  787............GSVNLSGLQVNSTGGAALEATNLNEANITQSILSSTNSATNGITLNGVSGTVDVSNSTVNVTNPTGNGISAENVTGTVNIAANSGSQVTTNGTAASLSLRESTGSVNLSGLQATATGGAVLEATNINNANITQSTLSSTNSATNGITLNGVTGTVDVSNSTVNITNPTGNGISAQNVAGTVNIAANSGSQITTNGTAASLSLRESTGSVNLSGLQATATGGAVLEATNINNANITQSTLSSTNSATNGITLNGVTGTLGVSDTTVNVTTPTQNSNITGTVNLNANAGSTITTNSTNAGIALEQSTGSVNLSGLQVNSTGGAALAATNVNNGSLTQSTLTSTNSATNGLSFSGVSGIFDVNNSTITVAQPTNDGISVVDSTGTVSVVANTGSQITNAVNGVRANNVSGGLTASGLAIVDSSQNGISATNSRNLTLQGNTISNSGVDGINLNEVTGQIAINNNSITNSAEDAIGLMNTTGQAVLSMNQNQIDGGINGINLSLSGDAQVTSQMANNQILNTTREGLLVNLQDNAQLNVTASNNQMTNAGTTVGSNGVLLSTGGNTLSTFTFSGNTFTNMGNGFVGNNFGFYLDARDNSSSNLTFSNNQLTSGTGVLAGVIAENNSPGSRLCVQMNGNTSSGASFVDFALSNNASAQYQVVDFANVGVNNTGNFGVFGAPFTNVQ................................................................................................................................................................................................................................................................................................ 1471
137 7.000e-23UniRef50_UPI000A07A201 hypothetical protein n=1 Tax=Paraburkholderia acidipaludis TaxID=660537 RepID=UPI000A07A201  ali  747...TLILTTTFSGTPTITGGTMQVGNGGTVGSIAGNVSNGGTLAFDRSDNVTFGGTISGTGAVVQQGTGTTLTAANTYTGATTINAGATLALGSGGSIADSGGVTDNGTFDISGTSGGTSITSLSGSGDVTLGSQTLTLTDASGTFGGTIAGEGGLTLAGGTET--LTAVNTYTGATTIDSGTTLVLSSANDILLNHVVDNGALLFEGTIAGLSGDGSVSVGNGGLVLSGGGSFGGTLTGAGGVTVASGTQTLSSANTYTGATSISSGATLALGAGGSIADSSGVTDNGVFDISGTSGTSITSLAGSGSVTLGSQTLTLTDAGGSFGGTMAGTGGLTLTGGSETLTGANIYTGATTIGSGATLALGSGGGIADSSGVTDSGTFDISGTSGASITNLSGSGSVTLGSQMLTLTNAGGSFGGSIAGSGGLTVDSGTLTLTGTNTYTGGTTITSGTLQIGSGGTTGSIAGNVSNGGTLAFDRSDNITFSGTIAGSGVLVQRGTGTLTLTGANTYTGATTIDSGTTLALSGSGSIAQSSGVTDNGTFDISGSSGASVTNLAGTGTVNLGTLTLANASGTFGGTFAGSGTLLFSGGTGSLILDGNSSSFTGTTEIASGLLEVGDIDNPQAELGGSVTVDSDGTLRGHGTVEGNVTNDGTVMPGGSIGMLTVGGNYTQASNATLSIEVSPTAASQLKVDGSATLGGTLAITYDPGTYTAKSYTLISASSVSGTFASTTNTGASYLGALTPSVTYGANDVDLVLAAAAGTTTTVVAPTDTSIYTAPGTTAILGAQAQDAALLDRLGKALPATAGQSSGWVTATGNQTKVDGTNGEPGFQADRYGFLAGLDQQLGAYTVGVAAGYDHADIDESGTGDSGTTDTLRVALYGSRFVGPVNLAATVGVGLDFLSQKRPFGSAGTAEGDHMGQEANVGSQAS................................................... 1674
138 8.000e-23UniRef50_A0A2U8HQX4 Uncharacterized protein n=1 Tax=Methylobacterium sp. DM1 TaxID=2067957 RepID=A0A2U8HQX4_9RHIZ  ali  10  984........PGVVGGPTNDLIEVGGNLTLAGTLSLVNAADPSASPVAGTYRLFNYGGTLSGRFDAVTSPTPISATVYTTIPNQVNLFLLNAGQVAQYWDGTDTAGTGAGGQGGTAVWNGANTNWTGSPTSSVNAAWASGVGIFAGTAGTVTVAGAQNVQGLQFVTDGYRLAGAGTLNLTGDPFSTPNQSFVTVDGGVGATIANALTGTGGTIGLNKLGAGTLTLAGTNTYTGATSVTAGTLMLAAGGSLTSDVSVAGGAAFSNAGTLAAGLTNAGTATNTGAIAGTLTNSGRFANSGTIAGRVTNTAGTLTNTGTFNGGATVTGGTLALDAGSLVNGALANSATVTARGRINGTVTNAAGAAFTNTGTLDGTLGNTGTASNAAAILGAVTNTGRFTNSGSVGGLLTQSGGTSTNTGTLNAGAVVTGGTLALDAGSLVIGTVSNSAAVTAQGRINGAVINGPGAAFTLTGALAGLTRVSNDGTLVLAGNGLGVGTLSGNGTVRNASATAATLTVGTGAGGDSTYGGL-LQDGAGGGALGLTKIGSGTLTLTGANTYTGATTIAAGTGLQLGDGGTLGSIDGTSGVAAEGRLTFNRSDAIAFAPALSGSGIVDQNGSGSVTLTGASTAFTGRANVNAGRLSVNGTFGDIAGNTAVVSVNEGGTLQGTGTIAGAIFVNSGGTASIGVAPSQPPGTLTVGGNYTVNAGSNNIFQLGAPNVVGGATNDLIDVGGTLAINGGTATLQNANASGLYRLYNVGGTVTSAGAANAGFAAVTTANGTASIYTVAPGAGGPSQVNARVALGGQIVQYWDGTDVSGLAGGTPGAQGGSGVWNATNANWTDDPVGGQVNQN...................................................................................................................................... 1821
139 1.000e-22UniRef50_A0A1Z7WU06 Uncharacterized protein n=1 Tax=Methylophaga sp. 42_25_T18 TaxID=1856285 RepID=A0A1Z7WU06_9GAMM  ali  11  16.........................................................................................................................................................................................................................................................................NTLTANIKRALMFTTTTLLSVNVAVADIVIDSDNSAASLNTIIAPANHSQGAFSDNAGDAIEVNDTNGANGTLTITGTVTSAGHGLHILNNAELTAFSNGSVVESSGGASAAFYLQEDQDNALTNAGTIQNTSTGDGLRIDTEAQTTQDFTNTGTISSASGTAINADVAMTGAGNGFVNNGGTVIGGGGSAVDAEADFTLTNSGTITGRIDHSTAGVLTISQTAGSIAGDIFSTADGAHSLTLTGGSITGNITLNGTTANTFTLDGATINGNVDLGDGAAHSVTLTTGSLLGTLDLGANTTAVSINTGGGDSVTVTTFDSLIATVNMTGAGTFNATTFNNNSTVNQSAGTANITTLNIGDSDTYTQTGSGVLNTTTTNVGNGATLTLNNQGTGIIQGTADNQGALVFSGNYNTDSVLGTAANTLASVTVNGGSTLSLDQNADVTTFNNNGTVNQSAGTANITTLNIGDGTYTQSGSGVLNTTTTNVGNAATLTLNNQGTGTIQGTNDGDGALIFSGNYNTDAALGTAANTLASVTVNGGSTLILDQNSDVTTFNNNGTVNQSAGTLAATTLNVGAGDTFTQTGTGVINITTTNIGLGGTLTVLNQGTGVIQGTSDNQGAVVFSGSYNTDAVLGTAANTLAFVTINAGQILTLDQNADVTTLNNNGTINQSAGTANITTLNIAAGETVTQTGTGVLNTTTTNIGAGSTLTLLNQ... 729
140 1.000e-22UniRef50_D5K7Y7 Vacuolating cytotoxin (Fragment) n=207 Tax=Helicobacter pylori TaxID=210 RepID=D5K7Y7_HELPX  ali  98  1.......................................................................................HYWVKDGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDSADRTTRVNFDAKNISIDNFVEINNRVGSGAGRKASSTVLTLKSSEKITSRENAEISLYDGATLNLVSSSNQSVDLYGKVWMGRLQYVGAYLAPSYS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 157
141 1.000e-22UniRef50_E6NNF4 Putative vacuolating cytotoxin-like protein VacA2, N terminus (Deletion of central part) n=6 Tax=Helicobacter pylori TaxID=210 RepID=  ali  24  26......LAPLLIGGFASAVYANNLWDLLNPKVGGEYVHWVKGSQYCAWWEF-AGCLKNVW-------------GANHKGYDPGNAANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGNLTINLGNSVV-LDLSGSNSFTSYQGYNQGKDDVSFNVGAINLNGALEVGNRVGSGAGTHTGTATLNLNANK---VNINSNISAFKTSQVNIGNANSGSVSLNGDTCSSLASVVGANCSISGPSYSFKGMTNATNFSNASGSFTFEENATFSGAKLNGGHSLLIKS...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 293
142 2.000e-22UniRef50_UPI000DA23CBA hypothetical protein n=1 Tax=Rhodobacter viridis TaxID=1054202 RepID=UPI000DA23CBA  ali  10  708..FSNLATAGDVTNSGTFVNNAGASAGAVTNTGGPAASGSNAGTIAGLTNADGSFGNIGTISGDVAVTAGTVRNSGAVGGALSVTGGSFTQSGAGQVAGLSTVGDAGRLTNAGTLADLTTSGHFENRAGGTAGAVTNSGTGANAGAIAALTNTDGSFDNRGRIATNVVVDGGAVTSSGRVGGTLTVNGGSFTQTTGGRVVGASTVKAAGTLTNAGTLADVTNRGQFDNLIGGTAAAVTNAGTGTNAGTIATLRNTDGTFDSSGTISGRVAVDGGTVTNTGTVQGAATVADTGSLTNGGTLDQVTTSGRFDNLAGGTAGAVTNAGTGTNAGIIATLTNTDGSFANSGTISGRVAVSGGIFEQTGDGAVAGTVEIGPDGTVRNSGTLHRVTNNGTFNTLATGSAGAVTNFATGSNAGTLASLVTSGGVFANTGAILHAVTVTAG----TLTNGGVISGDVTVSGGSLAQLAGGAAEGRMQIGAAGTVNNAGTIGEVTNDGTLDNAAGGETGAVGNAGHLINGVGATTGTVTNTGRVENHGTLDALVNSGDGRVTNAGAITGDAQIDGGTLTSRGTARIGGALSIAEGATAAVDTGRMTVGGATTLAGRLNIADSAAMFAEGGITSTASGVIALSGDLTLGTAGDPGTLENGGALVFRDSGAVVTGTVTGGTIYGLDGATINGTVTGADRITLLDADRNALLDAEIVPGARSAAAAPAMQTFTVGSLAGDATDLSFDVDFSTEAGAIDQIAVAGNISGS................................................................................................................................................................................................................................. 1457
143 2.000e-22UniRef50_V4PSL0 Uncharacterized protein n=1 Tax=Asticcacaulis sp. AC460 TaxID=1282360 RepID=V4PSL0_9CAUL  ali  2632.................GSFANVGTVSNVETITGNTLADDITLATTITAGVINLAGGTDVLTFAAGTNSATVSNVETITGDTGAETITLGTALANTMTVDLAAGTDTLILGAFANTGSLSNVENVTGGTLVDAVTLLTALGGTINLGTGADSLTLGNFANTGTVSNVETVTGGTAVDTITTGAALLATTINLGAGTDVLNLGNFANVVTVSNAETITGNAGIDTVTLGSALANTDAINLAGGLDILNLGNFANTGSVSNTETITGNALADDITLATAIAAGTINLAAGTDALTFGNFTNSATVSNVETITGGTGNDTVTTGAALTAATIDLVSGTDTLILGAFANSATVSNVDTLTGGSAADTIT---LATDASGMVINLNGGVDTLILGNFANTVTMSNVEVITGNAAVDAITLAAAITAGTVDLNAGNDVLNLGNFANTLTVTDVETLLGGTGIDTVTLGSVLANTDSINLAGGLDVLILGNFANTGTINNVETITGAAGVDTITLGTAITAGTIDLAGGADTLVFGNFVNSATVSNVETITGAANNETITIGAAVASATIDLAAGTDSLTFGNFANTATVSNAETLNGGTGIDTITLATTLTGMTLDLKAGADVLNLANLANTGTVSNVETITGNAAADVITLATAITGGVFNLAGGTDSLTLGNFANSATVSNTETINGGSLVDNITLGSQLTNTMVVNLKGGIDILNLGNFANTGTISGATINGNAGADIITLDTPLAAGTVDLGAGTDSLTLMSGVLNGVSVANVETVTGGSGIDTVTHTGTGAITFFGGGGGDTYYCGTGVDTAVLDDVTALMTVKNFRASGADKIALDVVGLGTYTANEFDIGGTSLIAGTNITSVNDYDAMLATSLSNGGKGAFVYQKDVGALYWDADGDFSAGATMIAVLQSSGTT................................................................. 3528
144 2.000e-22UniRef50_J9YWY3 Autotransporter-associated beta strand repeat protein n=1 Tax=alpha proteobacterium HIMB5 TaxID=859653 RepID=J9YWY3_9PROT  ali  452...TDTDGTTVANGATLKITDAVTIANEALTLNGTGVSNAGALQTTSSGTVLLTGSTTLGSDTTINIGNGNLRFDQAIASGSDSYDVTFTGNGGEIRTAGGININSGSVTMSASGTLFSETANSYSGGTTISSGSLLYGANDAFGTGAITMTGGKFYTTDATAYNINENLNIQGSIILGNTGASNATIFSGTNTLTGNASTTIQSSVSMAAIDDGSNSYNFSKLGSGTLTLTGSNGYDGTTTISAGTLTVTGTLDDNTAVTVSSGATYDVDASDTISSLAGAGTIDIASSQTLTVGNSSDQEISGTITGSGAFNKNGTGKLTLSGTGTDVGSIIISNGTIEVSGSLNSGSYSGNITNRSAIIFSSSSNQTISGNITREGTLTKNGSGILTLSGTNTYTGATTINSGTLTVSGTLSDNTAVTVASGAVYDVDASDTITSVDGAGTINIASSTTLTTGDTNDQELSGTVSGAGSLTKAGSGILTLSGTNSYSGNTTISAGTLLIRSQLGEGTYAGNISNSGDFGINSSSDQTLSGVISGSGTINKSGTGELTLTGANTFDGTINVAGGTLFAGTSGDSSNNITQGDIVVKGGTLGGGGVIGGDVSFTTTGGTLAPGNSI-GTLTVGGDLTLSADDTTEIEFNATSADKIVVNGNTTLAGTISLFPENTTYSDTSLTIVDASAGGTFTGTFATETMNNQSNLNGATWDIVYDTVGKTVKLDLTETTNSSKSIKDTTTINKFKKVATIFDDATTGKFKEIKDVLDSATVKSVNTELGKLKGTVLSSTYVQPTLNHNNFNRALNSITSSNVSTSLVSSFANHTGELTLASLQNAGLYGQKDKFNEYYDYSDISVLGFIKNNKNKSILDNFVSEDRASFIRTYGTTADRDNIGSSYTGYKSETTGILFGQQFKNDDVTFSGYSYGFTGTDTDYKNNYGESKTYSAHAS....................................... 1390
145 2.000e-22UniRef50_A0A257M4N0 Uncharacterized protein (Fragment) n=1 Tax=Verrucomicrobiales bacterium VVV1 TaxID=2015575 RepID=A0A257M4N0_9BACT  ali  22................................................................................................................................................................................................................................................................STSPGVVGLGTLSFTAGTSTLGDGAFASTLKLASTGGTANITATGGSTSGLTVSGGTINFDTGAFTAATLTLSSGTLGGTGQVNVTGAASITGAGTIAGSGTTTLLGATAFGGGILSTGRIVENGNGVAASTASWTAGSIQINSGAVLNNKVNSIFNASSTGTMSTASGVGNFNNAGVFNRSGVGTTTTITAAFNNSGTVNVDSGTLSIGSGTSSGLFDVDAGATLTLTATHAFSTSPGIVGLGTLGFSGGTPTISDGAFASTVKLASTGGTATITANGGSSAGLTVSGGTINFDTGSFTAATLTHSSGTLSGSGTLNVSGAATFNTTGTATLTGAGTTNLLGTTTFSGAGTTTVTTNRILNNGNGVAASTASWTAGSIQINSGASFNNTANAIFNASSTGTMSTTAGTAAFNNAGVFNRSGTGTTTITAPFNNSGTVNVDGGTLSLGGGTSTGLFDVDAGATLALTGSHVFSAGSSIAGSGSVSFISGSPSLGSATIAQTLTLVNSGATTTLTGGTVSVSSGSLTLNATTFNTGTLALTGGTLASTGTVNASGLATFNGTTTMSGTGTTNLLGGATFSGTGTTSIAINRTVNNGNGIAAVTANMTSGNLSVSGNFNNNANAIFNASGSTLSGNFNNIGTFNSSGSVTVGNFNNTGTVNVTSGTLTLGIGTSSGTFNLSTGSTLNVSSGNTFLGGTRFTGAGTLGLSGTVTFGTGVSTYDG.... 745
146 2.000e-22UniRef50_K2B6T1 YapH protein (Fragment) n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2B6T1_9ZZZZ  ali  11 1141....TLILSVANTYSGGTTLTNGTLQIVDGASLGTGTVNLNGGTFIAANTMTVANNFVIGGNAEIDSTSSALTLSGAGTFNSGATLTNSSAAGLTFDILGSLSGNGNIVQNAGTLSINS-----TNNNAYNGTITVNNGSTLAVENTAATNNALGAGTTVTITDGIFKINNNAVLTLNILNMGSASGSATLLTTTGAELTAPMNLAADSSVIININGIPSTTLIINKNIYGNANLAYVGTGTLVINGEVGKDQNNDPAPLQSINDTGFTGTIIYGGTDNITTGDQTYGASTPIILVADAKFISLNGNVYMAASIDGLHPLTFDTAGISVITGTIGGSTAVSSLNVTADGGILLGADITLNGNTAAFNSPVTLIGNPVVSDSGSINFNSTINSDSAATPR-SLTVISDTAVGLHGNIGSTIELNGLTVSGTTTIGSTAVNAESQNYNGSVNLNTSNINLTGDNITFVDVVNGSNAALQVNGSNIVFGDTVSINSLNAIGGTLNVNGGAITTVGSQVYDSTLALGNNTTLNLTGAGSKDVAITNGITGNKDLTISGSGSGSHNITINGNVAVNSLNIDAGAGSSNNTLSVEGGTIPTTWNINGINSGSIDADNISNTVGFNNIDNINGSTTGNTFIFTGNAALTGTVDGRAVNIGNTLDYTSYTGAVDVQLTAEHNGSISGTTFTNVDNLKGNGPDASIKLPNKANNAIVITDGGNGFINDPDNFTNFNTFVSQSGQDQVTFNAPVSAFSFNQATNTQTVVVNGVTMFFVNFGQLFGAPVPPSIVVPPTTIAGTGTAVTAGGFYVPSTTIIQGYASNYYYTYGDPYSIELLGFNNDTTFDITTDGTESSTPSWKNNVNNNMKTI....................................................................................................................... 1992
147 2.000e-22UniRef50_I9KXF4 Uncharacterized protein (Fragment) n=1 Tax=Ralstonia sp. PBA TaxID=795666 RepID=I9KXF4_9RALS  ali  11  902.........SLTGGVMTGDVNLGDGTNSATVDGGTLNGNINGGIGNDTVSIISGTVTGDITLGDGADSFSMTGGTLNGNVDMGAGDDTVTLGGGTRTGTITMGTGNDTFTLLAGDLTGDVVMGDGNDGFNVAGGTVTGNGNGDDTVSLTNGTITGNIDLGDGNDSYTQSGGTLNGDVLGGSGNDTATLSGGTLNGNVDLGVGDDIFNFSGGTLTGSLDMGTGNDTVNVSGGVLTSNLTLGDGNDAVNITNGTVNGNLDMGLGTDTLTMSGGALNGNADGDGNDTVTLNGGVMTGDVALGAGDDTMTVGGGTLNGNVTGGTGNDSVSISAGAINGNVDLGNETETFALSGGAMNGNVISGAGNDTATISGGTMTGDLLLGDGDNTVTQSNGTLNGNVVLGGGVTLSGGTLNGNVSTGAGNDTVDLTGTVMTGTLDLGAGDDVATVNGGTLNGPLNGGTGNDTVNLLSGAINGDVNLGNETETFTMAGGTMTGNVISGAGNDTATITGGTMTGNLLLGDGDNTVTQSSGTLNGNVVLGSGTDAVTLSGGALNGNIATGAGNDTVDLTGGALTGSINLGDGDDVATVDGVTMNGNI-QAGAGNDTVNLLSGSVTGTVALGDGNDTATLNGATVTGDLLAGAGNDTVTLQSGTLNGTVNLGGGSDTLALSGATVNGNVLAGGGNDTVNLTAGTVSGNIDMGDGNDA....................................................................................................................................................................................................................................................................................... 1600
148 2.000e-22UniRef50_V5YNL8 Uncharacterized protein n=1 Tax=Burkholderia sp. M701 TaxID=326454 RepID=V5YNL8_9BURK  ali  1708.........VTVSSGGDASATSVTGSGSLTVSSGGSMTSGAVNDGGSVTXXXXXXXXXXXXNSGGSLTEQNGGSAVSTTVNSSGVENVDGGTTTSTTVNDGGSQVINSGGSANDTTVNSGGSVTVNSGGVASGTTVNDGGSVTVSSGGEAISTTLSSGGSQTVDSGGSAVGTVVDSGGSQTVSSGGSATGTTVGTGGSQTVSSGGETSGTTVGSGGNSSGGSSNDTTISGGGNEIVSSGGFASGTVVNSGGSLTELSGGSAVSTTVNSSGVENVDGGTATSTTVNDGGSQTVENGGSAVSTTVSSGGVQQVSAGGSAMSTTLNGGSAVVSSGGVISGAIVNSGGLLTDQPGGSSLDTTVNSSGVEDVKGGADTSTTVNSGGSQTVENGGTATSATISAGGSAIIGSGGTEVSATVGGTDTVSSGGVASATKVDSGGVENVDGGSATSTTVTSGGSQTIENGGSATSTTIAAGGSATVGNSGTEVSATVGGTDTVSSGGLASATTVNSGGTLVEQSGGSATSTTVNSSGVENVDGGTATSTTVNDSGSQTVENGGSAVSTTVSSGGVQQVSAGGSAMSTTLNGGSAVVSSGGVISGAIVNSGGLLTDQPGGSSLDTTVNSSGVEDVKGGADTSTTVNSGGSQTVENGGTATSAT........................................................................................................................................................................................................................................................................................................................................ 2354
149 2.000e-22UniRef50_A0A0F3PF11 Outer membrane autotransporter barrel domain protein n=26 Tax=Rickettsia TaxID=780 RepID=A0A0F3PF11_RICRH  ali  10 1652........TATLGGAVIKATTTKLTDAASVLTLTNANAVLTGAVDNTTGDDNVGVLNLNGALSQVTGNIGNTNSLATISVGAGTATLGGAVIKATTTDLTDAASAVTFTNPVVVTGAIDNTGNANNGIATFTGNSTVTGNIGNTAALATVNVGAGLLQVQGGVVKANAINLTDNASAVTFTNPVVVTGAIDNTGNANNGIATFTGNSTVTGNIGNTAALATVNVGAGITLQAGGSLAANNIDFGVGSTLEFNGPLDGGGNTIPYYFKGAIANGNNAILNVNTKSLTAYHSTIGTVAEINIGAGNFFAIDASADDVTILNAQAINFGVPDSALVLSNLTGVEVKNILLAADLVAPGANGGYVVFNGGVNGLNIGSNVAGTARNIGDGGGDKFNTLLIYNAVTITDDVNLEGIQNVHINNNAAFTSSTAFNAGAIQINDAT----YTIDANNGNLNVPAGNIQFAHANAQLILQNTSGNDRTITLGANIDPDNDDEGIVTLNSVTAGKKLTIAGGKMLGGAHKLHTIVFKGAGDFGAAGTTFNTTNIVLDTTGRLELGATTANVVLLNDAIQTQTGGNIGGFLDFNAKNGTVTLNNNVNVAGAVQNTGGTNNGTLIVLGASNLNSVNGIAMLKVGAGNVTIAKGGDVKIGEIQGTGTNTLTLPANFNLTGSINKTGGQALKLNFTNGGSVSGVVGTAANLVGDITTAGATSFVSSVNAKGTATLGGTTSFADTFTNTGAVTLAKGSITNFAKNVTATSFVANSATINFGNSLAFNSNITGSGTTLTLGANQVTYTAGTGSFTDTLTLNTTFDGAAKSGGNILIKSGSTLDLSGVSTLALVVTATNFDINNISPDTKYTVISAETVGGLKPTPEENVKITINNDNHFVDFTFDASTLTLFAEDIAADVIDEAFEPGGPLANIPNAANIKKSLELMENAPNGSDARQAFNN.................................. 2587
150 2.000e-22UniRef50_A0A099VLB9 Uncharacterized protein (Fragment) n=2 Tax=Helicobacter trogontum TaxID=50960 RepID=A0A099VLB9_9HELI  ali  13  38.........................................................NSKNDRSSDTFYSNNMGTTWTSSLWGRSFTQNYQNGTLIIGNSSKSP-TNNRHWFGRGGDIGFINASFNAKEVYVTGTLGTGNSWRTGGGANTQNSTTALNGKEIDIKNSQFNIENINGGGINIGNEKTENLTIDNTNISMSGGQINITA----KNSKLNFGSVNITNGTLDLTKANYTELTTHSLNITNSSFRSKELNMSGDIVNGRFTPTQTLVHGAGFRQSLGNGRDFTANSITIDNGSSTLDATNATIKELNFKGPSTIFGSTQKKLTATISG------KLNITTLTNPYQPFGKGFTAELEVKQASEV-NIENIHHQNYTGGSWIHVN------VDNKLVVGNIQFATDGIAGSSARVDLSSKSDVIVQNV----------------GGCEWACTGASGIRPLNTLKISGQNFYGGNIEAIGLPTAGSNSTLDLTGVTGTNFIDTFGIRTGTLKAKNFHVNNFNVWKSNSH-----SVVDQDIGKSFINYLSMEIGTSHTSDGADFTGGGNILNFNLIDARPTSFVRMNGDKKIEHVNVNIMNIKEAEVNLHNAIFNTIVSQKGQTAITNGASKITANALNINELLHIKDSSKHSGVMNIELNGNEAVNQDFSKYLNVSVDSKDLKNMSGSEIAEIIKKAEANGGNNGGKKEDYQNASGTYITTSDGKHY......................................................................................................................................................................................................................................................... 702
151 2.000e-22UniRef50_C0KTT7 VacA cytoxin (Fragment) n=1 Tax=Helicobacter pylori TaxID=210 RepID=C0KTT7_HELPX  ali  95  2............................................................................................DGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDSADRTTRVNFDAKNILFDNFVEINNRVGSGAGRKT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 91
152 2.000e-22UniRef50_Q17WG5 Vacuolating cytotoxin 8 n=3 Tax=Helicobacter acinonychis TaxID=212 RepID=Q17WG5_HELAH  ali  65  1...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MQGVSYDAVFASNANLQEQFKECLALYNNNTRMGICVAQKGNTNGIKACGMAIGNHDMNSNPNHYKYLEGKAWKNTGISQTANNAKTSVRLGNNSMPSGHDNNAAN................................................................................................................................................................ 106
153 3.000e-22UniRef50_UPI00094D38C8 hypothetical protein n=1 Tax=Pelagibacter ubique TaxID=198252 RepID=UPI00094D38C8  ali  11  51..........................................................................................................................................TDGFVNIDGDIKAPFTFNITGGTYRLDTYVDASNPNTITKTGDGTLVFMDTNISDFSASTIISAGTVSVSSDNTLGTGSIILNGGSLSSFNTTARTLANAIQVQNSST-LGNSTNSGVLTLSGGITFTDKNFTLTSNSNNSISNIDLGSDPNTLSVSSGVTSTVTGAVSNGTLTKSGAGTLVLSGTNTYDGGTVISAGILEIQGQLDSGNYTNTISNSGQLTINSSSNQTLAGTISGTGILAKTGSGTLTLTGTNTYSGQTTIEGGTVVASNSSSLGAEPDSATNNNIVLNNGTLQTTNSIVVGSGGTINTDASTTLSYGGIISQNGPLTKTGDGTLVLSGTNTYTGATTVNDGTLTVTGSLSNSTAVSVASGATYDVDASDTVASIEGAGTIDIASSQTLTAGDATNKTFSGVIQGSGGLTKTGTGTLTLSGTNTYTGDTTISQGGITVEGQLESGNYDGAIANSGTFTINSSSNQTLAGVISGTGALNKSGSGTLTLSGTNTYSGSTTITNGTISVSSSANLGATPGSADGDNIIFNGGTLSATNDFTLGTNKGITLTGNGTIDVASSNTMTFDGIITDSGNLTKSGSGTLVLGGANQNDGTITVNAGILEISNQYSLGTDTNGTTIADGATLKITDGITIANEALVLNGTGVSGAGTTNSSGIVLLTGSTTLGSDTTINIGNSNLRFDQAIASGSDSYDLTFTGNSGIRTAGGININSGSVSMSASGTLFSETSNTYSGGTSISSGSLLYGADDAFGTGAITMTGGKFYTTDATAYNINENLNLQSSIILGNTGASNATTFSGTNTLTGNTSATIQSSVSMAAIDDGSNS.......... 895
154 3.000e-22UniRef50_A0A1E4YGX4 Uncharacterized protein n=4 Tax=Rhizobiales TaxID=356 RepID=A0A1E4YGX4_9RHIZ  ali  2622................TTAVGGTVGGNSNSINVLGTGVFLSLTSGTGNVVSMSGGTLTMSGVSQSATLNGNSNTIREQGKATITSSGTGDTLSVTGTGNTATLNGGTVNVGNSTTAGTLTLNGNNFSITEQGTASGVVTNGTGITLDIIGANDSATLSNGSVTIEAGITATVTGGSNNVVVNATDNVTLNGSSDVIDIRGSNAIVTTTGSSLTVESGLGSVTIGGNSDSITALGAGANIGYTGTGDTITISGGTVRSGIGASTTIVGNSNSIMESGTAAVSSTGTGNILSVTGTGNTATLNGGTIVVGTSSTAGAVTLTGDNFVVTEQGTGSSVITSGAGISVDVKGAAETATVTSGTVTLESGVTGATVKGNSNAITALGTGSSLSVGGTGDTIAMTSGTLNIAAGASGTINGNSDIINEIGTGTVTSTGTGDTLNVTGAGNAATLNGGTVVVGTTTTAGSVTLTGNNFAITEQGTSSGVVTSGTGITLDVKGTTNTATVSNGSVTIEAGATETITGASNAINDKAAGSLTVSGSGNTIDVTTSGAHAISASSDTVKLEASANATITGNNDLIVLASNNTVTAAGTNETYSFGSGAGQGTIGASTGTNTGIVDFGANLTDENLWFIQSGNNLKIDILGSSDSLTINDWFGGTPAKNVQSFATTDGLKLDSQVAQLVSAMATYSANNSGFNPTSATQMPTDSTLQNAIAAA.............................................................................................................................................................................................................................................................................. 3316
155 3.000e-22UniRef50_A0A1Z4K698 Filamentous hemagglutinin family outer membrane protein n=1 Tax=Calothrix brevissima NIES-22 TaxID=1973478 RepID=A0A1Z4K698_9CYAN  ali  11  36......ITPAVDSTNTIVTPNGNQLDISGGTLSGDKANLFHSFQQFGLDNNQIANFLNVHNILGRVVGGDPSIINGLIQVTGGNSNLFLLNPAGFMFGANASLNVPADFTVSTANAIGIGGNWFQASGNNNYAALIGNPTSFSFNTSQPGSIINLGNLTVNAGNLNLLGGTVVSTGQLSAPAGNITVASVPGQNLIRISQAGHLLSLEIPANAAVSGNVSVASLPKLLTGRGTANNQSLTVNNGQVQLAASGIPVNAGDVAVTGVTAKTATLNAAQNLILPESQLRTTGDLNLLAKNTVLARDTVANPFLAQAGGNLYIQGNQSIDIFALNHPQTPFVSGNNLSLVSDGNVSGDAHFRSGGQFSIRNLSGGAGNFVSYFDPIITANSDVFGNYTGAALKIETTGSVKGGNITITSADTSANIPANDPDFTELTTSRALIVRAGLNSVTGDNIPSNQGGTTFKLPAPPLNLADGSIEVGNINTSTTTNGENGGGITLSTDKATGAIATGSLNSSATNGNGGQISLTTTGGSITIGNSINSSANTAGGNISFNGAVNLGGSATSITTGSGTGNISFNSTINGAEDLTLNAGTGNITLGGAVGGTTALTGLSLTAANTNIASNISTTGNQQFTSPVTLTGGGSKTFNSNNSNISFSNTINGGSNLTLNAGTGNITLGGAVGGTTALTGLSLTAANTNIASNISTTGNQQFTSPVTLTGGGSKTFNSNNSNITFDNTIDGASNLTLNAGTGNITLGGLVGSITPLSSLNLVFSNINFPGNLDVTGDLIDNPVNLTSATNTFKADNITFNSTVDGNSNLTLNAITNISFNAAVGGTTALTGLSVTATNTNIASNITTTGNQQFNSSVTLTGGGSKLFNSNNSNISFSNSINGASNLTLNAGTGNITLGGAVGGTTQLTGLSLTAVNTNVASNIRTTGNQQFTSPVTLTGGNNQTFNANNSNIT....................... 992
156 4.000e-22UniRef50_A0A2V3WD55 Hemolysin type calcium-binding protein (Fragment) n=1 Tax=Nitrosomonas sp. Nm84 TaxID=200124 RepID=A0A2V3WD55_9PROT  ali  10  977..ITTKDTLVAAGAVLTLQATSMTSGVLTFNGAAETDGTFNITGGGANDAITGSSGNDILAGGNGNDSITAGLGSDTLTGGAGNDTFTFAAATGLTSADVVDGGAGTDTVALTGNIAFTATNDFDDVQNIEAITLGN-----TNTAVTITTQDTLVAVGAILTLSNAANSGVLTFNGSAETDGNFTITGGAGNDSMISGAGNNIFVGNAGDDTFTFIAGTGLTTDTINGGTGTDTVTLTGTTAISATQFNNVSNIEAIILPELTNTAVTITTVNALVAAAATLTLSNAANSGVLTFNGAAEADGTFNITGGSGNDSIIGGSGNDTLAGGDGNDSVTAGLGNDTLSGGADNDTFTLTAGAGLTSADNVDGGAGADIVALTGNTAVAATNFNNARNIETITANTTTNVAITTLDTLVAAGAILTLQATSLTTGVLTFNGAAETDGTFNITGGGANDSITG--SSGNDTLAGGNGNDSIIAGSGNDTLSGGAGNDTLRFSVVTGLASADVVDGGAGTDTVALTGNTAFTAAN-----DFDNVQNIETITIGNTNTAVTITTQNTLVAAGAILTLSNAANSGVLTFNGVAETDGAFTITGGTGNDNITGGSGNDTVSGGTGNDTLVGGAGNDSMTSGAGNDNITGGAGADTIPLGSSANDNTRQTVIYSAASDGAAAGANSGADSITQFDANANTATDDLIQVSGALKTLLDDDGDGMLDYSTSNSADLGNQAIVGGANQEATVLLDAEIELALADFTAVGLANVITELGEEIDFTGIATGEEHLFAINFSATQTAMVLYTAGSGGDDTLVATDIQVLGIVTHNDGTGLVAGNVTF..................................................................................................................................................... 1795
157 4.000e-22UniRef50_Q8KS18 Vacuolating cytotoxin (Fragment) n=1 Tax=Helicobacter pylori TaxID=210 RepID=Q8KS18_HELPX  ali  68  1..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RDGQVATLNVGNAAAMFFNNNVDSATGFYQPLMKINSAQDLIKNKEHVLLKAKII-----GYGNVSTGTNSISNVNLIEQFKERLALYNNNNRMDICVVR--NTDDIKACGTAIGNQSMVNNPDNYKYLIGKAWKNIGISKTANGSKISVHYLGNSTPTEKGGNTTDLPTNTTNNARSANNALAQNAPFAQPSA..................................................................................................................................... 187
158 4.000e-22UniRef50_Q71SN5 p167 n=4 Tax=Helicobacter bilis TaxID=37372 RepID=Q71SN5_9HELI  ali  14  32.........................................................NSKNDSSSDTFYSNNMGTTYTGLAWGRDFTQSYENGTLIIGNTSKSPTSNG-HWFGRGGDVGFINGTFNAKEVYITGTLGSGNAARTGGGANTQNSTTALNGKEIDIKNSQFNIENINGGGINIGNEKTENLTIDNTNISMSGGQINITA----KNSKLNFGSVNITNGTLDLTKANYTELTTHSLNITNSSFRSNELNMSGDIVNGRFTPTQTLAHGAGFRQSLGNGGDFTADSITIDDGSSTLNATNATIKELNFKGPSTIFGSTQKKLTATISG------KLNITTLTNPYQPFGKGFAAELEVKQASEV-NIDNIHHQNYTGGSWIHVN------VDNKLVVGNIQFATDGILGSQGHVELKSSN---------------GDVIVKNAAGCGNACTGGLGIRPLNFLKISGKNFYGGNIEAIGLPTAGSNSTLDLTGVSGTKFIDTFSIRTGTLQAKDFHVNNFIVYKS----NSYSVVDQNIG-KSFINYLSMEIGTSDFADGADFNGGGEILNFNFIDARPTSFVRMGEIKHVNVNEMKIKEAEVNIKNG---IFNTIVSQKGQTAITNGASKITANALNVNELLHLKDSSKHSGVMKIELNANGNIDQKFDKYLNVSVDSKDLKNMSGDEIAKLIESNKNTNGNNEKTESDYKNASGTYITTSDGKHY......................................................................................................................................................................................................................................................... 690
159 5.000e-22UniRef50_UPI0004709273 filamentous hemagglutinin family N-terminal domain-containing protein n=1 Tax=Burkholderia sp. WSM2230 TaxID=944435 RepID=UPI0  ali  10  90.........................................................NSFNVATGNTVQFNQPNAQAQALNRVTGGMPSNIQGSLLANGQVLIQNANGVLFSKGAVVNVGSATTKSIDANQFMAGGPLQLSSTGTNASVVNDGSIQAQGYVTLMGDQVRNSGTITTAPGGQVVLAAGDSATVALPNGQGIQLTLTNATANALVENSGTINAQNGTVLLTARGSNTLLNTVVNLSGVVRAGTVVADAGNTGDVAVTGKIDASNNAAGGVGGTVVLSGDRVGVFGNASVDVSGDAAGGKVIIGGDSLHQLAGTQAADMLQDGVNFANYTQVDSGASIKADSAHGNGGFVETSGHSLDVQGAVSAAAPNGKAGQWLIDPTDVTISTGADANYSGNVSGGTFSGGSNTSATVKNTTISNALSGGADVTITTASSGTATGNIVQQAGADIMKTGGGAATLTML-ANGSIQLNGNITTTSNALNLNLTADMSGNHNGSATLQGANTDLGGGTLTMSGNVVNGNGLAGVNAVYLNGNQANIGGGSITGHATTGDGVGIAGYMTKTGLGTLTLSGSSVSGDGVRFDQNSHLVQTGGTINAVGTSNSGIGVQFGRAGYNGQARVDVSNNAILNLN---GASTTGTGVSMGADLYSIASNSFNISDSAVINVVGTSSEAYGVLGYATQVNAQDNGKFNVNGTSANGTGASFYSGGAPVDFNVSGNAAVSVSGTSTNGTGASLTLNGNVSGDSAITVSGTSTNGTGASLTLNGNVSGDSAITVSGTSTNGSAAYIGGTTNFSQNATMDVNGTSTNGYGVQKQANWNESDNAQINVAGTSSTSMGGTNVTDSATLNISGVSNTGAGAWFALGSVVDISGNGAVNVNGQSNTSAGVVIRANDISVTDNGTLSVQGNSTSGAGVLQNGTSSINTSGNGEISIAGSSANGSGVDLNTGSINTAGNGTTNISGTSAN.......... 1006
160 6.000e-22UniRef50_A0A258AIU1 Uncharacterized protein (Fragment) n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AIU1_9BACT  ali  1............................................................................................................................INVGQIAEGSPNILNVGALTTGSSVSSITINVTTSSPSGYTNGTPYTLLTYTGGSILGTAGFSAFTIGSIAGTNTRTAGFLTDTGSSITLTLNADNPVWTGFDTTTGLASSRWAPSDTFLLDWKLINAGSPTAYLEGDVVLFDDSAVGSKTVDISEGDVQPSSVTFNNSSVVPYFITGSNGIAGSANFIKSNTGTVTISNANSFTGGIILNGGVIQLGNALALGTTNGLLFGANVAAGTKLQLNSNSITLTGLNTNATPGSAVVENGGASDVTLTLDLQTIGGPLSGEPVSVFAGVLQNGSTGKLALTMTGDGSLTLTGASTYTGLTTISGGTLRIGSGGTTGSIVGMGGIMNNGALIFNRSDAYNYTGSITGTGTTQISGGGTLTLTGSLGSTGGTTIDAASTLTVGDGGADGSISGNILDNGALKFNTNSTG---------LLVSGSITGSGTLENIAGVTILTGTNSFGSGSSTTITGGTLQIGNGGTTGSITGNILDNGVLAFSRSDNSTFAGDISGSGSVLINMASSSAIKTLSGNNSYGGGVTIAQGVMALGSATAVPAGSSVIIGGAITSGTLDLNGFNLSVSALATAGTAASQTITNNSATSNSVLTYDSAAPSTFGGLISNGASRNISLVITGGGTLTLASTNAFTGGVSVLNGTSRLGADGALGTGAITLGTTGFDGVLDLNGFSQTVSSLSVGAGAVAASQIIGNSSTTADGFLTINGTSTFGGLIQDVLGSGTFKTGLIIASGTTTLTNANTYTGTTQINSGATLQLGNGGTTGSLSNGTVITDNGSLSFNRSDLVTFGATVSGSGGLQQVGSGTLNLTGANSYNGLTVMNNAAGTLRTSGTN.. 846
161 6.000e-22UniRef50_A0A099V9L1 Uncharacterized protein n=2 Tax=Helicobacter bilis TaxID=37372 RepID=A0A099V9L1_9HELI  ali  16  86...................................................................................................................................................................................................................................CDWFWCHLGGGATSDTLHIANGNQSGSFTFTSIDLRTNNGSVDLNIKSEKPWEGKITIHDIYTSHTGVVGFNGNVNINVDTKIGGLAHN-NKGGGTRLNVVVGADNGAYKKNLHIDRVSFNQNGLAGSQGVINLYANNINIGKAAGRLSQVLNVNADGSIVADDVYFDVIPKSEIKFNAKEGGFISQSGHSNIFVNTKKDIVVGNVGFAVDICITQACDVIVKSVTGGTANESGIGSFNTLQIKGNNFYAGKVEAISLVTSLNNSYLDLTGVKNTTFIDDLQFRNGTLKAKNFHFNNFTVWKANANGSAYTTVSENIG-KSFINNLSMEIGTSHTADSAALWGGGDILNINFVAARPTSYINFGDIKQVNINELSAMEADIYMKTG---IFNTITNKKGQTIITNGASKIVANALNVNELLHIKDSSKHSGVMNIELNGNEEVKQDFDKYLKVSADSKDLKNMSADEIKKLIESSKSQNNNTSGNTADYQNASGTYVTTSDGKHY......................................................................................................................................................................................................................................................... 623
162 7.000e-22UniRef50_A0A1L3RYZ8 Hemagglutinin-related protein n=2 Tax=Granulibacter bethesdensis TaxID=364410 RepID=A0A1L3RYZ8_9PROT  ali  1....................................................................................................................................................................................................................................MTTLTSTSSGVTLTTAFSNPILILAGTTVANTSGIGIQSSLSTAWSITNSGAITGTTMGVSLAGSSTINNAGLISGGTYGIVFANTGTLTNLSGGTISAGTIGVLATDAAFISNGSGGTIIGSGYAAVSLNNGGTVYNAGLMRGRYAVEVRNAAGTIVNTGTISGDTNPTYNDGVYLYQGGYVTNNGTASLIRGDFASGSSSGTVVNQGTIVSGQYGINIGGNASITNSGTISATSASGNAILLNSTGTVTNLASGVISGVTAGIAAGGLVTVDNAGTIQVTGSGGQAILGTAGGIVTNRSGGTISGSFNAVSVYAGSIGTVINAGLITDNGGTLAAAHGVYLGNTSSDYVNNSGTILETGTGAGAGDLAAVRLGNGGTVVNSGSIGVSNSLATGVRVDVGGTITNYGTISAAGTANVSNGAGAAVYMSGTGVNLLRIGVTSTITGTAVANSAGANTLELLSGATAGTVNGSNFVNFQTGTVDAGAAWTLSGVSSFANLRDSGTLTNTGTINGANVTLLNGGLLTNAAGATIIGSGNTLIASDTVNATVVNAGSIISNGPNPYAILISGNVTNLAGGLIQALPSNGYGAQVTNGTVSNAGVITGGTATGGAAVVLAGTSGVVSNTGTLSSSGGWGIYATTSTVATITNSGLISGGTYGISLGNTGTISNQAGGTISAANNYAIFVAGTGAVISNAGSINNGTASGINAGTNGTFTNSGRLTSVNDAVNGTNAILINTGTIISSSTSLSGAYLA 757
163 1.000e-21UniRef50_A0A2S9MG96 Uncharacterized protein (Fragment) n=4 Tax=Burkholderia cepacia complex TaxID=87882 RepID=A0A2S9MG96_9BURK  ali  10  30................................................................................................................................................................................GAGVIPADALAACTGAPTVTCTGATTNYVSSINGLNVTVAPGATVSVVPLLGGTAMSLTGSGVTLINNGTIDPSLGGLSAVSNGAVVGNVSSASTVNVTNSSTGVMMGSTSGVLANGPALTVYNGVGGTTNITNAGTIGTTGILGFGAGPTAQVVTASGGAQVNFTNASGGKINGSVVLAPSAVAGTGNTFTNAGTITGNVSLGAAAGASNTFNALTGSSVGLGVDAGAGLGGSNTLNLQLNTASGSAANGAIAVDTFANFNHLAVQGGTWDITGASTATDASLTGGGTGALGTGTIVAGGGTLEAGAAGVNLLNDVTLNGGLNGGLTVDGANGLALSGAIGGSGALNVNGTGTLALNGANSFTGGTNLTGGGGIVVGTGAALGTGALNVTGAGGALGTSVGGTVLGNAINLDPNVTLGLNGSANLGLGGVIGGSGSLAQTGTGTTTLTGVNTFTGGTTLSGGGLIAGNGAALGAGALHVSGAGGSLATNASGTLLGNAVNLDAGATLGLNGAADLSLGGAIGGNGSVAQTGAGTTTLLGANTFSGGTTLSGGGLVAGSGAALGTGALNVAGTGGTLATNAAGTLLGNAVNLGAGATLGLNGSADLSLGGAIGGSGSLAQTGAGTTTLLGANTFSGGTTLGAGGLVAGNAAALGTGALNVIGAGGSLATNASGTVLGNAVNLGAGATLGLNGAADLGLSGAISGAGGLALGGTGATTLSGANTFTGGASLTGGGSLIVEGGSALGVGGALNVSGLGGSLSADLAAGSLANAINLNGASLTLNGAH.................... 820
164 1.000e-21UniRef50_A0A1C0V3W1 Uncharacterized protein (Fragment) n=1 Tax=Oscillatoriales cyanobacterium USR001 TaxID=1880991 RepID=A0A1C0V3W1_9CYAN  ali  141.....................................................................NVPASFTATTATGIGFGQNIFQAIGNNNWASLVGNPSAFYFPLQPGSIINAGNLAVSPGENISLIGGNVINTGSISAPGGNINIAAIPGKNLIRISQEGHLLNLEIGSHFWDRENGVKPANISELLTGSQLNNATGLAVLGDGSVELTATGITVPTTGGTTIVSGNLNADGNRGGQINVFGNQVGLIGAKVSANGIFGGGTVLIGGDYRGLGIVPNADRTFVSADSMINANAIDSGNGGNVIIWADEITRFYGNITATG----------VVSGGFAEVSGKKLLDYQGLVDLRSLSGQVGTLLLDPTDITISTAANSPTISNANGTFSDPTTSSSNLNTTTLQNQLGLSNV-----VVTTASGLSALGNITVSSPIAWNSSNSLTLTANNDITTNSSIVNSGNGAIALQANNSILVNANITSQGGGILLNADRDASSVGAIAIANSTISSNGGNIALGGGNNPLTSAAVGTSTNPDGVSISNSTINAGSGGISIIGTGGINSGVGGSGIVISNTSTLQTTSSGNIIMQGTGSTGNSTNSGIKIDGANTTITSVNGNIQLTGTGAGSNQGIGITIGNSTVKSTGSGNITLTGNGSTTSSAGVGINLEQSTLSAEGSGSLTLTGTGGNNATGINLSNSLINPTGGSGNIILTADEIDLIGNTTIAGNGTLKLQPLTPSLAMTIGQTVSDTSLNINSSELATIQPGFSQITIGRSDSSGAIAILGNVSFANPITIQAPGSGGSITNTSGNLTAGNITGSGNATITLNANQNITIGNITNSGRGITITSASGNINSSTGNLNTSSTTGNGGAISLTANNGINAGVINSNTSSATAATAGAVTLNSTSGNITLNGNINTSAVTGTGGNITLSGSTILAQSATELTTTGTTGSGSITVSGTLNGTTANTNNL...... 1031
165 2.000e-21UniRef50_F8L934 Polymorphic outer membrane protein B n=2 Tax=Simkania negevensis TaxID=83561 RepID=F8L934_SIMNZ  ali  1463......................................................TGGNTYSGGTTVTAGTLQGDVTSLQGPITNNGVVVFDQSSDGTYAGVMTGSGNLTKIGTAKLTLTGASTYSGGTTVTEGILQGDTGSL---QGNIGNNGEVIFDQGSDGTYIGKMSGTGSLTKNGASTLTLSGANIYSGGTTVSAGTLQGTTTSLQGSIVNDSSVIFNQSTDGTYAGIISGGGSLTKLGSGTVILTGANSYSGGTTVIAGTLQCNSGSLSGDTLNNAAVVFNQTSDGTYVGVISGSGSLTKIGTAKLTLTGGNTYSGGTTVSAGTLQGDVTSLQGSMINNAAVIFDQASDGTYAGVMSGSGNLMKIGTAKLTLSGANTYSGGTTVSLGTLQGDTGSLQGNIGNNTTVIFDQGSDGTYTGKMSGTGSLTKEGAGMLTLTGANTYSGGTTVSEGILQGTTTSLQGPVTNDTMVIFNQSTDGTYAGIISGAGSLTKLGSGKVVLTGENTYSGGTTVTAGTLQCNSGSIPGNTLNNAAVVFDQGSDGTYVGVISGSGSLTKIGTAKLTLTGANTYSGGTTVSAGTLQGDVTSLQGSITNNALVIFDQASDGTYVSKISGSGNLTKMGTSKLTLTGENTYSGGTTVTAGTLQGDTGSLQGNIANNAAVIFDQGSDGTYASKMTGSGSLTKKGVGTLILTEANTYSGGTTIEEGTLQGTTTSLQGPIANNTTIVGMVGSYANFISGSGDLIKKGLGVVTLSGDNIYTGKTTVSLGVLNITGSIAGSMTEVQSGAALHVNGEVKSPITTISVGGLLKGSGKLQTVDNSGIVWPGNSIGTLTVVGNYTQNANGRLLNELNSLGDTDLLIVTGTANLAGALTILPHPGVYPAGLEYTFMTYASRNGNLNLTDITSLGFSIVYHPTFAVLTNSNQG................................................... 2338
166 3.000e-21UniRef50_A0A248JW06 Uncharacterized protein n=1 Tax=Nitrospirillum amazonense CBAmc TaxID=1441467 RepID=A0A248JW06_9PROT  ali  10  22........................................................................................................................GASALAIGVGLAAPKSAWASACGSFSTSSTIGSAAHCTAFTWTGTVGTVINNGTLVGNNTGTSSTGFSIQGGKTLTAFFNNNLIGGTGTTGGIAAIVLTGTPTYTTTSGTISYGISAYTTIGTFVNNAAGLIQSDGGYGAIRMMNGVKVGGFTNDGTILANGNSALNLTGVSIGTLTNSGYIYSSVGGAIDVDVITTISTVGTIINSGMLRGNSGGTGAVNVFGVVGSVNNTGTILNDSGPGVEVRNYGGFGPTAIYHSHVGQDGTLSTLTNSGLISGTTGVSIGAGGSIVNLTNTSIGTIQGGIVITSGNASVTHNGYLGTLANNGVIIGSIATGGLIGTLINTGTISATGNAISIGTSGTIAGLNNGGVISGNIVNNSANTFSITGGTGTVLGTFTGASGKGSIINTLSNIVITGGNLFLNDNINVGSGTLISQGTNLTIAAGSTITGNYYNTLSTNTLTTSGLTVTGRVTLITGTIVPSFSSAGNYIVGTAASLIYSPTGISNLGSAFATVQAPTGAHFSNIGASGTTLIYYNPLMDYVGGAVASVSVGSTVLNGTSTIYPTALYIASTGSLGTLTNSGTIRGNIVNLSANDLSIRGGTLTTIGTLTGYSGSIGTITNTTSNVVLVSGNLRINDVINVGTNTLVNNGANVTFGTLGTISLTGNFAQTSTLGTLSLGTNLLSISGAASIAGTVLSNFTTTVNHTVGEAITLISADGGLSLGTLTGVVSSSGTGINVTGTTVGNYLLAMVQNYYIAGTYGTITNTGTLTAASAVYVASTGTLGAVSNTGVIQGSIVNNSVRDLTLIGGTGATYGTFTGVTGTAVGSIVNTASNVTLS....................... 865
167 3.000e-21UniRef50_O87485 Vacuolating toxin (Fragment) n=11 Tax=Helicobacter pylori TaxID=210 RepID=O87485_HELPX  ali  91  1...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SVFELANRSEDIDTLYAHSGAQGRDLLQTLLIDSHNAGYARTMIDATSANEITKQLNTATDALNNIASLEHKTSGLQTLSLSNAMILNSRLVNLSRRHTNNIDSFAQRLQALKDQRFA 118
168 4.000e-21UniRef50_UPI0009A9B37B S-layer family protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009A9B37B  ali  235.......ATLNATTANLSGISTNAGTGFTLNNVTLAGGIEKGKNVSFSSAGSGKAVTNVIGSGVLNATTTEALMKVGIENNTQISASGITLGGSGDDWTQNYTSTKGGGWIFDGATVSKTGNISLQGVGFVNSSVTAGQDLTINNGDTSLTVQNTTLNATAGNISLTGNAGITLSGNSTVTAGKDITLNVSAGGVNITGISSTAGNITFTANNPGAGDVTGINLQFVNVSVGGNGRIELNSTVHNGSLRAKGIALDSVNLTTGGGNVSVTAVSNGTAVYGKEVVITSGDSINVTTSGKSSGYSYASSNFVNSSFTAKNNISFTATDKEDAGKPMQAALGFYGNTAFNATDTVLKGHHTNPGGVGNFGSIGVALGANAGSGTGNIVVNGNLSVDGSVMDSGAGVTVGANMTVSGTTDIKGHSATGKGVSFTTSMDYAPTPVNLTINISGGGSISGTSDTGIGLLNGNKNNVINITTGTGNALTLTGNSTSSTGVQLDGTVNAAQGDLTVNGSSGNGTGVDASGASLNNATIHGNSTSGAGVNVSESTLNNVTVNGSTANGTGVDITGNLTSTGSTTVNGNATGMGSGVDLAGNVTGGTVNGSSTDGTGVNVSGNSTLTDVTVNGNTTSGTGVDISGNLTNQGNTTITGNSGSGAGVGLNGTVTGGSLVGNSVSGPGLYVTGNSTLNGVDVTDSSQSGPGTQ......................................................................................................................................................................................................................................................................................... 935
169 4.000e-21UniRef50_UPI000DEBF421 UPI000DEBF421 related cluster n=1 Tax=unknown TaxID= RepID=UPI000DEBF421  ali  43......................................................................................................................................................SGTAGHAQALDWDAGGAAANGVVDGGAGDWDAGTQNWTSDAGVTNEIYTGGGDAVFGSTAGTVTVQGLQEVSNITFNTDGYVLNGVNTANDQIRLAAGAGEIAVNTGTATLRVSIEDAGVADTDVVKTGAGTLVLDGVGFYRGDTVVQEGTLQLTNTSAISNTSGTVQVDAGATLQVSASNNINGFAGDGETVIDAGQTLTTGYNGRSSVYGGLISGAGNLRSFSDMTLTGDSTYTGVTTIAGDQVTLTGSIASTDIRILASASFPASLNIAGDGDAIDDAAVISNAGTLILTGNSETVGSVFGAGNINLNDNTLTTGDASNGEISGSISGTGGLTKTGSGTLTLSGANSHTGTTTLEAGGLTVSGGAAIANTGAVVVNGGTLTINTSETIGSLAGANGGVAIASGQTLTTGGDNSTTDYDGVISGAGGLTKSGTGTMTLNGANTYTGETIVNSGGTLVAGNANAFGTGNNFRVSGTADLGGFTITKFSTISQGGTLQNGTLNITGALQIQNATVNTVLSGTGYVASAGSGTSTLSAANTFTGNLVANYGALDITGSTVTNTVNITDLGNNGAGIVVHGTSLADTANVTISNSGVLTVAGDETIGSLASASATSSVVLNADLTTGDAGDDVFAGVMAGAGDLIYQGSGTFELSGANTATGTLTNNAGAVVVSGTWAGDVDNDAVFDLTGTSTVNGTFNNNATGSVTNSGGVAATLTGLTDFIADGAIGDAAGSITVNTQNLTYRDNHAETGTVTFNVSDTITEERTAGPTWAGTGFTANFATAAAGVFALGGDFTTTGSFTHNSSADLTVTSGNTMTVDQFTNN....... 866
170 4.000e-21UniRef50_A0A258SAK4 Uncharacterized protein (Fragment) n=1 Tax=Sphingomonas sp. 28-62-20 TaxID=1970433 RepID=A0A258SAK4_9SPHN  ali  11  235.............................................................................................................INNTGTLSAAGGRVLLTARAAADVVGGVINTGGIIDATSVSEKDGQIILDGGPVGTVNATGLLNASGTGAGEKGGLIQIAGENVVVGSGAQVLATGDAGGGQIYVGGGWQGATINGRPSSVRAGLASTATLDASATGNGDGGTVVLWSDVNNVASITQAHGSIFARGGAQGGNGGRIETSGRYLNTDGVQGSAGAPLGLAGMWLFDPYNITIGAAGNVNSYALAGGDFTAIADDSTIAASVINNLLNTTNVSITTGVMGNQAGNITVDAIIENTGGGTRTLTLDAANAITVNAKIRGSTNNALNVILNAAGTPGSGGGVTLADNVNTFGGNFTINTPGTVTQSAAFSANALNLLGGGSFTLNSANSFASLTATASAVSLRNTATATSFGAITTGAFTFNTGGTVTQTAALVATTANLLGTGGSYTLTDTGNSIATLTSTTGTGTITYSQTGALSVGPVTTSGALSATSGGDLSVGGAVSFGDGASSLVSTAGNVAVGAAINRTGTNAASLALTANAAARGVTITSGTGSIGASSTDAFG-VTVSATSASSTGISVGGTVNTRGGALTLNTGGAVSSASTGTLFGAATSITGSSITLGGAVTTTGATSLTATTGNIALNAALNAGSQALTLATSASGTASQTAAFTAGALTLQGGGTFTLDTATN--------SFASLATGTGGTTSISLLKGSSATSFGAITTGAFTFNTGGTVTQTAALVATSANLLGTGGTYTLTGSGNMIGTLTGNTGSINLLNASAATLFVGPVTTATTLVVSTVGDLTVTGAVNFGDGASSLVSTTANLTVDAAINRTSGTAAASLALSATAANKGVTTRAAGTIGAAS............................ 1069
171 4.000e-21UniRef50_UPI0009ABAD39 S-layer family protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009ABAD39  ali  498.......ATLNATTANLSGISTNAGTGFTLNNVTLAGGIEKGKNVSFSSAGSGKAVTNVIGSGVLNATTTEALMKVGIENNTQISASGITLGGSGDDWTQNYTSTKGGGWIFDGATVSKTGNISLQGVGFVNSSVTAGQDLTINNGDTSLTVQNTTLNATAGNISLTGNAGITLSGNSTVTAGKDITLNVSAGGVNITGISSTAGNITFTANNPGAGDVTGINLQFVNVSVGGNGRIELNSTVHNGSLRAKGIALDSVNLTTGGGNVSVTAVSNGTAVYGKEVVITSGDSINVTTSGKSSGYSYASSNFVNSSFTAKNNISFTATDKEDAGKPMQAALGFYGNTAFNATDTVLKGHHTNPGGVGNFGSIGVALGANAGSGTGNIVVNGNLSVDGSVMDSGAGVTVGANMTVSGTTDIKGHSATGKGVSFTTSMDYAPTPVNLTINISGGGSISGTSDTGIGLLNGNKNNVINITTGTGNALTLTGNSTSSTGVQLDGTVNAAQGDLTVNGSSGNGTGVDASGASLNNATIHGNSTSGAGVNVSESTLNNVTVNGSTANGTGVDITGNLTSTGSTTVNGNATGMGSGVDLAGNVTGGTVNGSSTDGTGVNVSGNSTLTDVTVNGNTTSGTGVDISGNLTNQGNTTITGNSGSGAGVGLNGTVTGGSLVGNSVSGPGLYVTGNSTLNGVDVTDSSQSGPGTQ......................................................................................................................................................................................................................................................................................... 1198
172 4.000e-21UniRef50_E3I388 Hep_Hag repeat-containing protein n=2 Tax=Rhodomicrobium vannielii TaxID=1069 RepID=E3I388_RHOVT  ali  40........................................................................................................................................................................................................................................................................................................................................................................................................GGTNTLTGTNAGKTNGTGGFLGSNSLNCTGNTVDGAEALRNNGNATLPATSGTAVLTNNTVVGNSASGNGSGLTSGNATLINNNVQGTDSLSLNGTSLLGGNANIQNNNVQGNNSLSSNGLLGGNATISNNAVIGNNSGSLNGLAQTVTVSNNRIVGDNSGSGNGGNVTDNRIFGDNSGSLNLAGSVTGNTIIGNASGSGNGNDVQNNTIIGNGSGSLNLGGPVTGNKIIGNASGTGNLGSVTDNTIIGNGSGGLNQTGFANNTVIGNTSALGNGANYSNNLVVGNLSGSGNGQNFQNNKIIGNGSGNNNTVIGDVSGNGYADGATFNTVVGNFSGNGVNGSGNLAVGVLSGNAVAGDSNKAVGNASGNVVNGSFNSAFGDLSGNFVTGDRNLATGFITGNAVTGNDNSASGTGSGNFVTGDRNAASGFITGNIVNGSDNSASGTGSGNFVTGDRNAASGFITGNIVNGSDNSASGTGSGNFVTGDRNAASGFITGNIVNGSDNSASGTGSGNVVTGSRNAASGFITGNIVNGSDNSASGTGSGNVVTGSRNAASGFITGNIVNGSDNSASGTGS.............. 621
173 4.000e-21UniRef50_A0A2W4RHS4 Uncharacterized protein n=1 Tax=Methylococcaceae bacterium AMb10-2013 TaxID=2202815 RepID=A0A2W4RHS4_9GAMM  ali  10  531...TGTISGAGLSSSAGLTLTGGNAALGAGNLTTTGTIGSGAITSTGLITGNGLNAGNTGIASAGPITGATTIDNAPGSGISGTNSAGVTIGQTGQTNTLNGSTTTSGTFNANGTTNNIGVAGSTNTITGTTNLNGNVTLQSSTTNNAKVSVTDGTASLTVLNNATGNTHGLTVGTTSTTLSGGTTSTTQTLNDTGATYTTGAAPGGALALVTAGTVNVGGAANAGGLGVNAATNGNLNVVSALGVTNFSVSGATGNTNVGGNLTTVGNASVGSNLLVNGTSTLTGTTTIGNAGNPVGTGILQVNGAVSTTGNASIATAVGTTNTFGSGSGSKNTIGNAGTSNNVMTGATNTLQAGNNSAVVDNVNGLTVVGVSNSITGATRLQSSSAVGANALSVDAVNGTVVTGPTSLNGTLAVAGNANLNSNLAVAGNTRLNGTLAVAGNASLNGAVNNIGTTQQGSVNTVGTTGSTNAINGANNYIGTNQASNNQIGTVGSNNTIVGSTNLVSSGGSSQVSVNDNGVNVIGNTASLQGRNSANISGGSTNMTLNNSGVQLSNASGGPVRVMGVANGINANDAVNVSQLTGATNNIYNRINGLQSKAYSGIASVAAMATIPEPIAGHNYTVGVGFGNFGSQSAVAFGGKANVGDSIRVAASLGYAGSELTVGLGTGFSW..................................................................................................................................................................................................................................................................................................................... 1200
174 4.000e-21UniRef50_A0A1I0R8G4 Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Fabibacter pacificus TaxID=1267423 RepID=A0A1I0R8G4_9BA  ali  14  3.....................................................................................................................FGQGTFQSNASAGWHLATTWTLISGSDADGIPDSNDNVIVQSGHNVSISVASSGNNLTLNNGTISFSNTVTLSIAGNLSVTSNSNINGYNNSHVIQVAGNATSVGAIGFTVVGTTTINGSLSGYSGKPRNFGDIIINSGGSMTCTGADAYTFNGDLTNNGTFTATSYGTTFAFASSSGTIGGSGLISLFSATFNSPAN---YTNQGNLQFRNSFSGTGSFTNGNGGQLELQNGGPFSISTFDASAVGN--TVTYTGYSNVSAFSGSYYNLVLNKSSGSLTFGGDISIDNDLTIQSGIFQIGAVTADIGGDL----IIEGGEFTPDNASGETNLAGDVLMSGGEYDHNNGDVNFNGNVTVSGGAFSMAGSGSTIDVAGTFNHNGGTLQLDAGTLTVPNIYVAAGVGGANVNSTGTAELDGTMLFNATNGTKSYNNIQVNVSGTWSVTQDEGFTVSGDITNNGTFNGSPTYGSAVYNLGSNSLTIRNLLINSPANITNEGVLTVTTTLNGSGTFNNGANATLTYSGNNSSGSNTITNFYASATGNTVVFNRDGDQQLRATSDSDNNYYNVHINTTAAGNDVTLAGNITIDN................................................................................................................................................................................................................................................................................... 604
175 4.000e-21UniRef50_I9ZND9 Vacuolating cytotoxin autotransporter n=1 Tax=Helicobacter pylori NQ4044 TaxID=992028 RepID=I9ZND9_HELPX  ali  25  2..............................GEKSQKVCVHHPWY--ALWSC------DKWEEKTQQFTGNQLITKT---WAGGNAANYYHSQNNQ--DITANLKNDNGTYFLSGLYNYTGGEYNGGNSNATFNLGASSGNSFTSW--YPNGHTNVTFSAGTINVNNSVEVGNRVGSGAGTHTGTATLNLNANK---VNVNSNINAYKTSQVNIGNANSNSVSLSGDTCSSLASVIGANCSTSGPSYSFKGTTNNTTFSNANGSFTFEENATFSGAKWNGGAFTFNKGFSATNNTAFNSGSFNFKGASSFNGASFSNATYTFNNQATFQNSSFNGGHSLLVT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 307
176 6.000e-21UniRef50_A0A1N7JX72 Uncharacterized protein n=2 Tax=Rhodobacter aestuarii TaxID=453582 RepID=A0A1N7JX72_9RHOB  ali  636....TVLGTTDVTGAGGNAAALSVVGGATFNTGNVTVGSDGTLTVGDADALTLENMNVGGGSGTTDVSAGGTGATLASAVTSASAVTNAGTINGTLGLSGAGSLLQSTSGVVTGTATLASGTQITSDGSLADVSNSGTFVNQSNGQAGTVTNQGLGTGSNAGTLGALIHNSSNSFANTGDITGAVSVSNGTVTNTGTMDAGASVTGGTLTNSGQVAGDVSVTGGDFNLSGGTVVDGSGAGAGPGDVTIGDDTGAAGFLATGTSSIAGAFSVGAQGTAIVGNTDATPDQLTVSGTTDVTGAGGNAAALSVVGGATFNTGNVTVGSDGTLTVGDADALTLENMNVGAGSGTTDVSAGGTLDVREGATLASAVTSAGAVTNAGAITGAVSVSSGTVTNAATGAMNGGALVSGGALDNAGQIAGDVSVTGGSFTLSDGSSVTVGAASGDVTIDGVGTQFDTTGTSSIAGDFALLNGGQATIGDGVIATDLTVSGAGGTTVDGTSSLTVTSNATLLSAVSNTGTINFENSALVTGSITGAGLLNVSGNATVDGSISSANTISLANGTTGQTFSVTGDLVGVSNTVLAFDVDLADSAADIDLIDVTGEVSGSFLLSFADATSANADLPASDLTFLLWGSENAPSFTYDFTDLTQNNPSYDYTVVPESGGSGLALHVAIDQDVGALAGSVALSQSLIGALVNRPTSPFTVGRAIPEEKNCAPGGWGRVTGGNVDASGDTTDSGGMQNGSNVTATYTGVQLGGDLSCFNGSIGGWDMAFGGFLGFNRGSGTISTISVANSTATSSPTANDFQQSYGGVYMTASKGNLVADLQVRTEKTDFTLNNASIAGTALSDATFASRATTVSGSVSASFPLKETGWNLVPTAGFMLSRSKTDTITFDL........................................................................................ 1529
177 6.000e-21UniRef50_A0A0N0LSQ1 Uncharacterized protein (Fragment) n=1 Tax=Helicobacter pullorum TaxID=35818 RepID=A0A0N0LSQ1_9HELI  ali  11  175............................................................................................................................ASALSSQAVAGWSNGNNGTLNCSGDTCVVNANRHQQQISTTNNGTIQNLTINSGVTVAGWGGGGHNSGVGVALNQNALIHVEVGDAGDITNEGTMIIYDNGRIIRVASGKRVGNFTNNGNMTITGDAILVHGSMGDFINTGNITSSGKIFYITGSGANISDILLTSGLVKAGSNVLEVAGSATLGSFIVSNNAQVEGNMNISGQITDRIAIQDSASVTGNISLAGSSAIANGITIGGNSSGGSGNNTSL-TGNISLAGRSSISKILIDGSNSSGANGTPKLDGDITLNTSNEITNGITIANGGTYDGTIHNRNSSSIGGVVVDNGTIVGDIIASGTSRLNGITIVNGGGNIIGQHVSGSSGNAMNLGNIDIQSRLQGGITLANGATIESLRLSNRGTITNAVSIGESGSNNQTSILKTITLNGASGINSLVVGSSNDNAGTIKSITLDGNSSIGSINVAQRGTIANLEIGNASQVGSIGSIGSITNAGKLQNITLNNTSTITNGITNEANGNIGNINNIITNSGTIKDLVVSKGTITYIDSNNSGVVDSLLQVASGATLKMGASGTGTITLDNSGLGSVLDLKQGSTFEGNLRNASAIKEWKNDSNIRGSFINASDASVGDLTAGSIANNLLNEGNITNLTIDKNIGTLTNNGSGVINSLVVQNGSNIDNGIRNNSNIGSLNLQENVTYDGSGSITNALDIANNKTLTATNNGINIANNATGTINNAGIIDGSLTNTANSTIKTFNTGSISGSIANNASATIETLNVTSNVGSIANSGEINSLTIQNGSNIANGITNTGDITTLIASGNVTNGITNDLNIDTLTINANANLGSGITNNSNIAN.............. 1028
178 7.000e-21UniRef50_A0A258LL52 Uncharacterized protein n=2 Tax=Acidocella TaxID=50709 RepID=A0A258LL52_9PROT  ali  4...............................................................................................................................................................................................................................................................................................................TTITTKQTSRRAAGVSLIALTAMLGATSAHAAAPATVTFGTDTAVAYMTYGDTQSNAAAIAATLNNAVGSSSVTGTRGTTSNGTFSVASNALSASAVGNTAPLTIDTQTIGSNGTNANGLASLSTQTNGTGSSMNATVSNSSLSDVITNAGSPTTLSLASNSVNATVTGNSANTQVSGVIPVSYASTNAVGGNLSNTVGSGNIVVASNQSNSGTGASAASLSSDTALLSVTSTGTGQQTVGLNTSETGNSLGSTFTGNNASNGINVVSTNGVTTGQGALNGSLVVANVQSNAPTGGFSASNTGSAVQTAIVGGTGAPINFTGSSTQTGNSISASATGNSTGSGVGSGNFITLGVNLTGVNQGAPDNVTTGATPSLNQTGDLIVGNNQSNTNLTLASSVTGGVITTVIDGTTGATVTTNANSVSSAAQGNTAANGIVSSGTLNNISGLAALASLQTQTGGSDTATSSTNAITATAGNATLAEGVSGSTMAVSNNSVSATAGGNNVSNSVNLAASAVSAQAVGATPAPAALVYAAAGASTNSAGAAINNQQTNADNASATASTNTIQGTAEGSVVTGDTLTLAGNNISASSTSNNATNSDVVSGTTTLAGLSGQSGTGTSSATASGNYVVADYLANGTATPLTSNTGSVTGTTIDAMATSNNASNTVSATGGALSN.... 681
179 8.000e-21UniRef50_Q9LB38 Vacuolating cytotoxin (Fragment) n=1 Tax=Helicobacter pylori TaxID=210 RepID=Q9LB38_HELPX  ali  93  1...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EHVLVRARNIDYNLVGVQGASYDNISASNTNLQEQFKERVALYNNNNRMDICVVRKDNLDDIKACGMAIGNQAM................................................................................................................................................................................................................ 74
180 1.000e-20UniRef50_A0A1H0TBM5 Autotransporter-associated beta strand repeat-containing protein n=2 Tax=Afipia sp. GAS231 TaxID=1882747 RepID=A0A1H0TBM5_9BRAD :  ali  529...........VNNSGTFKVVNNAAGITSVINSGLITFGNSSTAGTGPVINNASGGIFFNDSSTAGSTTITNNGRITFSNTSTAGSATITNNSLDIIFFNDASSAGSATITNNGGIFFSNSSSTVLPSTAGSAAIINNEEIEFERNSTAANSAITNSHNVYFFSNSTAGNAALTNNSSGLFDFSASTGPNNDGRISAGSIAGGGTFSLGSNQLTVGGNNLSTAVSGVIADGGILGGGGSSLVKVGTGTLTLTGSNTYSGGTMVTGGLINFSATNNLGSGAITLNGGGLQWASGTSTDISSQLAPIGGNGAIFDTNGANVSFAFSLSGSGGVTKTGAGTLM-LSGTNTHAGTTTVNNGTLEIASGGSITQSGSLTNSADFVVDGGGSATFGSVTNNATGAITVAAGGTVHDDLNNAGTVTNNGVYVANVAGNTGTITNNATTTSGTFINTAGATVSGLVTNSGTGSNAGTLSGGLANTGGTFNNSGTINGTTTISGGTFFGAGSVNTLSVASGGTFAPGNGTPGISASVSGSLAFQSGASYLIGLNRTTASFANVTGTATLGGASVLALFANGSSVAKQYTILTASGGVSGTFGSVVNTNLPSGFTTGLSYDANDAFLNLSLAFASPPGSGLSPNQQAVGNAVTHFFDSNGSIQLVFGGLTSAGLTQLSGETATGSQQTTFDAMMQFMNVMTDPFVAGRGDTTDASGGANAYASADEQANAGKRNPRDALAAIYAKAQPVAFEARWSTWAAGFGGSQTTDGNTTTGSNSATSRIYGTAVGADYRFSPFTIAGFAIAGSGTSFSVNNLGSGRSDLFQAGA................................................................................................................................................................... 1339
181 1.000e-20UniRef50_A0A1I3KR97 Autotransporter-associated beta strand repeat-containing protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1I3KR97_9BURK  ali  1201...TQIVGTLVGSGEVNLGADQLVVGSANDGVFGGSIAGTGSLIKQGTGTETLTGNSVFTGGTTIDAGTLTIGAGGSLYASGTVDLAAAGAAFDISAGGNQSIGALNGVAGSSVALGANTLTLNDTSNGNYGGAITGTGGLIKTGAGVQTLGGASTFSGGVTLEAGGLMLGNNTALGTGALNVTGGATLDDSAALTVNNNVTLASGVALNVLGSNATTLGGVIGGAGSLIKSGAATLTLTGADTFTGGTSITAGLALGAGGSLSATGAVALSGTGIFDISAAGNQAIGSLAGTTGSVNLGTNTLTLGGVGNTSFGGLIDGSGGLVKVGSGVQTLSGANTFTGGVALNAGGLVLGNSAALGSGALSVGGAASLDASVATALPNNVKLASGSALDVLGSQALTLNGQISGGGALTKDGNATLTLNGANTYTGATTINAGTLALTGTGTIGSASGVVDNGVFDISGTTSGASIANLAGNGAVAVGKQTLTLTNASGTFNGTFNGSGNIVKQGAGTMVFDGTSASFTGTTAIDAGTLEVGDINTPGAVLGGNVTVDANGTLRGHGTVSGDVTSNGGTVAPGGTIGTLTVNGNYSQASNSTLSIEVSPTAASLLKVGGAATLNGVLALTYDPGTYSATQYTIVS---------AANGVSGRFTSTTATGANLGTLQQSVTYGANNVQLVLANATGPGNTGPGNTGPGGSTNPVVVAPVDTSIYTAVGSIASLDAQALNAALLDRMGRASAATVAVPDGWINATGTHTNVGGANGEPGFQANQYGFLAGLDQRLGDYTVGVAAGYTHTDIDEQNTGDSGAIDTLRAALYGNRWLGPVGVSATLGYGLDFLSQKRPFGTPGTAQGDHTGQELTAGGQASLPLTLGS...................................................................................................... 2068
182 1.000e-20UniRef50_A0A2R9NYG0 Extracellular serine protease n=3 Tax=Zymomonas mobilis TaxID=542 RepID=A0A2R9NYG0_ZYMMB  ali  10  41...............................................................................................................................................................................................................................................................................................TTSGNSVTCSGTVGDTTTSQTNYTAQIGTGKNSSINSVTINPNASVSYQRTVISLGSGSSSNHNSITIGGSVISGGLGSGPNGTGGNAVEFGNNTDLTIAKGGLIQVNSTGAYNAEAINPTGSGNIITNYGTIKTNSNASALWMEGTDTSVKTNGINTVDNYGLIQATPSGTGTIIGNSNSGIVYFTNRSGATVNGNISLGSTGNLANVVTFENGSKVNGTVSGGGNAATLNLTGASGSDSLSKSVSGFGTLNKSGNGTWSVGSAEAPLSSLSDSLHINVGKDPSGNTTDGGTLILAGDVSSKNAVIGID-NGTLQLGTGSTSGWVDGITHNNGTLVFNRSDTNTLSSNIDGVGQVQQIGSGTTILTGTNTYTGVTTISNGALQLGDGTTSGTITNSSAITNNANLTINNPANTTLSQVISGTGSLTQVGSGTTTLSGTNTYTGVTTISNGTLQLGDGTTSGTITNSSAITNNANLTINNPTNTTLSQIISGTGSLTQAGSGTTTLSGTNTYTGQTTVALNATLNLPGAVAGDLVNAGTTN----------VNGGTVGGITSNTGTLNALNATLHDINNTAGTTSLNNSTAGTVTNASNATFSAVGGSLASATNSGTMTLGNGNNVAGDVTNNDGSLTLDGNAVAGTLAANGGSFEVTSAASDIGSLAGSANGNLDGALNLHNAKDTYSGA... 720
183 1.000e-20UniRef50_C3XJK4 Uncharacterized protein (Fragment) n=2 Tax=Helicobacter bilis TaxID=37372 RepID=C3XJK4_9HELI  ali  18  63..................................................................................................................................................................................................................................VCHSFACHLGGESAYDKLSIYGGDGTGSYNFSSIKLETNNGERGLTIESHNPHNGTITIDDLYTSHTGAVGFGGSVSINANTKINNAGGGTTLTVNVGREVSVGKLGGQNPTAISIDRVSFNQNGLAGSQGKINLNAKNVTIGKAAGRLSQVLNVYAEENIVAKDVYFDVIPKSEIRFNANNGGFTSDSGHSNIFVNTKKDIVVGNVGFAVDICITQACDVIVKSVTGGTANESGIGSFNTLQIKGNNFYAGKVEAISLVTSLNNSYLDLSGVKNTTFIDDLQFRNGTLKAKNFHFNNFTVWKANANGSAYTTVSENIG-KSFINNLSMEIGTSHTADSAALWGGGDILNINYVAARPTSYINFGDIKQVNINELSAMEADIYMKTG---IFNTITNKKGQTIITNGASKITANALNVNELLHIKDSSKHSGVMKIELNGSEEIKQEFDKYLNVGVDSKDLK--NMSGDEIAEIIKKAEANGSNGNTTDYKNASGTYITTSDGKHY......................................................................................................................................................................................................................................................... 612
184 2.000e-20UniRef50_A0A2W5QVL5 Uncharacterized protein (Fragment) n=1 Tax=Starkeya novella TaxID=921 RepID=A0A2W5QVL5_STANO  ali  11..............................................................................GVASADSVTVTNQADFTAAVNAAIAAGQPDTITAQGGGVFVAEPDWTLPGNATSLQLIFNTSPFIIGNADGDSLLTLSSASTLTLNTTSGTSAGRIEIGNGGTGTLNISGGTLQVNLADSSTAPGTSIGRIWVGGGSTNTTGGSGTVNMTGGQLLYSANAGSLNYGGLAIGRGAGVTGVFDQSGGVVRFSSAGSIGNRGGTGTYSLSGSSSFDASMGGVGLSLGAYTSDNTSSGTAATGTLNISDNAQFKITSGSFADSNIYVGDSMSTGTINQTGAGSVVTLGTANPILFGSDVGNYGTGGSGTYNLSAGTLSVQNVGGSAQLIFGAASGGTGTFNISGGAATVAASLTLASVAGSTGTVNLTGGALTLSSGSYLSFGSGAGTFNLDGGTFTVGGTDGIRGTGTFSFGGGTLKVGSALTTSSAMTIASGKTGTINTNGFNATLAGVVSGSGALE-KTGTGTLTLSGANTYSGGTTVSAGTLLVTSDANLGDEAGGITLSGGTLSATNFTSARSIALNGGGTLNQANGALSLSGTISGTGGLTKSGSGRLILSGTNTYTGGTRISAGPLQISADANLGDVSGAITFAGGSLETTATFSSARSITLSSNGTIDTADGTTLTLTNVISGTSRSLTKTGAGTLVLSGTNTYTNGTTISAGTVLIRADANLGGSGGSITFNGGTLTTAR-NISSTRSVVLTSTGTIDTAKDTDDSDTTFSISGVVSGAGALVKTGTGTLTLTGSNSYSGGTTVSGGTLRVAADSALGNASGGLALSGGTLATFGSFTSARAVTLTGANAFDTSTSTALTLSGVLSGTGSLAKTSSGTLTLSGANTYSGGTTVSAGTLAVTGSIAGGVTVSAGTLSGTGSVAGTVQLASGAT.......................... 887
185 2.000e-20UniRef50_A0A0E3YVU7 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium IMCC26134 TaxID=1637999 RepID=A0A0E3YVU7_9BACT  ali  707AFLTKSGAGNLSVGNAISATSTEVQGGTMTLNTANALTGAITVSGGTLAIGTNGAAGNGTATVTVSGGQLDVGTRNQSVADLTLSSGSITGTTGVLSTGGNAMVAQSGSVSA--------------ILGGTGGLSKTTAGTVVLTGANTYSGATTIASSGILQIGNGGTSGSIASTSGVANSGTLDYNRSDASTVDYVVSGAGTLVKDGSGTISLTNTNTYTGATTINSGTLQVGNGGTTGSISNTSGVTNNSILAYNRSDAITVTHAISGNGSVVKDGAGTLTLNGDRTYSGGTTLNAGTLAVGSSQAAGTGTITAANGTTIAATSSLGTNAVGEAITLSGSNATVTLTNNNASGGFNSVINGSAGQTLVISSAGGTGVNMNLQSSKQLQNFYGTVSIASGNNLTFRSTSLNQGSDNALFQVDGSISTRNNGNVALGALSGSGTVSMGGTGLNNLQTTYTIGGRNTDANFSGVIQDSDTVNGKIVNVVKTGTGVQTFSGVNTYTGSTTVNNGTLVISSTGSLASTNVTIGSGASFKYNGASAFTGTLTINGGTVSGSGALNVDLALNSLADHVAPGNSPGIQTFGADQNWSAFTYDWEVNDFTGTVAGTAFDKIAITGSLTLNSGNAYQLNVLSLDAGNASAAVPNFSEATTSWTIASTTTGITGFNAANWTVDASNFINAETGSFTLAQVGNDLVLT.......................................................................................................................................................................................................................................................................................... 1391
186 2.000e-20UniRef50_A0A1H1H7L1 Head domain of trimeric autotransporter adhesin n=2 Tax=Paraburkholderia fungorum TaxID=134537 RepID=A0A1H1H7L1_9BURK  ali  51................................................AGVSAAALSTPAVASTGTQTAAPVASGTDAVAVGAGAVAPVTGATAVGSGASVSNDVLWSINLGGNRRTDGLGTNVTSITQNGSGTALGNNSYATAYGGTAVGSYSTASGIGSVVFGVFGQALGRMSLAMGAAAYSSGVQSQAIGAFSVANNDRASAIGTLSAATGADANAIGTSAAASGARSIALGSAATVTFDPNSTTDAMQNTTNNTRASGTDSVAIGTGGLSSASSTIAIGTAASATGANAVALGSSATSASAGSVAIGQLSQTVNGNSIALGRYATADSTTASGAYSAIAIGTNSSTGDGAIVLGDSATATAGKSVALGRAAQASALNASAIGAGASATAANSVALGAGSVTTTNLGASAYNPGSMTLGGTTAAGEVSVGSSSQQRRLTNVAAGSAATDAVNVSQLQSLNNAGTRYFQAGGLADGTDDAKAQGQAIAIGAGASAAQTVTTTSIAIGKGATSAYGGNLALGESAYAGGGDSAAIGRNASTANINGANGQIAFGNSASTGALGAIALGTGANASVKNALALGAGSSAGAANSVALGAGSTTTASLAAAGYNPGSTTLSGTASAANGEVSVGSTNAERRVTNVAAGAAPTDAVNVSQLQSEAASRVAGVSSLSTGLSTANSNVASLSTSASTGVSSLSTGVGSLSTGLSTANSKVTSLSTSTSTGLSSLSTGVSSLSTGLSTSNSSVTSLSTSASTGVSSLSTGLNTTNSSIALLSTTTSTGLASLSTRVDTTDNNVASLSTTLNTTSSALASLSTGVGNGVMYDNAGRTSITLGGATSQPVTLTNVANGVSQYDAVNFGQLSSLSTTTSTGLGSLSTGLDTTNSNVASLSTGLDDTNNNITSLSTSTATSLSSLSTGVGSLSTGVGSLSTGLSTASSNVASLSTGLDDTNNNVTSLSTGLDDTNNNVTSLSTS....... 977
187 2.000e-20UniRef50_UPI00082A5DC3 hypothetical protein n=1 Tax=Novosphingobium rosa TaxID=76978 RepID=UPI00082A5DC3  ali  744AGFTTLGYQVASGATLTLGTNGTYGSTVTLAGQGNVVLNGTVSTSNAAALTTASVIQQGNSVLPTALTITNNGALASTRGSTSSYTGTVLLPSGYSYTGTGSGIVGSTFINNGQVSFTDTTGTTSPYAAVSSLAVVNNGSISAAGGNGVSATTLTNSGSITATGNAFLSTGSSTINNSGTLTSTAGAAIRSSSYSSTGDTLNNLAGGSVTGVGTAVQMIGGLVNNAGTINGNVNLGYTPAGGANSVSGMYIANGGTLNGDLAFGGGNAILVETGSGFGVTGTITAGSGTNWIGHQRSGTATVTLGSTLPSGFTNEFTVAAGSTSKVTLTGPSGYAGNLYVGGAGTIINQVATAGSVYGVGYLGNTPYAGIELAGFLNQANVRSVSLSAATFSNTASIGSSSLAGAAVTLSTANGFTFSNSGAITNDGNSAAVLLSGSTANSSSIANSGTIIGGMNANLTVASGNSVSITNTGAISGYQQPLYVAFPRPPYYLIYVDTALTATAYGAKNLTLNNSGMITGAINLGGSAATLLNNSGTINGAMSLTGGDVTLINSGTITGAIMTGAGNDSLILGGVVTGAISTGDGDDSIALNGVFSGSIDGGAGTNKLSISSGTQAAPVALTFVRNIGAFTQTGGFATVSGSGTFGTATLTGGRLVGLAGSILNADSFNVGSNATFGSAGTVNGNVVVSGTLSPGASPGTMTVNGNVTLNGGSTSLFEITPTVSDKLIVNGKMTILPGSTLQIAATGPVKVGSTLDLITASGGVSGTYDTVTGLAGSVRTLANG...................................................................................................................................................................................................... 1526
188 2.000e-20UniRef50_Q13JF5 Filamentous hemagglutinin / Adhesin n=1 Tax=Paraburkholderia xenovorans (strain LB400) TaxID=266265 RepID=Q13JF5_PARXL  ali  1058.......ATIQTGAGGSGTFADVQAGSTIALTASNDVNLTGTLAGGSTVALTAGQDVNVSGTLQSSSDTNLTALYGSVGTGSVNSNGALNVLAGTDINLGGTTTVALDTTLQSARDVNVTGSLSGQGNGFVTAGRNIGGAGSLAFAQSAVLNAAGAISQGGLIQGQNVQVSAVGNVAVNNIESTSTLALSAGTGGSGSLTVNGAAAAASAITATANGDVTVASAGKLAAGTTVGVTALNDINVAGAIESNGDAVLNAQQGSLNATGGINSGAELTITTGLDLSLGASTSAVGDVTLNAGRNAILNGTLVGQGNGYISAGQDVTGPGTQAFTNAAVLGAQGDIALTGSLQANSVQATGGDNAALNNVTSSTTLTLTANGNAGNGDAAITGTATAPGLVTLNAARDVLISGALGGGTTVTLAAQRNATVSGTVQAVGDLDVTATNGSAALTGTATTTGALNVTSGLDTQLGGQIAVTNSLTVQAGTDVELTGTVAGQAAGSLTAGQDITGGGSAAFAQAATLSAANNVALTGALQGSGISVTGGNNAGLGSAQATTGNLDVTANGNAGQGDVTFGGAVTAIGTTTLQAARDVSVAGAINSGGTASITAARNAATADVNSAGDLTITATSGNLSAGNVT-TQGNLNESAGQALSASGQTEAGGNATLASGGDMTLTGGIAAQNTGTLTSGGTLTAGSVAFGQQATINADGSINVSGSVATNGNLAATATDSLSMGSVQAG.................................................................................................................................................................................................................................................... 1787
189 2.000e-20UniRef50_UPI000806C3CD hypothetical protein n=2 Tax=Epibacterium mobile TaxID=379347 RepID=UPI000806C3CD  ali  978..LTNSDGTFTNTGTVTGTSTVAGGDLVSSGTLGGNVSVASGAELSTSGTING--TVSNSGVTTVTSGTVAGLDNSGTATVSGGSVSDFDNSGTATITDGVVADLDNGGSGQLTIEANGEVTVLANAGTASNAGEIGTLTNTGGTLTNTGTVTGVSTVSGGTVENSGTLTGNVDVAAAGTLNTNGTVGGTIDNDGTVTVGGGTVAGLNNTNTATVNDGVVAALTNSGTGQLVIDTNGSVT---TLSNAGTASNEGTVGALTNSDGTFTNTGSVTGDATISGGSVTNSNTIAGATVLSGGSLDNSGTLGGAVTNSATLVSTGTINGDLTNQGNATASLSGTVSGAITTQDSASVTVNGDLDSVTSITHGGSGTFAINSGTTTLAGAGAVTNSGSFTLTSATDATGDAVFANTGFANLSIGAGGNLDMDLNNDGTVQIADGGSVGGTLQNGSGGSVNLDGSVGGDLSNAGTLDLSGSVAGTLGNTGTLTVHGASTVTGTLTNAGSMFVNDTLAHGNLTNSASGPAWSDTMLVTDAVLRVSGSGALTSGTLTNSSSIGLSDGATITSAVINSGTIIADGNVTGAGDFTHQTGAILDLGDDAGDDVFVIAGDAVLNGTIELDITLEGEELVGDQIQVAGAVSGNATFNFNLTDADAVDLLGTVNVLSYGSGQLDSYSVNGLPNSGAAVFALVNNTDADAYQLQSGANPAVGGLATGLALTQSLIGSVVNRPTSPFVTGLAVPGDEPCGFGTWSRATGGRATASGSSETALGTYNSELTANYHGMQIGADYSCFGGAFNGWDLSFGGVAGYNGGTTTQPVYFFDANTGQVNTDVLTSTNRTSFSQSYGSAYIAASRSFANSGRVLFADVQVRGDKTAFDLDNSVNAAA.................................................................................................. 1854
190 2.000e-20UniRef50_A0A1B4C0Y3 Uncharacterized protein n=143 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1B4C0Y3_9BURK  ali  10  39.........................................................................................................................................................................................................................................................................................................................STAGTTVTCSGVANPLAPSYANGADNVNATVNPGASLGVLLGVGGTAMSLTGSGVTLTNNGTIDPSLLGSGLGILSSGTVVGNASASTTTVTNNGTMMGTTGVAISGVTGMALSVQNGTGGVSNISNTGTIGSTALSGATLAGADAPVVAAYGG-GQVNMTNSGTITGRVSLGSSGTAGVGNTFVNSGTINGGVSMGANSTNTFTAVTGSSVNTAGGTGGAFNITIGPVTLGVAATGVVDGGAGGDNTLVLQQGATANGTIAVNNYINFNHLDLTSGSWTINGASTAQDATLAGGVAIINDSASLGTGTVAATGGALQAGTTGLNVANSVNLSVGGLTVQGATGLTLSGTVAGGGTLTKNDSGTLTMSGANTYTGGTSLNGGGLVVGNNTALGMGALNVNAAASLDASTNVTLGNAINLATGTTLTVGGSNALGLSGTIAGAGGLVKNGAATLTLSGTNTYTGDTTINAGTLALGTGGSLAATGTVNLTGAGATFDLSGASGAQTIGALAGAAGTNVNLGSNSLTLDGTVNATAGTIGGAGSVTLSGTGTQSLTGTNVYSGGTNLNGGSLVVGSNTALGTGSVNVNGSSTLDATASVSLANGINVATGTTLTVGGTTDLGLGGTISGGGGLVKNGAATLTLSGANNYTGGTTLN.............. 692
191 2.000e-20UniRef50_UPI000CF0C6EC hypothetical protein n=1 Tax=Helicobacter TaxID=209 RepID=UPI000CF0C6EC  ali  14  45.................................................................................................................................................................................SVTKNQTDEFYVRETKTYYSSDKAFSQTYANGTLIFGNNTKASGTGSVFGSGWWIGYVTAKFQAREVFLTGTLGAGNGINTGGGLGITFQSSSNITLQDFNLNLTKAGLQNSSATFDAKGNLIAKNITVNNATGGSVIFSANNFDFYARQIQGS---GTLQFKNNEVSSESKNSITIDSLSISGGRFD---------SNESSASINIKSLSLSNTTFFTKDVETYTLDAQNATYNNQGDGVSITGDWNLF---ATGLKNNFITISNTPSFTSSGSITLKTFGVTGSSFFVKEGVENLNLDSIVLMLNSTVDTGANTFNVSNVSNKTVINTLTATRGNIYA-NTDFNIGNLNVQTADFNPTTNLIGNQNTNFKIGNLEIFGGWGATTKATAKFTSAQGLEITNAKISNWSTLDAFEVNNVVIDTLEASYA--TIKAGESLTIKTASFSNNEIFLYARNTNI---DDVTLENGAKLYIKSGETLRAKNLVMNSQSLLDAQRDSQSSAMTGDISIEKITFNNSTIKANNLFTKNISVNNAGVYLKDTNHTYTNNGDLNISDGSKLEVYGGN............................................................................................................................................................................................................................................ 593
192 2.000e-20UniRef50_A0A099B6X7 Uncharacterized protein n=1 Tax=Helicobacter saguini TaxID=1548018 RepID=A0A099B6X7_9HELI  ali  16  333..........................................................................................................GNMISGNGIATGGGATININGTSQPVTGGALRNGNITAVKRAGTQGSATRLQAKTITINNSNLRIGNVDGADSGIHIGNQNNHNESEMITINNTHVTGDGGVFRVYAKNSNLNFSGLNGDANYSNLNFNDESINVANFNFYAKDTNLHGDMQKGHIKTENGVQNFYAEMLRLRKGMNTNQQLSNLQFWIPDFAGTSHAGTLTFNAIAKDSINIINLLTRQAGGGSGSTINFYAKNTLNVANDIVMSAQIAGISDSHFRIEAKDGATSYDINAKNVYFDGDNVTGASKAYLVLDGK---NVNITGSMSGRTQNHINVYASENININNINFAQDICITESCGGSINLGATKNVYEAGIRAGNSVNIKSQNMYIGKMEAISLVIDGNKSKLDFSNVTGEKVIDDAYMRYGSVFGNNFHINNLTIWKGKLDFDAVSRFESNIG-KSFINSVGLEIATSNTSDAAAFTGGGDILNMNYVNARASSYLNAQSIKEQNINQ---FDIAGADAFLGNAIFNNITSTRTQ-LWITANSRITANALNINETLHLKNSSVNAGAMTINVSNSPTVNQDFSKYLKLDVDSKTLKSMNAGDLANLIEQNKDKITADNQNASGTYITTSDNKSY............................................................................................................................................................................................................................................................... 994
193 2.000e-20UniRef50_Q17WH1 Vacuolating cytotoxin 2 n=4 Tax=Helicobacter TaxID=209 RepID=Q17WH1_HELAH  ali  66  1......................................................................................................MKNAVGAYNLSGLRNYTGGDLDANMQKAAWRLGQSNGSSSTNFKEAANRATRVNSNAKNVIIGNFLEIHNRMGSGARRKASSAILTLQSARRDCKR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 96
194 3.000e-20UniRef50_A0A2R7R623 Transporter (Fragment) n=1 Tax=Pseudomonas sp. HMWF007 TaxID=2056844 RepID=A0A2R7R623_9PSED  ali  10  287....TVAGAGTLNSSSAVTLNNAITLNANLTAGGANALTLGGVISGSNGLINGASSLTLNGNNTYTGTTALTAGSLIVGSSTALGTGALNASNGTTLDAGTAATLTNNVNLGGTLTVGGSNALTLGGVVAGIGGLIKNGAADLTLNGANTYFGNTALNAGTLIVGANGALGAGSLNAAANTTLDANTAVNLNNAVSLAGALNVGGTADLTLTGLVSGAGSLVKNGTANLILNAANNYLGGTTLNAGTVTVGNSSALGSGALTVAGAATLDSNSPLVSLNNNVALNAALTVGGTQNLTLGGITSGTGPLIKNGAANLTLNGNNTXXXSGGTTLNAGTLTLGNANGLGSGGLTVGGAATLDNSASFGIGNAITLNAGLTVAGNNDLALNGIIDGAGSLTKNGTLAGSNTFSGALNIVSGSVTTLNSGALGNTSGVNISAGASLNLGSDASLGALTGSGSVQLTGSNTLTVGGGNLTSTFDGDLSGSGGLTKIGTGTLNLTGINGVTGNTAINGGTVNLSGSLASAQLNVN..................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 815
195 3.000e-20UniRef50_A0A1I0PJ18 Autotransporter-associated beta strand repeat-containing protein n=8 Tax=Xanthomonadales TaxID=135614 RepID=A0A1I0PJ18_9GAMM  ali  12 1884..............TLTLNGTNTYTGGTFINAGTLALGAGASLYAQGTVNLATNATFDLSAGAGTQVFGTLIGGTVNLGGNTLTIGGTDGTFGGSIGGTGGLIKEGTGTETLTGTNTFTGGTTI-----NAGTLAIGPGGSLSPVGAVTLANAGTTFDISGGGNQAIGSLAGVAGSDVTLGANTLTLNGIGNTNYDGVISGTGGLIKNGPGTQGLGGANTFSGGVVLNQGGLLVGNDAALGTGTLTVAGNGTLDASTPVTLANAIALDAGLTILGSNDLTLGGAITGAGSLTKDGAATLTLTGANTYTGGTTINGGTLAIGAGGSLAAGGAVNLTGASTFDISAGGDQTIGSLGGVVGSNVTLGANTLTLGGDTDSSFDGVIDGTGGLVKNGAGTLGLGGANTFSGGVTNAGGLLLGNDAALGTGDLTVGGAASLDTTGALTLANNIVLNASLALPGGNDLTLDGDISGAGGLTKGGDATLTLNGDNSYAGGTTVNGGTLVVGSDTALGTGGLAIDDAALEAGTAVTLANNVAVGPNGVTVQGAEDLTLNGNLSGTGLLDKNDTGSLTLGGTLAGFTGGINVNGGILNASTGGISVGANATANLDGTGNILNLIGPIAGTLNIGGGSNLDLDYDELPDVTGTVNGTGPGTTLNITGDGEGTLANGVFNGIDNLTTAAGTLSVNAGTSVTFAGGSTIGGNLVVNGTLGGPVTVNPGGGVVGGGTIDGPVTVDGGTIAPSGIDGATGPAGGTGTAGTTLTTGGLTLSGDSVTQIRVNGTGAGDSITANGPATVGGSLVVLPTGSTFGPVNRYTILNASGGITGTYGNVTQGLFPFLDTGVVQSGNQLILTLSQAGSGLGTGGIRFDQFPGLSNNQANMATALQTIATSGGDPLPTLLGTVRGLRADQVVRAFDSLTGETYASAAT.......................................................... 2793
196 3.000e-20UniRef50_UPI0009AE19E5 hypothetical protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009AE19E5  ali  10 1718.......INVTQGNLSVTGTTHHLTNGSYTGLLAGSGLNVNVSQGNLSLAGQALDGNDVSGNTVGLNLTNAILSAEHASLKGSSTSSGSGFILNNVTLEGGIARGENMTVSSAGSAASITNTLNINGGLGYGAFESMKQAGIDNKTTVGSLTASQDELKQYMNFSESSDWSFNGASLGGDNWSIAALT--GINATTTGNITLTGMGLTNSNLTGSSVSLNGDGNASLTVTNTTLNATTGDVSLSANVANGNALVVSGSNITAGRDIILTGTAKAGEGYGVSLTNGNMTATGNISVTGTGWDSKQGALNVNGGNFSAQNTVLEGTAGRNNVGAKLAGNINVTQGNLSVTGTIHHLNNGPFTGLLAGSGLNVNVSQGNLSLTGQVLKEDGKDASGNTVGLNLTNAILSAEHASLKGSSANSGSGFILNNVTLKGGIARGENMTVSSAGSAASITNTLNINGGLGYGAFESMKQAGIDNKTTVGSLTASQDELKQYMNFSESSDWNFNGASLGGDNWTIAALTGISATTTGNITLTGMDTTITNSNLTGSSVSLIGDGNASLTVTNTTLNATSGNVSLNTSNGTLTVRNVNLSSAGGESTLSGTSLENGTGVKLAGNINVTQGNLTVNGTVNRTGETNVWGIDARDATINVSASGAVLNMTGKVASDSGNGSVSVVGLDLSGNSVLNAHTANLNGTSVTNGYGFLLNSALQGGLTANGSLSLSSKGSGKGVSNQIGSRVSADVIEQNVSIGSYTDTTITNLYNQANFTQWIAAGNGNLTKDFGDFGLKFSGINITAGNINLTGTSFTNSNLTATSGDLTIDNKGGALGLSNTALNASSGNISLTGGSISLTGGQDVTAGKDIMLNASKGGVNITGQNGSNLKDITSGSGNISINGYSVGAGDSGTDDYKTSGVTLNNASLTASAGKINVSGVSDASYGYVSHNALFTSAGGILLLGNVSLNSTHN................... 2676
197 4.000e-20UniRef50_B2HPS5 PPE family protein n=7 Tax=Mycobacterium TaxID=1763 RepID=B2HPS5_MYCMM  ali  10  165......LTPFAVSGLVRQLGNAAAASLASAAPASXXXXXXXXXXXXDPVSALGLPSLGLAAATPLNLGAANVGTSNLGFGNIGSGNIGNGNNGDGNLGGGNLGSYNLGWGNLGGANQGFGNAGSNNQGFANTGSNNQGFANTGSFNVGFGNTGSNNIGIGLSGDGKIGFGSLNSGSGNIGLFNSGTNNIGFFNSGTGNFGVLNSGSYNTGFGNSGEASTGVFNPGNANTGWANTGNHNTGSFNAGNTNTGGFNPGNLNTGWANTGDVDTGAFISGSYSNGLFWQDDYRLLGIDLKINFGGTSGDYAVSIPLDNTFSA-----TVPTITTPGTTIPKQTFLNGGYIGPITIPSITIVGPPINATVGPATLDLSLSYDVSPIQLQLLYIPPTTGLGNTSSSPSSGFFNQGDGGSSGLFNTTSGPFGVSGLLNYGDLESGALNFGNT---ISGIHNTSGLELAPLEPARISGVGNIGSDLAGVFRDGPDATTFNVGVGNDGGLNFGSANIGDYNFGNANIGNLNLGSANIGFGNIGGGNVGDYNLGSGNLGSANIGFGNAGPGLTAAFNNIGFGNTGDNNIGFGNTGNGNIGFGNTGNGNI-GIGLNGDGLQGFGGWNSGSGNIGLFNSGTDNVGIGNSGTGNSGIGNTGSYNTGIGNVGVANTGLFNIGNLNTGIGNPGNYNSGAHNVGSTNTGGANQGDYNTGWLNLGDYNTGLANVGNVNTGALISGNYDNGILWRSDYRAQGGFSYAIGLVPITTSLNLSVPIDIPISATVGNTVIEGFTIPEIPIGAYGVVSGNIGPETFPTITIVGPTIDIGVGGTQSVFTPSFVVDTGLVQAIVLDLPSGPGVGNSTSVESSGFFNSGDGSASGFGNGGGSNSGFLNFATDSLGNSGFKNYGTLESGIANLGNSVSGVFNTSALDLLTAANVSGVSNFGSNLSGFFLAGDSADRIFNVGVANDGSFNIGSAN............... 1115
198 5.000e-20UniRef50_A0A2T5V8I9 Parallel beta helix pectate lyase-like protein n=2 Tax=Breoghania corrubedonensis TaxID=665038 RepID=A0A2T5V8I9_9RHIZ  ali  1191............TGAGISVSANTGGSVTFTSKVTTHTGSSAGVSLTSSSGFSTSFGGGLTIDTTTGVGLHANDGGDLNVSATAQDESITTAGAGNSILIENGTTTSSGLSLDRLNSDGASTAITVTDFSGAGSFTIGDATITNLGNTGLALSNITTTGAFTVADISITGGATGIVSVGGHTATLNLGTGTNGLSVDGSGQGATFSGAHSAVNLGTGAGGLQLGATTAIAGDGVFFATNSTGTFTVGNAGVTSQINVTSGSATADGIHYFLSDADITLTNVAISGGGGYGVLVSDNNGTGQVTLAGTNTIDGTGLGGVSSSGANVSLSGLTVGGTSAVGGAGVTIDDNAQNIVAGLSGVAVINAAGAGIDIDGTGGGSITIEAFGNNSVTTAGGAGVSLDTVTFDADGGTAGGGDADFTGDTVNGGTVGQGGTVAGAGVSFANVSGDVSFGAVDISSVGNAFTVTGTGALNAGAGTGFQLATTSGTISSSTGSGVYFDPFTANVTLTSITSNGGQGLVLDAIGGSFTVTGDVTVNGATGNGIDISNSSATVSIQGTTTVTSPGGDGIALTDNTGTVTFNEVTISDPNGATGGVGIDVEGTNAAITFGNVSITGLGDDDTGLDLSGATLTGALLVNSIAIQGVSSTATDVENSIGVNLTGVLGNQIVYLGSHATPASGPSASIVNLTGVLIDNTAAVQFAFGDGESASDVASVISVVAGGYTIDAGSGTLGASTFDFSDVTFTGDPNFPSATSYIFVSATATNGTGDGSYANPYSVSDADAILTSTASFVFLDGVYDFATLNGGNAFTLSGDQTAQGLAFANEVTGVNQPANIIGDFGGSLGGTITGGGSQEFTNTGNASVFDLQGNNRLSYVTVDASSLTGDAITASSHGGAVTIEEVEAINLAATSAMFSFSGLTGGVFVQDSQVTISQGTLFQISGGTATYTFDAGTIATTSAAGFLSVTGTAT................ 2147
199 5.000e-20UniRef50_UPI000C1ED3B1 autotransporter outer membrane beta-barrel domain-containing protein n=2 Tax=Snodgrassella alvi TaxID=1196083 RepID=UPI000C1ED  ali  79.................................................................................................................................TYTEISASGGAELIGEEGKKITAIGTTKVKKVINVDGGSTLNATNITTTNRVNSKGTNALAIAGSSIVDIDENLTATNMGNKADTIVNSGGSTLTVGKDLTINDEKGSNGIQNIENSTIGAENITITSKKVGFSNDGILNKNNSVIDVKQNIDITSEGSDGNASIENTDGGKIKANNINIIQGGKNYAIHQTSENSSITVNNDLTIKSGNIPEGNSTIKIEGGKINVKGKTTINTHVDPDFIDDPKKVSAISITDGTYEANGGANINIKDNDEKNFEDAAGVIIGNKGIFENNGTLTVNGGKNTVIATDLESGEEATFTNKADGITTSHADTIVHNSSGILTVNNDGTLYSDGDSVLKNNKNGDIVVNNNEASSVINGNIINTKDGNITVNNKNSASTITGNITNQDNGTVTINNSGKIQNDNTRNKIENSGTGSMDITNTGTIASDILNGNTGDITINNNKTSSVVNGETDYTNPTTINGDIINNNDGNITVNNNESTSFIKGGITNSQKGSITINNSGSISGSDDTKKITNSNDGEIIINNNHEGSFLSDIENDATSTGLISIKNEGHVVSHISNKNTGIIQIINKDSFGGSIENTGDILINNYNAFGSTINNDGNGTIVINNNENSSPTDRSSIGVINNNQSGNITVNNNGNESVIDSDINNNAENGNITVNNNTDSAIISGNITNSQAGSITINNSGLTVLYRKVTNSGAGKINITNNDKGNFQSAIDNDATSTGMITLNNEGTVNSKITNQNTGAIMIINNGTINGSITNTGTKNNVDNIWIDNNKDLNSTIENRDGSIVVNNNKEGSSFTGNIYNNS............................. 903
200 5.000e-20UniRef50_A0A2N2H5L3 Uncharacterized protein (Fragment) n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-21 TaxID=2013749 RepID=A0A2N2H5L  ali  864..LTGPVAINTGAGAGNILFGSTVNGAQDLTLAAGTGDITFNNAVGNTTRLGALRINSAADVTAGAITVGSLTQVAGTGRTTLNGAVNTNAAGGVDLTTNLIDVNNTITTTNGGVTFTNGGALTIAAAGDINADGAVVQNGAGAVSTAGDIQTSNDLVSFARAVTLTGPVAIDTGAGAGNILFSGTVDGGQNLTLAAGTGNVTFDGAVGDTTRLGDLTINGATGGVTSNSTIDATSVTIANGGGVVVRGRITSPGGFSSAGTTFDNTGGPITTTNNAITINHTGAVTIGGGLASNGGAIDIDATGAGATIALNAGITSGAGNVTLDSAGRTTVAAAGDIVTTTGDVTFGGTLAGALTTSGDVTTARGDVTFNRATVLGANVGVDTGAGAGNISYQSTLDGTVPDTQTLDLTAGTGNILFNGAVGSTVRLEALRIHSAGGITSNSTLAASSITITDGGANGAVTSPGGFSSAGTTFDNTGGAITTTGTGITINHTGNVTIGGALRSNGGAVDIDATGAGATIALNAGITSGAGNVTLDSMGTTTIAAAGDIVTSSGDVIFGGTLAGGLITSGDITTTAGNVTFNRATVLSGDVVVNTGTSSGNIIFQNTLDGTVDYAQNFTLTAGSRSILFNGAVGSNAALGTLTINSAAGGVTSNSTLAANSISIMNGGAADLNGAVTSPGGFSSAGTTFDNTGAPITTNGSPITIDHSGAVTIGGALISNGGAIDIDGASMGILGGINAGTGRVSLYTAQNIEGPGTIAGQSVDVNA..................................................................................................................................................................................................................... 1633
201 5.000e-20UniRef50_UPI000A00BB6B hypothetical protein n=1 Tax=Methylosinus sp. LW4 TaxID=136993 RepID=UPI000A00BB6B  ali  10  33............................................................................................................TIVNSGAIKGGAGGLGGSGAASGNGGAAIVGSGLIITNSXXXXXXXXXXXXXXXXVALDLSGTNRLTTLGAGALSGDIRANGGALTLDQTVAAAGNAAYANRIVDTAGNLNVVVDAGANAVT-LSNASNNQFQTQVKSGTLSVTNTGALGGGDLSLVAGGSTAPAFQLAAGAGAQSLTQNVTIDSGVSGTIGAGAGATLMIAPGVGKMLSLLGGAGTTVHFGSATSTGTLFLVPTLATVASAGAVSVDGGTLRLGNTQSAAAISGLTGGLNVGKDATTAATLDTGFSFTANNLTGSSKGVITNNFGGLATVTTNNSVDTTYSGVIGAGGQVGVNVKSGVLTLAGANTYGGPTSIDSAGTLKAGAVNALSQKSRTSVLGKLDLNGFNQTIDTVYLSGGRIRNGTLTSTDIVASPSGGIISTGGAVESISGSTGLRLTAGTTNLEGANTYSGATLVDGATLRLNSAKGLSANSALTVNWGGTFDLNGFNATVSGVGGQGTVTTNGGASKLTFGLGADSTFAGTQVSGGKTLTVTGQNIYSGTTQIDGGSGLTVAAGGAIGTAANHAGAINVDGTLLIKTGGAVDTGANNLTNQGTVTIEAGGRLTDDLVNSGVVNNSGLTTANLQNNATGVVTNKAPTGVWQGNVVANSGAIVNEAGANWIGNVNAGANTGAIDNRGVWTGNVGNNLGQLTNSGTISGTVANSGTFSNLAGGVVAGQLTQSAGTTTNAGNLNGGAGVTGGLLTNNNQIVGAVAVTGGQLDNNATISGAVDNSATFNNYAGGNVTGGLKTSGTATNAAGATISGGVNVTGGTFATQGVVNGGLTNSGTTNAQGTINGIVNN................................... 881
202 5.000e-20UniRef50_UPI0009B8F6D3 hypothetical protein n=2 Tax=Rhizobium loti TaxID=381 RepID=UPI0009B8F6D3  ali  41........................................................................................................................................................................................................................................................................................................................TGAGLGSWNNPLSWTAGVPTAADTATFDTVGVPAVGFGPGASSVGAISFTAGAVPYTFSVGGVGLASSLTLGGAGIQNNSTLTTPTFAVGGTLGGSGALTFNGTGTSAGNALINATANGTVNFAGTSTGANATITATLGGDINFAGNSLAGAAQIAVGGAGSTLNFNGSSSADNAGISVNLGGVANFTGTSTGGNAAVSVALGGAANFTGTSTGGNAAITLAGGSLGLSGLTSGGMSIGSLSGTGSVDLGAKALTLGGIGGDTIFNGTIGGAGGSLIKTGTGSLTLTGANTFTGGVSIGAGTLVAGSNTALGTGAASGVTLGNAVSLTGAGSATLDVALGTGTLNGAISGTIGLTKTGAGQLTLGGVNTGLTGGLTIATGSVLATNVDALGSGAGGIGQVTLGGGAALTLGAAGTFNNALNLGAGLGGTLSAGTGLNVTLGGGLNIGAGATLGLGTAASLGSLTLAGTSTIGAGATLSADFGSVKFGDASIGAQLSNATLNIGAAGTVDINGFGATIGNLTGAIGGSLTNTGGAATLNIDAGNFAGVISGNLGLNKIGAGTLTLSGVNTFTGGVSISGGGSLVVANNLALGLGGISLGAGSSFGIGAGTTLTNDLDVTGATSLDVSGGIGTLNGNITGTAGLTK......................... 695
203 5.000e-20UniRef50_UPI000CF115AC autotransporter domain-containing protein n=1 Tax=Helicobacter aurati TaxID=137778 RepID=UPI000CF115AC  ali  13  36..................................................FYSQNMGSTWSSLGANFIQNYQNGTLII----GNSSKSPAQNNRHWFGTGGWLGYINATFNVKEAY----LTGIIGSGNNARTGGGANLIFNASNLLTLDGATIQIYKAGTQNSTTFLYGNTIDVRNSSFILEGNLAGGGLNTVRLGSDATRQIMLKNTSIRFDSITDVGPVLPQLIIKSNSNQSEIDFSSITGKRGRITFEKDQYKTFSAQTVNVEDIHINSNRIKFHGDIRGGTFKLGTDADTYFNASTLIVTDNSQITANRFNVDAIESNLITRTNRELTLNSNNQIHIKELRNSDYVAFQTGGFTATLKTNARTEI---DKITMRNFTAGNTMNVETSGNNNLIVGSL----NYVTDGIAGSSARVKLQALD---------------GNVILRDVSGCNSLCVGSQGIRALNFLQIVGKNFYAGKVEAMGLVTAGSNSTLDARQVNGTTFIDDFYIRSGTLYASDFHINNFTVWKGNANAGSAFSAVDYHIGKSFINYLSLEIGTSHTADSAALWQGGEILNYNLIDARSTSYLNMSGINQVNINQLTATETSFYLK---NAIFNTIINKKGQTI-ISSDTQIEANALNINELLWLKDGSKNSGIINIRLNGNQDVNQDFSKYLSVNVDSTGLKAMNKEQL---QTLITESARGTTAPQSDYQNASGTYITTKDNKHY......................................................................................................................................................................................................................................................... 695
204 6.000e-20UniRef50_A0A126S9J8 YapH protein n=1 Tax=Pseudomonas putida TaxID=303 RepID=A0A126S9J8_PSEPU  ali  10 2158..ITDLTVQTAVANQVNLVVGGASNVLFWDGSQSVANGQIDGGSGTWDAINTNWTDVNGVLNSTWNDTFAVFQGAPGTVTVNGNHSITGLQFVTDGYVLNAGIAGELLGNGTTNLRVDNGVTATLNVALNGTGSVAKQDGGTLVLNAANGYSGGTALNGGTLVLGN----NSALGSGTLTAAGGTTLDSNTAVTLANTTVLNGALAIAGSNDLTLNGVVSGTGGLIKNGAGLLTLNGANTYSGGTQINAGGVVGNTTSLQGAILNNGALTFAQNANGSYTGNLSGNGTLAKNGTGELLLTGVNTFTGATSVNAGTLLVNGRLDSTSVQVATGARLGGSGTYGGAVQIANGATLAAGQSATPLTVGSLDLASGSALDFSLGAPAASTTVNGNLVLDGTLNITDAGGFGTGVYQLFSYGGTLTDNGLVFGAIPGSVVLGDLSLQTAIANQINLVVQNYGEELQFWNGGKTNPDGSIGGGSGTWGSNTGWTNAGGTSSEGWSGGYAVFGGTPGTVTVVGNQSFDGLQFLSSGYQVVPGAGGSLTPVNDTDGSLASVRVNAGATATISAPLVGTGGIKLDAGTLILSGANTYSGGTTVSGGTLVGNTTSLQGNILNNANLVFAQGSNGTFNGTLSGTGTTTKQGGGTLLLTGNQPFSGAFNVNQGLLQVGDAAHPGSTLGAQVTVANGAALTGNGTVAGLTNNGTVLPGPAGNLNVSGNFTNGATGTLVIDLATSPVNYLNVGGTANLGGSLMVANLASGNGQYTVVSAAGGVTGTFATTNLANSAFLNSSLNYGANQVTLSVSRNGTSFADVAATGNQRGVATALSS............................................................................................................................................................. 2979
205 6.000e-20UniRef50_A0A1Z2F1K7 Uncharacterized protein n=1 Tax=Lactobacillus casei TaxID=1582 RepID=A0A1Z2F1K7_LACCA  ali  10 1426...............ATAEYAKIASESAIDAETAAKNASIAADAAAKAAASWPDDAAISSAAQSASTAASNAASYAVQASSAAVVATSASIEGNNSVASSAADAASTAASLASSEAVLASEENSKAQAKAAANTAANNHGSGNTGSNNSGDDNTGNGNTGSNNTGDNNTGNSNSGSDNAGDNNTGNSNSGNNNTGDKNTGNSNAGSNNSGNNNTGDDNTGNGNKGSNNSGDDNSGNSNSGSNNTGDNNTGNSNSGNNNTGDDNTGNSNSGSNNSGDNNTGNSNKGSNNSGNNNSGDGNTGNSNSGSNNTGDNNTGNDNTGNGNKGSNNSGDXXXXXXXXXXXXTGDNNTGDNNTGNGNKGSNNSGDXXXXXXXXXXXXTGDNNTGDNNTGNSNKGSNNTGDSNSGNNNAGSNNSGNNNTGDDNTGNSNAGSNNTGDNNTGNSNSGSNNTGDDNTGNGNKGSNNSGDSNSGNNNAGSNNTGDNNIGNSNSGSNNTGDDNSGNGNKGSNNTGDSNTGNSNSGSNNSGDNNTGDDNTGNGNKGSNNSGDSNTGNGNSGSNNTGDNNTGNSNSGSNNTGDNNTGNSNSGSNNTGDNNTGNSNSGSNNTGDNNTGNSNSGLNNSGDNNTXXXXXXXXXXXXXXXXXXXXXDGNTGNSNTGSNNTGDNNTGNSNSGNNNSGDNNTGDDNTGNGNKGSNNSGDNNTGNGNKGSNNTGDANTGDGNSNTGNGNKGSNNSGNNNSGDGNIGNSNTGSNNTGNSNKGSNNTGDNNTGNSNAGSNNSGNSNTGDNNTGNNNAGSNNSGDNNTGNSNLGSNNSGDGNTGNANKGSNNSGDGNTGNSNSGSDNTGDNNTGNSNSGNNNTGDDNTGNGNKGSNNSGDNNTGNSNAGSNNFGDNNTGNNNAGSNNSGDNNTGNGNTGSNNSGDNNTGISNIGSNNSGDNNTGNDNTGSNNSGYSNTGNSNAGSNNSGDN................. 2397
206 6.000e-20UniRef50_A0A2T5J116 Hemolysin type calcium-binding protein n=1 Tax=Agitococcus lubricus TaxID=1077255 RepID=A0A2T5J116_9LACT  ali  11 1228......................NLTLLGSLALNATGNSGNNIITGNSGNNIIDGVTGIDTLIGGGGNDIYLVDSSTDVVTEQLNEGTDTVNSSVSYTLSANVILNLTGTGAINGTGSVDNNQITGTSGDNVLTGMTGNDTLIGGEGVDTYVFNVGDGQDTIDNLQTTIVNDKIVLGTGFTAANLRLNRYGDDLILTFLNSVNDSIRIKNQFNNPAFEIKIVQFSDNSTFNISTTNTNYTLYSTGTAAGESMYGFAGVDIMATGDGDDFAYGADGNDSIDGGNGIDSVSGENGNDTVSGGAGDDFVYGDAGNDSLVGGDGNDFLDGGVGIDTMLGGLGNDTYVVDEATDVVTEVASQGTDLVQAKVSYTLSANVENITLLLGGENATGNTLNNVLTGNNAGNILDGAAGSDTMIGGLGDDVYVVDNAADVVTELANEGTDTVKSSLTYTLAATTLTGTAVINGTGNALNNIMIGNTANNSLTASAGDDTLDGGTGADTLVGGTGNDTYVVDNIADVITELANEGTDLVQSSVTYTLAATLENLTLTGTAAVNATGNASANILIGNAGNNTLNGAAGTMTGGLGDDIYVVDSTGDVMTEAVNAGTDTIQSAITYTLGVNFENLTLTGTAAIDATGNTVNNVLTGNSGNNRLDGFAGADTMIGGAGDDIYIVGNVADVVTESTSAGYDIVESSVTYTLSNNVEQLTLVGSQALNGTGNSLANTLIGNTGINRLDGATGADTMIGGLGNDTYVVGNVGDVVTELVGEGVDTVESSVTYTLSANIEKMILTGELIINGTGNDLANTITGNIANNSLFGGAGNDTLSGGDGNDLLDGGEGNDALTGGLGNDIYVIDAASDSVTEAVDSGIDTVRSNLTYTLGINLENLLLLGTNALNGTGNSLNNTITGNTANNSLSGADGNDSLVGGAGADTLIGGLGIDTMAGGADNDNYIVDNIADIVS......................... 2168
207 6.000e-20UniRef50_A0A2K4Y8T3 PPE domain-containing protein (Fragment) n=2 Tax=Mycobacterium ahvazicum TaxID=1964395 RepID=A0A2K4Y8T3_9MYCO  ali  10 1228..........VNGGLNVYTDASFTNSGTLTNLNSGSNFTVYGTLTNSGTLTDAGVFDNEGVLANNGSIIVQSGGNFLDDGILTNEGAVAIDHGGTFYVSAGGTLNDGGTITSSGNLYNAGTFHVADGGTLTVDTGGFLDDSGTLAVNDGGALTVNSGGDLYIETSGILNDGGMFTVTDGGTVTDLGTFSVDSGGTLTVDHGGSLAVGHGGAFLDSGTVNDFGTFNVTDGGTATIDPSGTLTVDPGGILTVNHGGVLSDSGSLSAFPGGTINDDGVLTVNAGGTITVDDSG--ALTVSNGGTLTVADGGFVTDGGTLTDFGSLTIDSGGNINVIADGSLVSENGGVVTDGGMLTVNDGATLTLGDGGSLTVVDGGTLADAGTVTVDLDGNLIVNSQGILTVSDGGVLVDYGTLTDSGSLTVDSGGVLSTDGGTLTVADGGTLTDGGFLGVTDGGTLNVDSGGAVTVGNGAVLDLN-PGASLSDGGTVTVQAGGTLDDAGVLTIDQGGSLANSGTLNVFPDSGLNDFGTFTNSGTLTNTGTLTVDAGGTLTNDGTFDDFGFVSNSGTLTLDHGSTLTVYPGSSLDDYGILDNYGTLTVNNGALTDPGVLAVHAGGALNDYSHLIVNLNGTLNVDTGGALNEYGTLTISNGGILN---DTGVLTVNNGATLIDAGTLNVDASGVLSDSGTLTVSPDSFLANAGTLTVNPGGVLTDAGSLTVGPGGLLDDGGSLIVDPGATFADQGVVAVGPGGTLIDAGTLTVDGGATFGVGDGGSLTVSPGGSLVDGGIFTDGGTVTVDGGGSLALADGGTLTVSDGATLTISPDGTMTVGVGGNGATATLVVDSGGTLAVDGGGYLTVNAGSSVPITDGGSFTVGVGDIIT..................................................................................................... 2091
208 7.000e-20UniRef50_UPI0008FF9FE8 hypothetical protein n=1 Tax=Cedecea neteri TaxID=158822 RepID=UPI0008FF9FE8  ali  1347...........ITNLQTQLNEGAVGLVKQDATTREISVAAATDGTSVTFANASGVSRTLSGVADGELSATSNQAVNGSQLFATNNQVTTNTGNIATNTANIATNTANIAGNTASIATNTTNLGNVASSLGGGAGIAPDGS--WTAPDYAVQGGNYSNVGAALGALDTATTGNSTAITNLQTQLNEGAVGLVKQDATTREISVAAATDGTSVTFANASGVSRTLSGVADGELSATSNQAVNGSQLFATNNQVTTNTGNIATNTANIATNTANIAGNTASIATNTTNLGHVASSLGGGAGIAPDGSWTAPDYAVQGGNYANVGAALGALDTATTGNSTAITNLQTQLNEGAVGLVKQDATTREISVAAATDGISVTFANASGVSRTLSGVADGELSATSNQAVNGSQLFATNNQVTANTVSIAGNTASIATNTTNLGHVASSLGGGAGIAPDGSWTAPDYAVQGGNYSNVGAALGALDTATTGNSTAITNLQTQLNEGAVGLVKQDATTREISVAAATDGTSVTFANASGVSRTLSGVADGELSATSNQAVNGSQLFATNARVSTNTTNLGHVATSLGGGAGIAPDGTWTAAVQGGNYANVGDALSALDVATTGNSTAITNLQTEINNGGLGLVKQDATTRDITVAAATDGDLVSFTNSTGNTRTLSGVTAALLSSTSTQAVNGSQLYAANNTIVNILGGSAALDGNGNITGPTWTIQGTTTNNISQALASLDNSVNDLKKEAQSGGGKIVTQPDPKDTVSVGGHTGGTSVSLTGQEGDRKLTGVANGVNDNDAVTVAQLNALSREVVAASKQLAVNVSDSVTPASATGADSIALGGNANSSGTNAISIGNGAAASGSGSSAVGASSSASGTNATAMGQNSNASGANSVALGSSSTASGSNSVALGANSVASRDNSVSVGAAGNERQITNVAAGTQSTDAVNLGQLNSAQQQNNRA........................... 2290
209 7.000e-20UniRef50_E6NK01 Putative vacuolating cytotoxin-like protein VacA2, N terminus (Deletion of central part) n=2 Tax=Helicobacter pylori TaxID=210 RepID=  ali  24  2...................YANNLWDLLNPKVGGEYVHWVKGSQYCAWWEF-AGCLKNVW-------------GANHKGYDAGNAANY--LSSQNYQAISVGSGNETGTYSLSGFTNYVGGDLTINLGNSVV-LDLSDSNSFTSYQGYNQGKDDVSFNVGAINLNGALEVGNRVGSGAGTHTGTATLNLNANK---VNINSNISTFKTSQVNIGNANSGSVSLSGDTCSSLASVVGANCSTSGPSYSFKGATNATNFSNASGSFTFEENATFSGAKWNGGGI........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 251
210 9.000e-20UniRef50_A0A0E3YSV8 Uncharacterized protein n=2 Tax=Verrucomicrobia bacterium IMCC26134 TaxID=1637999 RepID=A0A0E3YSV8_9BACT  ali  615.............................................TNNWKLTSANTTTTFLAADDALFNDNATGAGNIDTANVAPASTTFDNTTKDYSLIGAFGISGGTLTKTGTGNLTISTPNTYTGATAINGGTLTLSGNGTLGTGSTLTLGGGNLNLGGTSQSVGAVSVTTAAASGDTISNGNLTGTSYSVSNAAGNVGISAANGSAGLAKTGNGTVTLSGANTYTGATAINGGALTLSGSGTLGTGSALTLAGGNLDLGGTSQTVGAVSVTTAAASGDTIGNGSLTGTAYAASNVATTATISANLLANGAAGFTKTGNGTVILSGNNTYTGNTTVSAGALNVQSANALGSTAGSTSVAANQVLQLQGGVVFAAEPLNLLSNSGSNVALQNVSDNNEWTGTISSVSVSPINTLNISSDSGLLTLSGTMTSGVGSSTTGAPFLLRGAGNITISGQITGLAGVTSSPVTAPNLLANPGVRTLTNNANNYTGLTTVTGGTLSFSSIKNADGSPSALGAPTNATNGTIAIGSGNATGTLVYIGTGDTTDRILSLAGTTGNATIDQSGTGLLKFTSDLTVTGSGEKTLTLQGSTAGMGEISGAIVGSATSLTKLGSGTWTLSGANTYSGNTTVSSGTLALNTNSTSSISVASGAALQLNLANSLTTTGTLNLDSGSTVTVVGTPVGATTYSLLSAASVTGTPALTTPIAGFALVVDGSTLKLTPSAVSDTTPPVIAAAAPASVNWGSTYTDVPPTATDNLDPSVTVITSGTVNTAKPGTYTLTYNATDAANNAATPVTRTVTVSILNPTTVEADGYTPLMRYALGATSPSGTVEAPVTNATATTLSITAVVRTDDAKLTVVAKTNTDLTLPASWTATGVSVTAAGSQTG.............................................................................................. 1463
211 9.000e-20UniRef50_Q8RIV2 Vacuolating cytotoxin (Fragment) n=20 Tax=Helicobacter pylori TaxID=210 RepID=Q8RIV2_HELPX  ali  61  1.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PWNYFDARNIKNVEITNKLAFGPQGSPWGTSKLMFNNLTLGQNAVMDYSQFSNLTIQGDFINNQGTINYLVRGGKVATLNVGNAAAMMFNNDIDSATGFYKPLIKINSAQDLIKNTEHVLLKAKII-----GYGNVSTGTNGISNVNLEEQFKERLA................................................................................................................................................................................................................................................. 152
212 1.000e-19UniRef50_UPI000D71A1C0 hypothetical protein n=1 Tax=Hoeflea marina TaxID=274592 RepID=UPI000D71A1C0  ali  22..................................................................................................................................NVRGALFASSALTLLALAVSASPALAQSTWNGSVDSDWTADANWTPAAPGPGDLAVVSDGGAPSQPVVTGIETVDTLDLSAGSVTIDTGGELTAVSAFDLSGGTLNGPGTLATSTTTMTGGLIAGDAVVDTLTFAQTGGINLGTVTADFAVVAIGGAVTSIGANGITASNASASGITVTTSASGQIVKAGSGNGITLDNSTGGDVLVTLGADIEVANGDAINVVSTGGGTVTITGTANLVGGTSDGQDGIDITSDGDTFVSLNGDINGDPGVVFNSAAGADFTLTGSGNVTGGAGEGVFANTTGGDGNVLINRDGAILGDTTGVSSDGGTGTGTVTVTSFAGQSITGTNAAGVITRTDLGQNTVDGAGSISGVTFGVDAQSIGGGVTVSGTGTTTSSGAGSTTINAQITGVGAETADLLVDRSGLISNTGAGSTIGINATSNLTGSGDVTVTGAPTINIAGTGSTAIYVGLNVLGATGVVTVDAGVITSTGTGNSGGINAFTSSGLLDVDSAGVTLSAVSSGIGIRAYSAGNGNITVDTSGVINGGGTGIFAQASGVGTATVTLGADVGDITAPSAAGVEVSTQSGLATVDGSGNVNGTTRGIDAQSLGGGVTVSGTGATTSTGAASIAINAQQTGAGAESTNILVSRSGTVTNTGSGGTIGINATSNLSGSGDVTVTGISAVNIAGNGSTGIVATISNAAASGAVVVNSGLVTSTGTGASGGIRATNLGSGAVDIDSAGVSLLGVSVGTGIASSATGALTVDTSGTINGGNVGIDAASSGANVTVTTAAAIGDTIAPSDVGISATVATSTARVTNNAAVTSGTNGITATATAAGNVTVDGSGSVTGT... 874
213 1.000e-19UniRef50_A0A2V5BAQ8 Uncharacterized protein n=2 Tax=Novosphingobium sp. GV010 TaxID=2135477 RepID=A0A2V5BAQ8_9SPHN  ali  29.....................................................................................................................................................................................................................................GTGNTAVNPVVVTCVSDPGNFATGITYDQSTYATPAGIQVTLLPTVVVATPVATGVSVTGTANNLAGITTPISGLGRASVTATSTGLFATTTGTGATSVTSSANVTSGQTGLYALADVTGGTGTATATNQSLAAVTINLIAPVTGYGVLARGGSAVAGNDGTITATNTVAGSTAYGVAAGSFATGGTLSAGNTGTITISGAGTGIGLASLTSTGTVGLSNTGTLNVGSTVGGATGLVAAGGTAGAVTATNNGVLGVNGTTTSTGFDVEQGTAVTITNQRTGATGSFAVNGGNATGYLVNNATGAVNITNSGFAAQVTGTGTATGVNVNGGSSQSVTFAPVTIGGTTYVGTLTVNGAGTATGVSLANATGASTTDLSGANLSVTSTGGAATGLSLSTIAGAATIGTAAVTVTGATGATGILTSGVAGNTVVNTLSVTATGGTATGLSLSGAGGQSVALGKAATINGDTATGASFSGSTGTVALNAYDTLTVTGTTGDATGVSLNNGATDTAHFYNTLNVTTNNGAATGVASANATGSVAITADSDLLVRSQSGVATGIAIGAGTDENIVLSGLFNVRGSSTTSGVSQTGTGTLSLTALAGYSVVSDSGAATGASQTGGLNQSMLIVGATVSGSAGTTGLSQTGTASTNDIHTTGALTVTDATAGATGITQRNGAVQTVEAGGAIAVTGAAGNTFGLNLQTTAGTSTATLTGALSATGAGGTTAGAYVQGSAGASLTANNT............. 771
214 1.000e-19UniRef50_A0A090G2U0 Uncharacterized protein n=5 Tax=Mesorhizobium TaxID=68287 RepID=A0A090G2U0_MESPL  ali  10  332..............................................................................................................................................................VSDTTTRVAINAATNTAFGNFFFADGGNSLGLGTIGDPTTLDDAVTKAGGNGFIVALGGSGNITTGGVNLAAGQTVIGGGGGVQAKLANGSIGTYNFGGSNGTIQGTNAANPVITLASNNTLSNLTITGGADGIFGNNAAGTRLTDVTVTSAGGNGADFTGNSTSVTASNFTATGNGLDGLHIEDNGTYNFTGTTTLNGNADDGLDITGQGTYTFATVNAQNNSDRGITVQGTSSGGSFTITGGTISGNGGTAVFITAHVVLDSITQSGGVSGVILDQVSGSFTVNGATTISNTTGPAIAITASPASIRFGDINITNPGADGLSFTGVNAAVVAGNIVISGLGAGSGLDFFGSQTNFTAQSLNLTGTGAAGSIGLDLANTTGDASIIITSGGSISGVDTGVRLGISGSLANSANAEFTFGGGSIGITASLDARGLNQTLGHYAFGSTTFSGPQLFEQQNVIFVGASATGAGDGSSLLDLASIATADANTDGTAIFVLVNRGTSIDAAGGFTLSDGQTLASFGNGRTFSLGGVPVNVTGDNIQHDQVVSDAGGAATLTNSGAGDVVTAGSGSALLDFNISGGAAAGIQATGIAGLTVQGVSVSNAALGLVLNSVTGTISVDDLTIQNPSQFGIELVNTGATVNFTGNMTVTNATGAALLANNFDGTAAFDDLDISGGGGGVAILNGSDGTLTFGAASSITNTGSESFGIGSSSANVTYNGTINQTGTGSAVKISALTGGSAT--FGGKITANITGPEAINLSGNTGSTINFTGGLDLTTDGGFGFSAVNGGTLNVTGTN......................... 1131
215 1.000e-19UniRef50_A0A099VHM9 Uncharacterized protein n=2 Tax=Helicobacter TaxID=209 RepID=A0A099VHM9_9HELI  ali  15  18.............................................................................................................................................................................................QKGVNIAIACGATLLLCNVSYAETVSLGGGGTDSWTATCRGWLCNLGGSAAYDTINIQGGDGSGSYNFDSIRMQTNNGSVTLDINSDRPDSGKITIGDLHTWSTGTFVAVNTLNVNADTYIKSYLYSWAAPNKGYLDVNVGSNGNGSYTKLQVDNISFEHNGLHTNQGTIALRANNITLGTVAGRLSHILNVEADGNITANNVYFDTIPKSSISFTAKGGSFMANSGHSNVWVKARDQVKIENVSFIVDICITEACDVIVGSVSGGTSNESGIGSFNTLKVIGNNFYAGHVEAISLVTALNNSYLDLSGVRDTTFIDNLEFRNGTLKAQDFHFNNFTVWKANANDGSAYTSVTTNIGKSFINYLSMELGTSDTADFAALWGGGDILNINLIDARATSYINFGSINNVNVDTLNGIETSIYMKNG---IFNTITNKKGQT-AIASNTKIVANALNVNELLHIKDSSKHSGVMNIELSGNEAVNQDFSKYLNVNVDSEELKNMSGSEIA---DLINKAQENSNANVTDYKNASGTYVTTSDGKHYLILPNIDASNGN............................................................................................................................................................................................................................................. 604
216 2.000e-19UniRef50_UPI000BA38266 autotransporter outer membrane beta-barrel domain-containing protein n=2 Tax=Pseudomonas TaxID=286 RepID=UPI000BA38266  ali  2...............................................................................................................GSGKLTAAGGTLDNTTALTLGNALTVTGNLTLAGVQNLVLGGVIDGAGSLTKNGTATLSNTNTYTGGTTLNGGKLILASNGALGTGDLTANNNVALDNSIALALANNVHLLGALGIGGSADLTLNGTVDGAGQLTKNGAGVLTLNGNNSYGGGTMLNAGGLVVGQNGALGTGALQVNGASTLSSGNSAVVLGNNVALNASLAINGANDLGLSGVISGGGEVVKSGTGTLALTGANSGWTGGTVLNGGTLSINNSAALGTGTLTTNGTATLLVSQALAQALSNAIVVNGDLTLNTADALTYAGQLNGNGNLTKDGAGELILLPSASPFSGTWNVAAGTLTSFGAGAIGSPSLINLGASTTLNISGNTSIGALTGSGTTNIGAGSILSVGGNNGDSVFAGAFAGNGALSKVGAGVLELSGTSSLNGSSTVNAGTLKVTGALNVGSLTVNSGATLTGSGSLGGLVSVANNGNLSGTSGNTLSFGSLVLAPNSQVNVALGSPVTGNVPLFSVASTLTLDGLLNITDAGGFGNGVYRLFEYGGALVNNTLSFGSLPGAVTAGSLQLQTGNGQVNLAVNSPDLILQFWDGAGTVPNGTIEGGSGVWDSTTTNWTLFDGATNENWLSKFAVFQGAAGVVSVNGTQTVDGLQFMTDGYIVVDGNAGALNVVNRNGGLFAVRVDPGVTATVNGTGTLNKLDTGTLVLNGNNGYTGGTLLSGGTLVVGSNSALGTGNLSTAAGATLDSNKAVTLANNIGVTGQLNLAGSNALTLNGVVSGTGSLVKNGSGRLTLGGTNTFAGPLALNAGSL-VLASDGALGAGALNAANGTQLDVSSARTVANTVNLAGSLTLLGSNDLTLNGLVNGSGSLLKQGNKTLA 876
217 2.000e-19UniRef50_A0A0B4CZB8 Uncharacterized protein (Fragment) n=1 Tax=Tateyamaria sp. ANG-S1 TaxID=1577905 RepID=A0A0B4CZB8_9RHOB  ali  10  27..........................................................................................................................................................................................................................................................................ATELVFVLATGAMLMVGASANAQDTLTWDGVSVGAGPSDNWNLLDDNWLNGAAREAWTNGDNAVFDDAATVTIDELGGVTAQNVDVNVDGVVIQGSETLDVDGTLTVNTGTTTVSATIAEGLVTAGTGNLNVNGGVTGTTGSGTVTLNSSANELDHDSGTTIIGGTGSVTTTTNIAAGTVTNTGTMTGLATVSGGTLNSSGTLTAGANNTGGTVNITGGTAGAVTNASTLTLSGGTTASVTQSTGSTTVSGDSTVTNLTDINGGSLTVNNGITLTATGGVDIASGATGAINGIVDGTLANAGIATITGDVTGNVTNTNDLDLNGGSVNGIDNNGGDVDVTGGGTVDTTITTNGTFNVNSGTLVVTGDSTTNENGGTLTIAGGATLDSNTTNDAGGTLTVNSGTIQGNVTNNGSANLNGTVSVTGNYTQSASGTSSTTVNGTTTIDGMLDISQGALNVTNGSSISATGGTTSMGGMIDGQVTGDLASTGDVDVGVNGVVTGTLTNGVGSSNAGTVNALVNDAGTFTNTGTVTTTTTVNAGAVTNSGTMTGLATVNMGGTLTSTGTLTAGATTQSGGALNINGGTSGDVTNGGTLSIGGGSISNVTNTNVTNVTGNGTVTGTFANSGTTTISDGVTLSANTINNTGGSISIGENATLAGTGNTLNNGAPINVADGGTVTDAGAINN............................... 714
218 2.000e-19UniRef50_A0A261TYZ3 Uncharacterized protein (Fragment) n=1 Tax=Bordetella genomosp. 5 TaxID=1395608 RepID=A0A261TYZ3_9BORD  ali  3..............................................................SGGDAFRTQVSAGGRQTLSSGGVTTATTISNNGIQTVLSGANVLSTQVMSGGTQTLSGGTATSTTISAGGTQSVDGGQASNTRVSGGLQTVASGGVAISTILYDRGRQGVESGGQASNTLLSGGGVQTVSSGGTATSTFVADGARQAVQNGGQASNTQLLSGGYQVVSSGGSATSTIIGNRGYQVVREGGQAIQTHVSSGGDQQVSSGGTATSTIVSAGGRQTVSGQADYTRVSSGGSQSVHADGRATSTIVGDGATQTIYDSGRATSTQVSSGGWQRVLEGGQASDTQVSSGGIQTVTSGGTATSTTVSDGGSQSVQTGGQASNTQVSSGGVQTVSSGGTATSTTLSSGGSQGVESSGQASNTQVSSGGVQTVSSGGTATSTTLGSGGSQGVESSGQASNTQVSSGGVQTVSSGGTATSTSLSSGGSQGVEGGGQASNTQVSSGGVQTVSSGGTATSATVSNGGEQVVQSGGQASDTHVSSRGAQIVSSGGTATSTTISNGGSQVVYGRADHTQVSSGGSQSVDSNGLATSTIVRNGGFQTVSGFALASDTHVSSGGTQTVQASARVSNAHVSTGGVQIVSSGGRAVSTTVSSGGSQGIQGRGDASGTQVSSGGVQTVSSGGTATSTTLSDGGSQGVQGGGAANDTQVSSGGNQTVSSGGQATSTSVKQGGSQGVQSGGQTSDTQVSSGGTVSSGGKATSTTLSNGGSQGVLIGGEATSTQVSSGGVQTVSSGGTATSTTLSTGGSQGVQSGGQASNTQISSGGNQTVSSGGTATSTIVSAGGSQGVQSGGQASNTQISSGGKQTVSSGGTATSTQVSSGGDQVVSAGGSALYTVVSSGGAQWVSSGGYTSGTTVQSGGQENVASGGSAIGAAVSSG......................................... 882
219 3.000e-19UniRef50_UPI000225C16F hypothetical protein n=1 Tax=Candidatus Odyssella thessalonicensis TaxID=84647 RepID=UPI000225C16F  ali  31................................................................................................................................................................SLASANTLNRWNTQASLGSGMTFAAGIAVDTSGNVYVTDRANNNVYKLTPSGATYTQSTLLTGFNDPKSIAVDNSGNLYITDSGNGNVVKATLSGGTYSRSNIITGIGGLNGVACNSTGSTVYVTKNGSGAGVIRGVLSGGVYGTTTIASAGLNNPMEVTADSSNNVYVADFYGNKIFKETYNAGSYSQSQIDSGGLNAPYGAVVDSAGIVGNTASILALTPAGGGTYTQSTFAGISNPWGLAMDSSGSLYVARQSNNVTRIDINRLNITQPTTSGGTVTLSNNSTYTQIDGVANSQISIGSYQLTANISSSAPSTFNGNITGTGPLIVSGTGTFTLTGTNTYSGTTTISSGTGDGTTTGSITSNVTNNSSLLFNLGSSNSTYGGVISGTGSVTKQGAGTLIVTGAHTYSGGTTITAGALQIGNGGTTGSLSGNITNNAALIFNRSDAITFAGIISGSGSLDKQGASTLTLTGANTIGGTTITAGTLQVGNGGTIGSITSNITNNGALIFNRSDAVTYAGTIAGTGTLDKQGAGTLTLTGDSTYTGNTTITAGVLQIGNNGTTGSLVSDITNNGTLIFNRSNASTYTGNLSGSGALSKQGTGILTLTGTNTHSGGTTITAGTLQVGNGGTIGSMTGNITNNGALIFNRSDAVTYAGTIAGTGTLDKQGAGTLTVTGAHTYSGGTTITAGVLQIGNGGTTGSISGNITNNGSLIFNRSDAITYSTIISGTGTVNKQGTATLTLTGNNTYTGGTTITAGTLQLGNGGTIGSITGNITNNGALIFNRSDAVTYAGTLTGTGSLTKQGASS.............. 845
220 3.000e-19UniRef50_A0A257Q2M2 Uncharacterized protein (Fragment) n=1 Tax=Acidocella sp. 20-57-95 TaxID=1970301 RepID=A0A257Q2M2_9PROT  ali  754.........VLYSGIGRSTTTAAGSIGTLTNSGVIEATGLNVVYSSITGTIDLAGINNQGFIGGLTNNATGTIMGAQTGIANFGLINSLTNNGKIIASGSSGIQNKGLINTLTNNGFISGGSSGINNYGGSILRLTNNGNINGVSKAGVE-NANFNGTIGYIGTLTNAVGALIEGGNTGVYNVNGTIGLLSNSGTIYGINDSGVANGGYLGSLSNLAGGSIFGAGYGLYNTGSILSVSNSGLIDGIHAVGILNVGSIVSLTNSNLIEGYGAGVANNNPGSNISTLTNMGTIIGGHFTGIYNNGTIGLLSNSGAIMGEYVGVSNLGTISNLTNTGLIEATGATIATSGGPSVLAFLRSANTGVANYNTIGSLNNLAGGTIFGGYAGVLNNYFGTIGQLNNAGVIANGTIGGSSAAAVSN--------DGHIGTLSNTGLISGYYTAVYNNYAGSIGLLSNSGTIYAATNVAIVNNGTIGALTNSGLISSNLAAIVNNGTIGALANNGIIKSNYSAAIANYGTIGALTNNGVISAYAYTRAIYSSGTIGAITNTGTISGGTGIYIKNHGTTITNSGVIIGTGGTAINLEVASALILNTGSDIIGTIYGGGSGSSSTITLEGSDAMSNTFAGFTPGALTVAPGANWEADGRWTIGSVTNNGNFEGGKPGAPLDLTGNFINNGNLVVVVTPKTSSQFVVDGNVTLAGSSVTYELAPGIYGGVKDYQYLTIPVNGTIAAGTISGSFASQTITSAAAGNYSTTIVSDPSANLLISGSFTVDPVDQSIFGDQAQALAGATQDVTSDILGKATEGGSNADPACAAQSPATLANLANSNNVANASRMASTLANVFCGEGGWVAATGSLN......................................................................................................................... 1595
221 3.000e-19UniRef50_Q65UK5 Uncharacterized protein n=1 Tax=Mannheimia succiniciproducens (strain MBEL55E) TaxID=221988 RepID=Q65UK5_MANSM  ali  10  72................STVTNWNGAVSVSLNGASATGASVPYNYHTPNNENYPDQGNNSNSSNIYSGTLSAAQSIAIGINATSQSGSIALGDNSRATGGLSLALGAFSQTNQAGAIALGTSALASGFNSFATMRQAAATADFAIAMGTAANANATNSIAMGSSALALGNQSIAIGSAAMEKKVGSAGGESYRTDYVGTTNTKAQGDRTIAFGVNTSTTSNDSIAIGSNSKTNSGTGAIAIGWCSSTSYQDSVAIGSNATANGGYSLALGYNATSTNLTSISIGWNAAASNTGGGHSQGAVAIGPKTTALGNQSVVLGASASAVEQATAIGNDSKANGFGSIVIGGDDTGYSRNPNSDPYTPTALGGERIGYLANTATGDNSNYRSSLSSGIGSVVVGVHGQALSNGSTAIGVYSTAGDNGITFTNDTTSTTAIEATAIGALSRAKSIRSSAIGY---SAEALGNYSTVVGANSTANGTSSLALGHNSTAYSTYSLAAGYNASANLSNSTAIGSSSNASGLNAIALGTGAQALNTNTISIGTGNIVSGENSGAIGDPNNITGSNSYALGNNNVIYANNSFAVGNSIYISDTAQNTLAFGTNISVPTSTKTNNTLIGTSAKIQGGESSIAFGTNATVSNSVQSSAIAIGNQSKVEAAVGGIAIGNGSTISSSANNGSIALGQKTNVTGVSSIALGNNASVTGTQQGSVAIGNNTNVTNTGQGTVAVGSDTNVTVGNAVAIGDHVNVKGQRSIAIGSSSNVAEGVVNATTIGTGSNVTQNDGTAVGYNAIVSNYNGLALGANATSTAQRAVALGADSVAGREGWDQAAYDPYIPANANTSQSAAITATKATNNYGAVSVGSDTVKRQIINVAAGSADSDAVNVAQLKAAIGSVNTSWNIQENGTQKDIVNAGDNVSFANGTGTTANVSVDSTGKTSTVKYSVNKSGLSVATDGT.............................. 1003
222 3.000e-19UniRef50_A0A1Y2QKI5 Uncharacterized protein n=2 Tax=Sphingomonas TaxID=13687 RepID=A0A1Y2QKI5_9SPHN  ali  10 2078.........SLNGGDLTLTGASANIGGWTVTDGTLTLDGTVQIGSDGTAVTLANSGTSLTIAHGATVIGNLGNGVFAQAGTTVTNAGLIRSTDADYSGVAMLGGTLGNIVAEGNGVTVSAGASTITNAGIIVGRTGGVIGSDDYQTLNNTGIIAVGTAANTVTINQDYSTGDGVRFTAGGTVTNTRGANNGGTIVGGANGLVITGGAATIVNSGTIQGNTGYGVSLDTAAGQTSTITNLMSGAFVGTTGAVLLSGDGTVNMTNEVGSAMYGSIVSTGNGTRKLDLSGIVYGDYDARSGAGTDNSGQIRNVYLGDGDDSFTYFGGTISGIVDGGAGYDKLFADFGAGQSYNVSLANFINFDSIGLVSGDMTLTGPSNDPNQAIYAGIGGAPAGTITFDGTSGLTGDIYVNGGAIRAATAGAFGTGTIHMIDPTATFGATGSYANNISLEVVTPSSANPSTLNADAGVTATLTGAITTGAGAGVDPSQDLVIGGQGTIVLTNTANRWTGTTIVNLGATLQGASDTISGSAIVNNGTLAYQQAYSGTVSQNITGNGNVRVGGLAAGNTLTFSGTNSFNGSILIQDASRVAISGATGTGAYVSVDLGADASRLDVAATGSLTSSNIAVTAYGANQSVHNLGSITSTGNAAVYLSGANALLDNDGTVSGTRGVYGDAANIKLINGAHGTITGNTNNAQGGTIDNSGTIQSRNGYPAVYVGSGAATITNNAGGLITSQGTTVALYDAGSKLTNAGSVTSRDETAVYLGAGGTVINSGGLTGGTGGYGLWTSGGGSFTNQSGGTITGGLGGMYLDGTGTITVNLDAGSTTGKIFSGGTGDRVVNISGTLNGGYAGGTGDDRITLDTSAIVTGVLDGGYAGNNTLTLTGSGTATLGDVMNFGSAAKSGSGTWTLSAPTSMTSWTIADGTLLLSGGNAIDDTATVSMTGGT....................................... 3027
223 3.000e-19UniRef50_UPI000B45AE35 putative uncharacterized protein DDB_G0282133 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=UPI000B45AE35  ali  189...TNNLVTTDNGNTNNLVSTNNGTTNYLVTTDNGTTNNRVNTDNGTTNNLVTTDNGNTNNLVSTNNGTTNYLVTIDNGTTNNLVTTDNGTTKNLVTTDNGNTNNLVSTNNGTTNYLVTTDNGTTNNRVNTDNGTTNNLVTTDNGNTNNLVSTNNGTTNNLVTTDNGTTKNLVTTDNGNTINLVTTDNGTTNNLVTTDNGTTNNRVNTDNGTTNYLVTTNNGSTNNLVTTDNGTTDYLVSTNNGTTNSHVTTDNDNGPTNNLATTDNGTTNYLVTTNNGSTNNLVTTDNGTTNNLVTTDNGTTNNLVTTDNGTTNNLVTTDNGTTNNLVTTDNGTTNNRVNTDNGTTNNLVTTDNGTTNNLVTTDNATTNKLVTTDNV........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 563
224 4.000e-19UniRef50_A0A0P6WAH2 Uncharacterized protein (Fragment) n=1 Tax=Bacillus vietnamensis TaxID=218284 RepID=A0A0P6WAH2_9BACI  ali  1...................................................................................................................................................................................................ATITGGNINATLLGGTLNNLLDGTISSVLGATITAGTLNSVNEVQAATIVGGTINAITGTVTVDIPSVTVSGGTLNVVESVLGATITAGTLDSVNEVQAATIVGGTINTIENVLSATIAGGNINATLLGGTLNNLLDGTISSVLGATITAGTLNSVNEVQAATIVGGTINAITGTVTVDIPSVTVSGGTLNVVESVLGATITAGTLDSVNQVQAATIVGGTINTIENVLSATI------AGGNINATLLGGTLNNLLDGTISSVLGATITAGTLNSVNEVQAATIVGGTINAITGTVTVDIPSVTVSGGTLNVVESVLGATITAGNINATLLGGTVNNLLDGTISSVLGATITAGTLNSVNEVQAATIVGGTINAITGTVTVDIPSVTVSGGTLNVVESVLGATITAGTLDSVNQVQAATIVGGTINTIENVLSATIAGGNINATVLGGTLNNLLDGTISSVLGATITAGTLDSVNEVQAATIVGGTINTIENVLSATIAGGNINATLLGGTLNNLLDGTISSVLGATITAGTLNSVNEVQAATIVGGTINAITGTVTVDIPSVTVSGGTLNVVESVLGATITGGNINATLLGGTLNNLLDGTISSVLGATITAGTLNSVNEVQAATIVGGTLNTIENVLSATITGGNINATLLGGTLNNLLDGTISSVLGATITAGTLNSVNEVQAATIVGGTLNTIENVLSATITGGNINATILGGTINAITGTVTVDIPSVTVSGGTLNVVESVLGATITAGTLDSVN......................... 755
225 4.000e-19UniRef50_Q9LB46 Vacuolating cytotoxin (Fragment) n=4 Tax=Helicobacter pylori TaxID=210 RepID=Q9LB46_HELPX  ali  96  1.......................................................................................................................................................................................................................................................................................................................................................HLNTKADGTLKAGGFKASLSTNAAHLHIGKGGVNLSNQASGRTLLVENLTGNITVEGTLRVNNQVGGAAVAGSSANFEFKAGENTNNATATFNNDIHLGKAVNLRVDAHTANFNGNIYLGKS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 122
226 5.000e-19UniRef50_A0A2D7NCN0 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D7NCN0_9BACT  ali  4498..FTTTNNDITFSGTVNSVSSTKTLDIVAGNGDTTFSGTVGGSEALGNTTIGTAGLTAGAIKVQGTLAITNSGAGAITGSNGDSAAILTKAGAGTLTLSGDNTYTGATTVSAGVLAITHADALGGTSGATTVASGAALSISGGLTIAEPITISGTGVSSGGAIVFTGGDNTYSGAITLGATSKIVSTGGAQTISATVNGGNALNITSNSDLTISGIVGGSTPLSAYSVTTTGSGTQTFNVNVTTTNNQTYTAAGGITSSGARTFTSNSGTVSFRSALAGNNNNLTVSGAASIEGAVTNIAVLSITGTANIGGDITSSGTQTYGGAVNLTTNVTLTTSSDVVTFDSTVNSFGSARNLTIATGGNSTEINFDGIVGGSNALGVITITGALDLNAAIASATSIAVSGASNIGADVTTSGTQTYSGAITLSGAARTLQGSTIQTTTINGAQNLTITGNLDLDGIIGGSSAIGVFSVSGTSNLGANVTTTGTQTYSGAVTLSTNTTLTSSNDNFTFSSTVDSDGSTRNLTLSAGSGTIGISNAIGGSAALGTLTITQSGGVTFSGNINAAIVTLTDTTGNVTFAGNTTLTTLNTASQDYNVIFNGSTNTITNAVTFSNTGSLTFGNASGDSSTFNXGLNNYXTKSN.................................................................................................................................................................................................................................................................................................................................................... 5138
227 5.000e-19UniRef50_UPI00046958FC hypothetical protein n=1 Tax=Sulfitobacter noctilucae TaxID=1342302 RepID=UPI00046958FC  ali  10  727...............ANGLTVSTTGGILGAADGQTISLTGDYTNAGGLLELGSDPSADLPLTGTIGLNVASVSNTATGSVAIAGGTVQVQNETTGTNGIASTDIQSAGTLDVNGTATTTGSGSLTNTATSATDVTLTGTGDTTFSGVISGEGASSLGVVVDTDTGSITLSGTNTYDGTTQVQSGTLILSDGTAILDTGSVEVSGGTLELAADETIGDLSASAGTIDLQANDLTFGTENDTSIAAGITGTGTLILLGTGTVSVTSANPTGAFGTTINAGAIDIGADGALGTGLVTINGAALSASVDATSANDLTVTGSGATLSAANATSLALTGGDFVNEGGALTLGTEDNDGTINLAFGDVDNNPTSTVTIANGTVEVGSAAVGTGFFTGVAGTEIGTDATLDLNGTDTAVDNLSGTGTISATTGATLTVGGAGVTTFDGVIENGTGVLALTVDMATSDDVLTLTNTNTFTGNTMITKGILDVQDGSALADATVVDIAADGTLRVTDAEQIAALSGTGAVDLTASLTLDNGTVTVATGTYDGDISGDGGLTVAGNTDQTLSGTNSYTGMTRIEDDAQLTLDDGAAILDTGSVTISDNGTLALLVGIGALSASGGTIALGTDALTFGTETDTEIAAAITGTTGSLIKQGDGTVTVASTNTGETFSTTVNAGTVAIGADDALGGGLITLDDGTLQVDVATTVANAVTVSTAGGTIAGADGVDFEITGALTNNGALTFGDGTAMSSITVNAATVGATATATIAENTTLVLGAASALDLVSDNATVTGTLDLFGQDAMLTGLSGTGVITTTDTPLTTVTLSGPTTYTGAFTDGVDGAGVPSVLALNVDV-GAGETFTLGTAAGAAAANAFSGATTITSGTMSVSGGNAIGDTSDVTVLSTGTLDVQADETIGSITGDGGVALADAATLTIGGDSATTYDGVMSGDGGLTVGSTGSTGSLTLNQAQT................... 1681
228 5.000e-19UniRef50_Q9LB69 Vacuolating cytotoxin (Fragment) n=5 Tax=Helicobacter pylori TaxID=210 RepID=Q9LB69_HELPX  ali  76  1................................................................................................................................................................................................................................................................FNHLTVGDHNAAQAGIIASKKTNIGTLDLWQSAGLNIIAPPEGGYKDKPNNTNSQNPPNSGQKTEIQPTQVFDGPFAGAKDTVV................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 112
229 6.000e-19UniRef50_G8AUG5 Uncharacterized protein n=1 Tax=Azospirillum brasilense Sp245 TaxID=1064539 RepID=G8AUG5_AZOBR  ali  1231.....VTFNGTVNGAQALTIAGTGTAQFNAAVGGTTALASLTTNAGATVSL----LNVTTSGTQTHNAATTLNGTYSSTDSPITFNGETTLAGTTAVNAGYGTITFNGRVNGAQALTATSTGAMVFNAAVGGTTALASLTTGTGYTSLVNVTTAGDQSYGGETSLMGTYATGNGAFTVAGPVTLAGTTTVDAGSGAVTFNGTVNGAQALTVNSSGATRFSAAVGNTTALASLTTDADGTTSVTSVTTSGAQTYNDAVTLDGAYQAGTVFTAAQAVTLGGDSRITGTGGIVLASTLDGGRALTLTSGSGDILLGGAVGGGSRLGALTINGGGTTTIADTVKAASLVTDATGITILNGGSVDTIGAQSYADAVTLGTDTVLTGTQVALSGGIDAAEAGRQSLTIAGNAALAGTLGTRQALAALTVGGETLLAGATAVTSGAQTYGGAVRLAGSPSALTGTGITVAGTLDGGQALTVTSGTGDAVFAGTVGGTERLGDLTVNSAGQTRFAQSVRAASVATDVAGTLALNGGSVDTTGTQIYGERAVLGTDTTGSTVVLAGGLDAATRGGQGLTIAGNAVVNGLVGGTQALSRLSVTGTAALNGGAVTTMAEQSFGGAVTLGADTVLTGGTVSLLNGGSAANAGVQGLTVDGDAVLAGVFGETGALRQIAVSGGTRLDGATVTTTGAQRFGGALTVTGASTLTSTGGDLVFGGAVDSANRSALSLNAASIRAAGDIGASGLMGDVTVRTSGGVFYDGAVTVRSLTQTAGGESRFAKALTATGTDGLRLTGAGFTFGAAVNSAGSLALVTTDAAGTVTFGRDATVVTEGGFTQSGGSGIVLPASITAKTGPITLGAVAS............................................................................................................................... 2077
230 6.000e-19UniRef50_Q8GF46 Uncharacterized protein n=1 Tax=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) TaxID=264203 RepID=Q8GF46_ZYMMO  ali  1160.........AVAGDLVNAGTTNVNGGTVGGITSNTGTLNAQNAALHDINNTAGTTSLNNSTAGTVTNASNATFSAVGGSLASATNSGTMTLGNGNNVAGDVTSNDGSLTLD---------GNAVAGTLAANGGSFEVTSANSDLGSLAGSANGNLDGALNLHNAKDTYSGAISGQGSLNILGGTETLSGTNTYTGQTTVALNATLNLPGAVAGDLVNAGTTNVNGGTVGGITSNTGTLNAQNAALHDINNTAGTTSLNNSTAGTVTNASNATFSAVGGSLASATNSGTMTLGNGNNVAGDVTNNDGSLTLDGNAVAGTLAANGGSFEVTSANSDLGSLAGSANGNLDGALNLHNAKDTYSGAISGQGSLNILGGTETLSGTNTYTGQTTIAENATLQLGNGETSGTINNTQDIINHGTLSVNNSHAVTMPMLISSSGQFKQIGIGTTTLGDHNSY-SGGTTITSGRLVGSAHSFGTGAINNYSALIIAQPSNATFDNSINGTGTLTKTGAGILTINSNNSLSGSTFLNQGELAVNGSLASSSVTSQPGTILSGTGTVGGITAKAGSIIRPAGNIIGTLNVSGNYQQDAGATYAVQVTNTSDVLSINGKASLSDGAILSVSKASPGNYTLETKYRVLTTKGGVSGNYTLTGDTALSAFYGLGTTYDANNVYLEVKQDHLFVEEGKTSNQIAVAGGLDSLASNSVIKNVVGSLMTGDQARQAFNTLSGEIHASARTSLFQDSFYIRDITVERLRASDCGIGTDADTKKTCDIKKKREAEGACEGAAPALWMQSYGSWGRNSGNDNVATMNHSTGGFVLGADTPIGRSKWHIGGLFGYGYSSFNIPNRSSTGHSNNLTAGAYGGTSWGN................................................................................................................... 2009
231 6.000e-19UniRef50_A0A2W6YXQ5 Uncharacterized protein n=1 Tax=Pseudanabaena sp. TaxID=1153 RepID=A0A2W6YXQ5_9CYAN  ali  3659SILTNAGGTTELNGTINSTSGQTFNDSVVLIGATQLNSVDSAIAFNSSVNGNQNLTINSGANFNSDVGNTAPIGNLTANSAGVTRFNTVNAASLTTDINGTTELNGNVTTTGSQTYNDAVVNNSIQLNTTDSAVTFSNSVNGNQDLTINTGSGDITFSSPATVRSLTTNSSGITRIDRDINAVSFTTAFEGSTLLLGNVFTSGNQTYNNKLLISANTILDSSSGNGNISFLTVNNAIAGTPSNLTLNAGTGNISFGISAGSLGDRLGDITVQNANEFTGSGIIANSLTQNAGIGATQFSNDNEFTGNLNITSQSFSLTEGANLRVGNANIQAVNGVDLSVATNFSFLGAGVINIDSDSNSDGIGTFLSRGTITDNGLGGVVNIRTANPDIRNVITASQISLAPSVANTSIAIGSVANGDFKLQDFALDLLQASLVTIQANGSPVSIGSNNASFATGTSLEIGTANSPATSISAIAGFTLNVDRNLSLTGNTIQLGDTNVGGDLALRFTESVSQVGTIAVTGSTNLIVDSNPLTDVLLADFANSFGNQIVFTFINLPNDDFQNFEIRDITENANLAFFPNQVNNLKLILDNGTIDLPSIPLTGSLTLQARQVSLNGDITTTNANLSGDLINLNRNLTTSGNLTINNASTLKISTETNLDITGNLEQIGDGSVQLGGNIVRAASVSFAQDIELIGDSSITSDGIINFDGNVNGLFTFILDASGNFVVAKGGFGTTNPLQSLAIALDSTLVSQVNSRFSPTDINIATIGDVNVGNITNNGRDIKI---NSADGLIATGNIDSSFTFSIGDGGNVNLSAEGDVTTGSINTSSFGNAGEVSLESRSGVISTGDINASGAVGGRVFFNAATAINAG-QISTRGFEGAGGDVILDPLGDVVVESIETSGLTGGNVTLISTGGNLRITDVLNNPSSLATCLGASICTSGSNTSGTISLRTGGLN......................... 4614
232 6.000e-19UniRef50_Q9LB70 Vacuolating cytotoxin (Fragment) n=7 Tax=Helicobacter pylori TaxID=210 RepID=Q9LB70_HELPX  ali  96  1.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKEHVLVRAGNIDYNLVGVQGASYDNIFASNTNLQEQFKERLALYNNNNRMDICVVRKGNLNDIKACGMAIGNQSM................................................................................................................................................................................................................ 128
233 7.000e-19UniRef50_A0A2C9BZ04 Outer membrane autotransporter barrel domain-containing protein n=1 Tax=Burkholderia sp. OK233 TaxID=1882795 RepID=A0A2C9BZ04_9BU  ali  28...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TVAKAQTTISSAVTTTQTWTSSDFTVDGGASVSVSNGTAVSATGSSLGTLSNSGTISASASGIAILNRGSIGSLSNGGAISTSASGTGIFNSGSIGTLTNSGTISGGIINSGTITALTNNSGGTISGGINNSTSSGTIGSLSNSGTIDYIDNEGTITTLTNNSGGTISGGISNNGTITTLTNNSGDTIISIANSTSHSIGSLTNSGTISGGTYAIVNNGSITTLTNNSGGTISGGAYGITNSRLINTLNNSGAISGRIGIYNGGTITTLTNNSGGTISGITGINNDVTIGTLSNSGTITGTTYGINNSGSITALNNNGTISGIVNTGTIGGGSTGINNSGTISTLSNNSGGTIHGGNTGINNSGTTGALTNNGTISGGNTGIQNNGAIGALTNNXXXXXXXXXXXXNNGSIGSLTNNGTISNSYVGIFNSGTITALSNSGTISTGINNNNGTITTLSNSGAISGGISNSASSTTIGSLSNSGTIDYIANSGTITTLTNN... 528
234 7.000e-19UniRef50_A0A099TXV3 Uncharacterized protein n=1 Tax=Helicobacter muridarum TaxID=216 RepID=A0A099TXV3_9HELI  ali  15  133......................................................................NPKSNSEHTFGSGGILGFITASFSAKEVYLTGNINTGNSFRTGGGTNLSFGDLNVNQAAITVRRAGLQ-NHTTTLNGRNIYIVGSRLNIENVN-GGGMQIGTNSSNTSVVNISNTQLQINGGTLTIGNSRANVNIDSSSSINMTNRNSLSMNISGDIVNGRIKPTPNARSFRSFRAALGNNGQDFSANTVKLTDVNNSINATLEFVGPGTVFGNGDRNLTISSSNGNSINIKTITNPFFFFGKGFASRLTTNVSTTIDNIAHRNYTGG-SQIIIDSQNADLEVKNMSFATNGIFGSQGLIELKGNNINIGSASSGSLNTIRANA----KGAINADNIGFGSDVIGSIGHIDLTAKDDINVENLTFVQDICITNGCDVIVKSVLGGNDSEQGIRAGNFLIAEGQNFYGGAIKAYALPTAGSDSTLDLSKITGDVFIDNFNIRTGTFKASNFHLNNFSVSKS----NSYSVVSVNIG-KSFINSLQMDLGTSNFADGSDFTGGGSILNFNLIDARATSFTRMQNIDNTNVNTLNITQADFYMKNG---IFNSITVKNGQTFNVTNDAKITGNAMNVNSLLHLNGSIHSGRLEIVLNANNTDVNQDFSKYLKVGARSNLMSKEELRNIIQEGKDKLGNTTGGSTSQSDYENASGTYITTSDNKHY......................................................................................................................................................................................................................................................... 840
235 8.000e-19UniRef50_A0A2R4S7L5 Outermembrane autotransporter n=3 Tax=Zymomonas mobilis TaxID=542 RepID=A0A2R4S7L5_ZYMMO  ali  542....TTTLAGANTYTGQTTVAQNATLNLPGAVAGNLVNAGTTNVNGGTVGGITSNTGTLNAQNAALQDINNTAGTTSLNNSTAGSITNASNATFSAIGGIIHSVDNSGT-------------MTLGTGNTVVGNVTNNDGSLTLGKGNYVIGNVTNSKGSLTLDGNVIVGTLAANGGSFEVTSANSGLNSLAGTANGNLDGTLKIYDAQDTYSGSMTGQGGVQLLGGTETLSGTNTYTGQTTVALNATLNLPGAVAGDLVNAGTTNVNGGTVGGITSNTGTLNAQNAALHDINNTAGTTSLNNSTAGTVTNASNATFSAVGGSLASATNSGTMTLGNGNNVAGDVTNNDGSLTLDGNAVAGTLAANGGSFEVTSANSDLGSLAGSANGNLDGALNLHNAKDTYSGAISGQGSLNILGGTETLSGTNTYTGQTTIAENATLQLGNGETSGTINNTQDIINHGTLSVNNSHAVTMPMLISSSGQFKQIGIGTTTLGDHNSYSGGTTITSGRLVGSAHSFGTGAINNYSALIIAQPSNATFDNSINGTGTLTKTGAGILTINSNNSLSGSTFLNQGELAVNGSLASSSVTSQPGTILSGTGTVGGITAKAGSIIRPAGNIIGTLNVSGNYQQDAGATYAVQV-LPGTNTSDVLSINGKASLSDGAILSVSKASPGNYTLETKYRVLTTKGGVSGNYTLTGDTALSAFYGLGTTYDANNV......................................................................................................................................................................................................................................................................... 1239
236 9.000e-19UniRef50_A0A210QVQ8 Collagen alpha-1(IV) chain n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QVQ8_MIZYE  ali  11 2241...............AKGDIGNTGSKGDVGSVGSTGSVGNTGSTGFKGDTGTQGNVGNTGPKGQRGVEGNTGATGDQGQIGSTGLKGGLGETGISGTDGLVGNTGEKGQTGGTGVQGVTGVVGNTGSTGQSGDTGSTGPTGNTGVEGTTGEIGVSGSTGQVGNTGEQGLTGNTGPIGSTGQVGNTGVEGATGNVGASGATGSDGNTGAKGETGGVGNTGPVGSTGVEGQTGGVGDTGVKGDVGSKGLKGDLGQVGDTGVKGDSGNVGNTGTVGATGPEGNTGYTGNTGTQGVAGQTGDKGEIGQTGSIGSTGNTGSKGEQGIQGLTGDIGQTGDVGATGYKGQTGNTGNTGAKGEIGNTGGNTGVKGEDGNXXXXXXXXXXXXIGATGLQGNVGNTGLEGTTGNTGSVGATGNVG-------NTGAKGEVGDTGVQGATGVVGDTGLEGNTGDTGSTGPKGNLGNTGDTGPQGSEGDDGQTGAQGNVGLTGQTGNTGNKGDVGATGNQGQIGNTGVSGSQGVTGAVGSTGLKGSDGVTGDQGNVGDTGVVGNTGSKGDQGDVGSTGIQGQTGYKGEIGTSGVTGGVGDSGVVGNTGPQGVSGITGTVGATGSKGDTGAVGNNGATGTIGSTGQKGQAGTDGVTGPQGETGPLPDVTNTCDTSNGGCAHNCKNVFGAYI............................................................................................................................................................................................................................................................................................................... 2901
237 9.000e-19UniRef50_A0A1L3GUR3 Hemagglutinin-related protein n=2 Tax=Granulibacter bethesdensis TaxID=364410 RepID=A0A1L3GUR3_9PROT  ali  2545...STLVNSGTIQSSSSSLSGAFLFGTGNIITNSAGGLIRGGLYGAGVNGGSINNAGSIVAFGSAGIAVRGIGNAATLVNSGVVNATGSASQGVLFDTGGRVTNSAGGTISGNFVGVSVFGNTTVAGTVINAGLITDNGGTLTAASGVYLSNTSADYLNNSGTILETGTGAASGLLAGVRLASGGTVINSGSIGVAGTAGTGIRLDVGGTITNSGTISAAGTANVTNGAGAAIYMTGTGNNLLQLGASSRIIGTAVANAAGTNTSGSSAGSISGLGVSYIGFQNLVIDAGASWVAGGFNTVSSNSTLLNKGTLTNTGSFAGAVTMAANASLTNAAAAVLSNGNLSSAIFSAGSGVAIINAGTIQGGQPINALISLGNAATLVNSGQILGSGSASTGVTMGAAGTINNTGTIAITGATNTAVAIVSGALNNTGLISADIGQSTGISVSGIGSITNSGTISAIGGLGQAIVLTGGGTVVNTGTIQTQSTFRSAINFGAGNSRLAISGSSVIIGKVTAAGTGNVLELDGNGTTLSGFGTQYTGFQTINVKGNGWVLADTLTNTNILMQTSGTLTVSQTLDGSNTITLGGTSSAGVGSGNIIISTPGTALAATVSDFGNGESITLTGLAYQASDVVDVVSSGGNVFLILSHVASNGT........................................................................................................................................................................................................................................................................................................................................ 3198
238 1.000e-18UniRef50_A0A0G9HAB2 Uncharacterized protein n=9 Tax=Xanthomonadales TaxID=135614 RepID=A0A0G9HAB2_9GAMM  ali  11  27....................................................AKGARSIGGASMIATTKGRLAAGVMLALAGTTGAFAHTTSIGYTNSGNNSLSFYYGTYHLSDEATYTEGSLHLTSTAGFNQTVSFNILTGTKPAGLVDGDTNF-FSDGTKLIGTPNQVIANWQGVTFNNLVHGTYTFTYIPIANPTQVWAPIDNVILSSTITIINADLSTAPHVVAGQVVDQTYAIDPLIMDGGMVKNTADGTMSQMVSITNNNGTFDTNGHDLTLTGEMDGRGALIKQGEGTLNLRGDNTSVGEIDLNGGAINVLSDAALGDTSNDLKFNGGALQWGAGFDLNSGRNVTLGAGGGTLDLQTYNSNVGNVISGTGSLTKTGTGTLTLSGANTYTGDTHVAGGDLIIASNGKLGTGVLNVDTGSAVTMNNATQTVAGLAGAGNVDLEGTTLTLNGNGASTTYGGVLSGTGGLIKNGSSTQVLTGSNTYSGGTTVNDGTLAFSSDANLGNAAGSLTLNGGTLEASGTGSTARDIHVAGGAIAVDAGQQLTSTGSVSGTGGLIKNGDGTLVVNGVASQAGGVTANGGTLALGGTNTYTGDTTINTGATVVVSRDNNLGASANQVDLDGGALVATGSFTTARDVTVGSAGSSL----------------------GASTGNTLTSTGVVSGSGTLNTQGAGTIVLAGTNGGTAINDGVLQISSDANLGAASGAIGLFGGTLHSTADITSTRAVTTGGVGGVDVDAGTTFSTSGAVNGAGGLIKNGEGTLAMSGTLSQIGGVTVNDGTLALSGNNSYHGANTLNGGTNDTNLGDAGNHVVFEGGQLHVTGDTTTARTVDTNAGSNADLVVDSGKTFAVNGTVQGNGGLVASGNGTLVLGGNNTYTGGTLVNGGMVQIGNDAALGAASGAITLAGGTLHTTGDVASARNVTLSG............................... 908
239 1.000e-18UniRef50_A2WE64 Large exoprotein involved in heme utilization or adhesion n=19 Tax=Burkholderia TaxID=32008 RepID=A2WE64_9BURK  ali  152.......................................................................................................................................................................................................................................................................................................................SSPATAQVWHGTTSSDWTVGSNWSTGAAPSGTATVTINTNSPNPTVLGVSGAVNSTIGNLQMGTATGTSALTIQNGSTLSSSVTTGTNQIGQSSGATNATITVTGTGSSWSMASSTIFGAALGSTGTLNVANGATASLASNLAVGQTSGGRGVLNVTNGSTLTTGGATIAASNSNSTGSISGAGSQWNVGGALTVGLGRGNGAGVGTLNIANGAAVTATGNITIGGLTLSTSGAGAITVDGAGSRLSTGGALNIGLYSTGSTLTVSDGAVVTANTVTVTALPAAKGTLNLSSSGTLATQALTGGPGTAQVNFDGATLRATASNTAFISGFTATGLNIAAGGLTLDTGAFNVTAASPFSGTGALTKVGTGTATFTGDNTYTGGTTISAGTLQLGNGGTSGSIVGDVTNNGTLAFNRSDTATFGGAVSGSGATGTTVLTGNNTYAGGTTISAGTLQLGNGGASGSITGNVTNNGTLAFNRSDTVSFGGTISGSGALAQLGTGTTVLGGNNTYLGGTTVNGGTLQVAGDANLGDASGSLSFGGGTLRNTADFASARAITLNAGGGTFQTTGNLTLTGPIGGSGALTKTDGGTLLLTANDTYTGGTTISAGTLQLGNGGTSGAIVGDVTNNGTLAFDRSDTATFGGAVSGSGALT................... 807
240 1.000e-18UniRef50_A0A258RXY1 Uncharacterized protein n=1 Tax=Sphingomonas sp. 28-63-12 TaxID=1970434 RepID=A0A258RXY1_9SPHN  ali  2521................AAVYGVNAIIGFTNASGQIINVIRTSNDDVNFYNVVSG---DPLIGTLCIAGANTACLTATGSVQDLIPTITALNNGSGLYIAGQSSFDATIGDLLAGSGSSQILSLAGSGSVILGGTTLVIGNADDAFSGAISGAGGVTLTAGNQALTGTNSYTGLTTLDGGTLTLDGGAAIADGNMVLVNAGGTLALLASGSLNGAGAVSLNANTLFLGTNDLDSSFSGIASGTGGITKTGAGTLTLSGANSYIGYTSIYGGSLVFGASDVLADTSTLIIENATADLGANNDTIAALLLTNGTLNGTGTLTAGEYALQDSVINANLGTGYLHTSASNMLTTLNGTSAASTVESEAGTLALGASDRLLDTATLYVDGFSDTVGSLGLQGTLDGTGTLTA--ATYFLTAGIVNGNLGTGSVYVSRDTLSGDTVTTLNGTSAATSIQVNNLATLALGAADRIADTTTVSVNAGGTLDIAGFNDTVGSLTLGGTLNGTGTLTAASYVLAGGTVNANIGDGTLTQVSGSSVLNGTSTAATVAINGGTLVLGASNRLADVAAVVVASGAALDLNSFTDTVGSLTVAGTLSGSGTLTAATYSLTGGTVNANLGTGILTQTSGTSTLFGTSAAATVRINGGTLALGASERLANNAALSIASGATLDLRGFDETVGLASISGTLNSNPVRSQASTRIGGAQGALVQLVQGTGTLTAASYDLIGATINGNLGTGTLNQLSGTSTLNGTAAATVVAITGGTLVLGAADRLADTAAVSVASGSTLALGAFTDTVGSLALAGTLSGTGTLTAAQYQLTGATVNANLGTGSLFQLGGVSTLNGTAAATAVQVQGGTLMLGTSNRLADAANVAVSSGATLNLGGNLDTVGIVQLAGTLAGTGSLTAAQYQLTGATVNNLGAGTLFQLGGTSTLNGTAAATAVAINGGTLALGAN.................................. 3458
241 1.000e-18UniRef50_UPI0009B34355 hypothetical protein n=5 Tax=Burkholderia ubonensis TaxID=101571 RepID=UPI0009B34355  ali  941....STVAAAGISTAQSGVSSLSTSVNATNSNVTSLSTSAAAGISTAQSGVSSLSTSVNATNSNVTSLSTAAAAGISTAQSGVN-SLSTSVTATNSNVTSLSTSAAAGISTAQSGVNSLSTSVNTTNSNVTSLSTSAAAGISTAQSGVSSLSTSVNATNSNVTSLSTSAAVGISTAQSGVSSLSTSVNTTNSNVTSLSTAAALGISTAQSGVSSLSTSVNATNSNVTSLSTSAAAGISTAQSGVSSLSTSV-NATNSNVTSLSTAAAAGISTAQSGVNSLSTSVNATNSSVTSLSTSAAAGISTAQSGVNSLSTSVNATNSNVTSLSTSAAVGISTAQSGVTSLSTSLNTTNSSLGALSTRESTDVGSLSTSLNTANSNVTSLSTSLNTTNSTVGSLSTSLNTTTSRVSSLSTSLNTTNSNLTSLSMSTSTGISAAVSGVTSLSTGLSTTNSNLASLSSSFSGSIASWMNSLSTVNNNLSTLSVSTSTSVVQLFTGVASLSTGLSTTNSKLSTAVTSLSTGIASLSTQMNSPGFGKGGQSTTSTSTAAALXXXXXXXXXXXXXXXXXQSSTSTASSSLSTSAGSQSTGAKAVVSAQLVQSALASPVATGASAQATGDSATAMGANAVASGSNSVAVGSGAMAMAPNSVALGASSIATDANTVSVGSPGNERRIMNVAGMNPTDAVNMSQLSAVQSNMNQVARLAYSGIAGAAALTMIPEVDPGKTLSVGFGTAGYQGYQAVAIGFTARITNNLKVKGGVAINGAGGNTYGAGASY.............................................................................................................................................................................................................. 1710
242 1.000e-18UniRef50_A0A2A4K7S6 Uncharacterized protein n=1 Tax=Heliothis virescens TaxID=7102 RepID=A0A2A4K7S6_HELVI  ali  750................ASGHAETNDNGSSTTVDTSSNSHVENNGHGEEGPSQGDGEXXXXXXXXXXXXXXXXNDNGGQGSAHGEATGHAETNDGDGHTTVDSDSNTDARSDGNGGDSAAHGEATGHAETNDNDGGTTVHTESNSNAESNENPGAGSNEGSSHGHVKNHRSGGKRHHHKRHRTTTEHDQHDGSGDGSGHVKNHRXXXXXXXXXXXXRRNSTVNTNSNSTVGNVGKATGHAETNGGRRHHHHHHHNSHDTSDNHGNRGQGTASSETSGHAETSNNEDTAVADATSNSRADTNDNDGNNSGHGHARNHVKNHHKRSQIRRRTHHRRHNLVHNHHRRHTIITRNGSHNRHVRNHVNHANSDSWSRAETNGTSSSTTAGSIAEITHRRGRTRCHRPHHDDDNTNSGGSTATSTDTSTSQSNATATAISEGGSNTATAQTNSSSTVTTTTDNDTEDDTCXXXXXXXXXXXXXXXXXTTTTTSSSGNATATTTNEEGSDTSTANSESNATATSTNEGGSNTATAESNSTATATSTNGDDSNTSTATSESDATANSTNEGSSNTATASSDSTATVTSNCTDEGGSNTATANSGSDATATSTNEDGSNTATAD--SNSTATASSTNGDGSGTSSATSASNATATSTNEDGFNTATAQTNSSSTVTTTTDNDTEDDTCXXXXXXXXXXXXXXXXLTTSTTSSSSNATSTNEGGSSTSTATGHSSATATSTNGDGSGSSTATSESNATANSTNEGGSNTATANSGSNAIATSTNEVEDSSNTATAESNSTATATSTNGNGSNTATATSDSDATTNSTNEGGSNTATANSGSDATATSTNEDGLNTATAYSNSTTTATSNNEGGTGSSTATSESDATANSTNEGGSNTATAASNSNATATSTNGDGSNTATAQTNSSSTSDATANSTNEGGSNTATAASNSNATATSTNGGGSNTAT.......................... 1686
243 1.000e-18UniRef50_Q84FS4 Vacuolating cytotoxin (Fragment) n=7 Tax=Helicobacter pylori TaxID=210 RepID=Q84FS4_HELPX  ali  85  59.........................GLLSWGLKQAEEANKTPDKPDKVWRIQAGRGFNEFPNKEYDLYRSLLSSKIDGR...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 112
244 2.000e-18UniRef50_UPI000720AC7A hypothetical protein n=1 Tax=Paraburkholderia caribensis TaxID=75105 RepID=UPI000720AC7A  ali  38..............................................................................................................................................................................................................................................................STAGSAVTCSGAANPLAPSFSSSANNLAVTTNTGSSLGVLLGVGGNALTLTGNNVTLNNAGTIDPSLLGALSILSTGTVIGNAAASTVNVTNTGTMTGTMGLLGVNLSSLTGLALAVQNGTGGVTNITNSGLMGASALAGVSVGTGDLATAAFYGGGQVVFTNSSTGTINGRVAFEASATPGAGNTFVNAGTIVGSVSMGAGSTNTFTARTGSSVSAGTGVSGNALGVLGFNLGFAAAGIVDGGAGGNNTLRLQQAGGGPATGQMGIANYINFNHLAVDSGTWTLNGASSVSDAAASGAVVNIDNSASLGTGTITSTGGALQTATAGLNLGNALLFGTGGLTVAGANPMTLSGAASGSGALTKTGAGTLTLTGNNSYTGGTNLAGGGLVLSNNTALGTGALNVNASSTLDTSAAGLALGNAVNLGSGTVLSLG-----GSNALTLAGAIAGSGGLTKNGAATLTLTGANTFTGPATVNGGTLAVTGAGTLAPTGSVILNAAGTALDISAATANQTLAELSGSGNVLLGARTLTFGDANSLALSGAISGTGGLIKQGTGTQTLSGANTYMGGTTINGGTLALSGSGSLATGSAVNLAGVGAQFNIGAASGARTIGALSGVAGTSVGLGANTLTFGDASSQTLGSAISGTGGIVKQGSGTQTLTGASTYTGGTTVNAGTLALGAGGSLAASGALNLAGAGTAFDITGTTGAQTIGALSGVT........ 752
245 2.000e-18UniRef50_A0A1X0TDL3 Uncharacterized protein n=3 Tax=Snodgrassella alvi TaxID=1196083 RepID=A0A1X0TDL3_9NEIS  ali  10 1024..LTNSIKNTGTGSISLINNGKIASDILNGAAGAINITNDGTLSGSIKNTGDKSTIADNNIDITNNTTHNITSDILNEGTGTIKITNNGTISGSTTNDELTNSIKNTGTGSIS---------LTNNSKIVSDILNGAAGAINITNDGTLSGSIKNTGDKSTVSDYNIDITNNNELTGSIENNGTGSISLTNNSKIASDILNGAAGAIKITNNGTLNGSMTNTGDKGTNDNIEINNTGTLNSAIDNKGKGTIKLDNNNLVNSAITNQNTGAIKITNDGTFNGSITNTGDKGTADNIWIDNNHILNSTINNEGNGSIVINNNTASSVINGKSIHTKAADTKVGINGDITNKNTGKITLKNSGNIQNKIENSGSGLIDITNDNTGNIASTILNGGAGIINITNDGTLSGSITNTGDPNTVTANNIDIKNSTSGNIASKILNGGAGDIKITNNGTIRGSTTDDELPNSIENTGTGNISLINDGKIASDILNGAAGSGIKITNNNTLSGTITNTNSGSVYATNTGTFTGMTTNSGSGILDLDNKGIWNNTGNSVLTKLENKTGTIIFPQVSEVNAGDKDQYHTITVNGNYTGGGLMRVNTVWNKDGTSYSDRVDIHGDVDGAPTTVRTLNEKGIYGDVTLKEIPIHSAVVVHVAGKSSGNDFTGSAPTTNAGEAQLKKIDTTSGTDYAWTLTA..................................................................................................................................................................................................................................................................................................... 1700
246 2.000e-18UniRef50_A0A1I6IF02 Uncharacterized protein (Fragment) n=1 Tax=Litoreibacter janthinus TaxID=670154 RepID=A0A1I6IF02_9RHOB  ali  10  19.................................................................................................................................................................................................................TLRSTTSALAVSTLIAMAGLYPVNEAVAQDAQWIGPTGTPAAGSSGNWDTTPGTLLNWVPTGGVGAPGFNNGDNVTFSPGLYTVTLAENVTIGNMILNGNTTIDGGAFVLTFDNSVAGDELLTVNADSVINAEFTGNSGSFSISGAGNLTFGQDVQALGFVTPANGAITNNGTGQVTFAGAVNAGSVVNNGTLMTLQGVVSGDVLNTGNLILSGTANDDVTNSGTGAGTVTGTLTNSVTSTGEIILNGANVGIVNNSGTGSTLTVAADSTSGAAVTNAGALNLDGGNLTGATSLTNTGTTTFVGAETLAANTISNTGAGSVAVGAGSLTATAGDLVNSGTGGITVSTGTVSATGAITNSSSLEMTDAGTISSGTGLTNTGTLTIGGGTVNGAVTNNTGGTINANAGNFAGLVTNTDGALNMGGGSFGGGVTTTAGTVSLTADTSISGTFASSAAITGDGGDHDITGLTSFTSDAAIASGAGTVGIAATTVTLNNGTALSGNVGFTGTDVTINTGVTVAGTVNVNTTNLNIGPTVAIDIGGGTSVTGALQNDDATANITAGAVASLTQIGTGTAVTTVSGTGSITGLSDVDAGALVVDGANASVADVQMD--GLGFGMDNGATATTLTQGTGTSAINGAATEVTGLVTINGGTVTVEDATIGGLTLAAGQTSTLINATVDDDG--LSNAGTLVTAGTVTVNSAFSNTGTLSIGADTTLLGTYAYSGAGVIGATNNLTFGGAGSVALLEGATVGGNVTFDMASLITAAN..... 785
247 2.000e-18UniRef50_H9U6Q0 Vacuolating cytotoxin A (Fragment) n=27 Tax=Helicobacter pylori TaxID=210 RepID=H9U6Q0_HELPX  ali  67  1..............................................................................................................................MQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNISIDNFVEINKHVGSGAGRKASSTVLTLQASEGITSDKNAEISLYDGATLNLASS---SVKLMGNVWMGRLQYVEAYLAPSYSTINTSKVTGEVNFNHLTVGDKNAAQAGIIASNKTHIGTLDLWQSAGLILPNPPEGGYKDKPNNTPSQSAAKNDKNESAKNDKQESSQNNSNTQVIN................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 211
248 3.000e-18UniRef50_A0A248K1Z6 Uncharacterized protein n=1 Tax=Nitrospirillum amazonense CBAmc TaxID=1441467 RepID=A0A248K1Z6_9PROT  ali  3596...................................................TVSNSGTLAGVGAVTGYGASIAGTIGTLTNSGVVSGDGTNGGYGLLNRGTIATLINTVGGTFAALAGTVGYGLINQSILNTVVNYGLMTGHDGGLQNTGTIQLLDNTAGGTIRSNSASAQQGLRNDGTIVTLLNDGLIGNNYGLFQAAGTIQTLVNNGTIVANASGVYMSAAIGTISNSGTIAASHKAIVANAALTALLNSGTLSGTQALAIGVNGRVGTISNSGVIQGNIVNTGTVGLXXXXXXXXXXXXLTGSSGQGTITNTAGNLVFSGGALALNDALNVGTHTVINSASLTLDSVISIAGHNSLVGSAVTLFGGNFVQNGGTLNIRAGAGQLFAPGSVSITSGRVNVILNDQANYSSSVSFTAPVNWVGAHDTMAQGAAFATTLLGWASTLSGSGEYFAYVAYNANDYIGGSIASVSNTGSIGFNTAVYVASTGTLGTLTNSGTLGATVGILNHGTIGSIQNDGLIHSATTAIQGDGSYGTLSNSGTIFSSVIGLSLGGHMDVLANSGLFTIGPDGFQAVYVGGTLGTLANSGRLAVGTASQQAVYISATGSLGTLVNSGTIAGDITNDSAHALILQGGSGTTVGTLAGATGMGTLTSTLANVTLASGNLALNDAVIVTGHTLVNSGASVRLDSIVTVTGDYSQSAGGLTVAAGASRLVVTGAASLSGGSVVAGLSSIANYLVGTLVGTLVTGNASSDYAGVQADGGFVALRTSTVSGGGAISLLATAISDYIGGMLATLTNSGSIGAGVPLYVAATGSVGTVLNNGTLTGATPLQNDGVIATLTNTTLGTIAGNFLGLVNNGTIGILNNAGLISSTSLPAVSNAGGIATLNNSGLIQGLSGGISDSGSIGTLDNSGSIAGGRAVAVNGTLGLLNNSGHLVAGGSTALYIGSGGTLASLVNSGTVQGN.................. 4519