current user: public

If you have questions about the server, please let us know.

Query: PF03181.15; F6HH21_VITVI/115-326; BURP domain, from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# E-value Template Links and tools%idFirst LFFLEKDLHPSKKLNLHFTKTTSGAKLLPRHVAETIPFSSNEFSDILNRFSVEPGSAEALEMKKTIEECEVPAMEGEDKYCATSLEAMVDYSTSKLGKNVKVMATEVGKEESPQQEFTISPGLTKMVGDKRVVCHGQNYPYAVFHCHASHATKAYLVPMVGADGTKVKAVAACHIDPSKWNPRHLAFQVLKVKPGTVPICHFLPEDHIVWTSLast
1 6.000e-84UniRef50_A0A2I4DFF2 BURP domain protein RD22-like n=3 Tax=Pentapetalae TaxID=1437201 RepID=A0A2I4DFF2_9ROSI  ali  66  102LFFLEKDMHPGKRMNLHFMDSNTAATFLPRQVAKSIPFSSNRLPEILNKFSLKPGSPEADIIKNTIEECEKPGIKGEEKYCATSLESMVDFSTSKIGKDVQAISTEVGKETQMQKYYTVVPGVKKMAGNKAVVCHKQNYAYAVFFCHTTRTTKAYLVPLVGNDGTKAKAVAICHTDTSAWNPKHLAFQVLKVKPGTVPVCHFLPKDHVVWTS 315
2 5.000e-83UniRef50_A0A0S3RC78 Uncharacterized protein n=5 Tax=Vigna TaxID=3913 RepID=A0A0S3RC78_PHAAN  ali  62  116LFFKENDLHYGKKLNLHFTASSNQATFLPRQVADSIPFSSRKVDDVFTKFSIKPESEEANVVKNTLSECEDTGIKGEEKYCATSLESMVDFSTSKLGKNLVVLSTEVDQETGLQQ-YTIAPGVKKISGDKAVVCHKQNYPYAVFYCHKTETTRTYSVPLEGANGIRVKAVAVCHTDTSQWNPKHLAFQVLKVKPGTVPVCHFLPEDHVVWV. 325
3 2.000e-82UniRef50_A0A2I4GNV7 BURP domain protein RD22 n=12 Tax=fabids TaxID=91835 RepID=A0A2I4GNV7_9ROSI  ali  66  149LFFLEKNLHPGTKMNLLFTKNSNEATFLPRQVAESIPFSSNKLPEILNTFSVKPRSVEADMMENTIKVCEKPGIKGEEVYCATSLESMVDFSTSKLGKNVQAISTEGGKET-QMQKYTIVPGVKKMAGDKAVACHKQNYAYAVFYCHETNTTRAYLVPLVGDDGTKAKAVAICHTDTSAWNPKHLAFQVLKVKPGTVPVCHFLPEDHVVWTA 359
4 9.000e-79UniRef50_C3VIX8 RD22 n=7 Tax=Pentapetalae TaxID=1437201 RepID=C3VIX8_VITVI  ali  98  115LFFLEKDLHPSKKLNLHFTKTTSGAKLLPRHVAETIPFSSNELSDILNRFSVEPGSAEALEMKKTIEECEVPAMEGEDKYCATSLEAMVDYSTTKLGKNVKVMATEVGKEESPQQEFTISPGLTKMVGDKRVVCHGQNYPYAVFHCHASHATKAYLVPMVGADGTKVKAVAACHIDTSKWNPRHLAFQVLKVKPGTVPICHFLPEDHIVWTS 326
5 1.000e-78UniRef50_Q947D4 Dehydration-responsive protein RD22 (Fragment) n=4 Tax=Amygdaloideae TaxID=171637 RepID=Q947D4_PRUPE  ali  58  135IFFLEKDIRPGTSMTLTFSGNSNTAAFVPRKTADSIPFSSNKLPEIFSQFSVKPESVEADIIKGTIEECESSGIRGEEKYCATSLESMVDFSTSKLGGNIQAISTEAEKGATL-QKYTITPGVKKLAAGKSVVCHKQTYPYAVFYCHATKTTRAYVVPLKGADGLEAKAVAVCHTDTSEWNPKHLAFQVLKVKPGTVPVCHFLPKDHIVWV. 344
6 9.000e-78UniRef50_A0A2K3NKZ8 BURP domain protein n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A2K3NKZ8_TRIPR  ali  59  112LFFLEKDLHHGTKMNLQFTKTTNAAAFLPRQVANSMPFSSNKVEYILNKLNIKKGSKGAQIVKNTISECEEHGIEGEEKSCVTSLESMVDFTISKLGKNVEAVSTEVNKESELQQYIIAQGVKKLGEKNKAVVCHKENYPYAVFFCHKTEKTKAYSVPLVGADGSRVNAIAVCHTDTSKWNPKHLAFQVLKVKPGTVPVCHLLPEDHVVWIS 324
7 6.000e-77UniRef50_A0A2P6QF99 Putative BURP domain-containing protein n=9 Tax=Rosales TaxID=3744 RepID=A0A2P6QF99_ROSCH  ali  59  109.FFLEKDLRLGKKMTLHFPKTTVAAEFLPRKVAKSIPFSKSKLPQILNHFAVKPNSVEAEVIKQTIEDCEAPSIKGEDKYCATSLESLVDFTVSKLGKYVQVYSTEVENENK--QEYKIGKGAVQRIGDRSVVCHKQKYVYAVFYCHEIHSTRAYVVPLVGADGTKAEAVAVCHTDTRTWNNKHFAFQALKIKPGTLPICHFLPSGNLVWV. 316
8 8.000e-77UniRef50_W9SHX1 Uncharacterized protein n=1 Tax=Morus notabilis TaxID=981085 RepID=W9SHX1_9ROSA  ali  62  147LFFLEKDVHPGAKINLHFTKSSNRATFLPRQVAASIPFSSNKLPEILTKFSVTPQSEEADMIKETLNECDSPSVKGEEKYCATSLESMIDFSTFKLGKDVQVLSTEVEKETG-VQTYTVTRVEKKTSGEKSVACHKQKYAYAVFYCHATQTTETYLVSMEGADGVKAKAVAVCHTDTAAWNPRHLAFQVLKVKPGTVPVCHFLPEDHIL... 354
9 9.000e-77UniRef50_UPI00077E49F4 BURP domain-containing protein 3-like n=1 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI00077E49F4  ali  54  98MFFLQNDLHSGKKMKLHFPKSTNQAKFLPRKVSESIPFSTTKLPEILNRFGIQPKSVEAETLRQTIEECEQAGIEGEDKYCATSLEAMVEFSVSKLGNKNINVLSIESDKGISKQVYSIVDKGVKKIGDRSVICHKQKYAYAVFYCHEIKATKTYTVSMVGNDGTKAKAVAVCHTDTRTWNHDNFAFQLLKIKPGTVPICHFLNSDTLVWV. 308
10 2.000e-76UniRef50_A0A2R6PIU6 BURP domain protein n=6 Tax=Pentapetalae TaxID=1437201 RepID=A0A2R6PIU6_ACTCH  ali  62  134LFFMEKDIKMGTKMPLYFTKSTTPTTFLPRQVAEKIPFSSEKMPEIMSYFSVKPDSKEAEIMKKTVKECEEPEIKGEEKYCATSLESMVDFSTNKLGKNIQGVSTEVDRETQLQK--YSITGVEKMAGDKAVVCHKQEYAYAVFYCHKIQTTKEYVVSLVGADGTKAKAVAVCHMDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDNIVWV. 342
11 7.000e-76UniRef50_A0A251SY38 Putative BURP domain-containing protein n=7 Tax=Asteraceae TaxID=4210 RepID=A0A251SY38_HELAN  ali  57  153LFFFENDLHLGKEMNLYFTKNDQKATFLPREIADSIPFSSNKLPQIYNEFSVNPGSMEAKVMKQTLEECEKPSNEGEERYCATSLESMVDFSTTRLGKKVKVISTEVNTKESTLVGKYKIEVAKKFPANTAVICHKLNYAHAVFYCHKTVSTRAYAVSMISADGKKMNVAAVCHTDTSKWNPKHLAFQVLKVKPGTVPICHFLPEDHVAWV. 363
12 1.000e-75UniRef50_C6TI21 Uncharacterized protein n=8 Tax=eudicotyledons TaxID=71240 RepID=C6TI21_SOYBN  ali  63  129LFFLEKDLHPGTKLNLHFTTSSNQATFLPRQVADSIPFSSSKVEVVFNKFSVKPGSEEAQIMKNTLSECEEGGIKGEEKYCATSLESMIDFSTSKLGKNVEVVSTEVVDKETGLQKYTVAPGVNKLSGDKAVVCHKQNYPYAVFYCHKTETTRAYSVPLEGANGVRVKAVAVCHTHTSEWNPKHLAFQVLKVKPGTVPVCHFLPEDHVVWV. 341
13 3.000e-75UniRef50_A0A218XNV2 Uncharacterized protein n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A218XNV2_PUNGR  ali  57  128.FFLEKDLTKGKTMTLHFIKSTNQAAFLPRQFAGSMPFSSKNLPEALNKFSVKPGSVEAELMATTIKECEEPGIKGEEKYCATSLESMVDYAEYQLGKNLRAISTEIKKET-ERQKYKIEEDVKKIMGSKYVVCHKQNYPYAVFYCHKTKNTKAYVVTLKRENGSEVKAVAVCHTNTSKWNPKHLAFRVLGVKPGAVPICHFLPQDHIVWYS 339
14 4.000e-75UniRef50_B7FI52 Dehydration-responsive protein RD22 n=7 Tax=Pentapetalae TaxID=1437201 RepID=B7FI52_MEDTR  ali  58  112LFFLEKDLHHGTKLNLQFSKTTNAATFLPRQVANSIPFSSNKMEYIINKLNIKKGSKGVQIVKNTISECEEQGIKGEEKVCVTSLESMVDFTTSKLGKNVEAVSTEVNKESNLQQYTIASGVKKLGEKNKAVVCHKENYPYAVFYCHKTDTTKAYSVPLEGADGSRVKAIAVCHTDTSEWNPKHLAFQVLKVQPGTVPVCHLLPEDHVVWI. 323
15 6.000e-75UniRef50_C3VIX9 RD22 n=43 Tax=cellular organisms TaxID=131567 RepID=C3VIX9_VITVI  ali  62  127LFFMEKDMRPGTKMNLHFIKNTKEATFLPQSEHPII-FSSEKLPEILKHFSVKPESVEAQIIKNTIKECEAPGTKGEEKYCATSLESMIDFSISKLGKRVQAISTEVVKET-QKQKYTIAAGVKKMAGDESVVCHKQNYPYAVFYCHKTQTTRAYMVPLVGADGTRAKAVAVCHTDTSEWNPKHLAFQVLKVKPGTIPICHFLPEDHIIWV. 335
16 3.000e-74UniRef50_M5XDK2 Uncharacterized protein n=15 Tax=Prunus TaxID=3754 RepID=M5XDK2_PRUPE  ali  52  127IFFLEKDMSPGTTMKFQFPRNSNTATFLPRESAQSIPFSSNKLPEIFNHFSVKPTSEEAKTIKQTIEECEAPGLKGEEIYCATSLESMVDFSTSKLGTRNVEAISTEKGGTMSIQNYTTMPGLKKLAGDKVVVCHKQNYPYAVFFCHAIKHTAAYALSLKGDDGEKVKAVTICHLDTSEWDPEHMSFQIVNVKPGTIPICHFISTDAIAWV. 340
17 5.000e-74UniRef50_A0A2H3ZI43 BURP domain-containing protein 3-like n=4 Tax=Petrosaviidae TaxID=1437197 RepID=A0A2H3ZI43_PHODC  ali  54  78LFFLEEDLHPGAKMTLHFIRTTTGATLLPRRAADSIPFSSAKLPAILSRLSIAPNSIEAKVMNKTLHECEEPAIDGETKYCATSVESMVDFSTSSLGTRNVRALSTAVGREGTPKQVYAISDVQELPSSKLVVCHGENYAYAVFYCHKTSAV-AYKVSLVGKDGTKVEAVATCHTNTTGFNPEHVAFKVLDVKPGTVPVCHFLPQNDIVW.. 286
18 7.000e-74UniRef50_G7I4D9 Dehydration-responsive protein RD22 n=11 Tax=50 kb inversion clade TaxID=2231393 RepID=G7I4D9_MEDTR  ali  56  114LFFLKKDLHHGTKLNLQFTSNNNGTKFLPREVANSIPFSSNKMENILNKFSIKEGSKEAEIVKRTISECEANGIKGEEKLCVTSLESMVDFTISKLGNNVEAVSTEVDKNSNGLQQYVIAKGVKKGEKNKTIVCHKENYPYAVFYCHKTDSTEVYSVPLEGVDGNMVKTIAVCHTDTSEWNPKHLAFYVLKVQPGTVPICHILPQDHVVWVS 329
19 3.000e-73UniRef50_G7I4D7 Dehydration-responsive RD22-like protein n=8 Tax=Pentapetalae TaxID=1437201 RepID=G7I4D7_MEDTR  ali  55  12....EKDLHHGTKLNLQFTSNNNGTKFLPREVANSIPFSSNKLENILNKFSIKEGSKEAEIVKRTISECEANGIKGEEKLCVTSLESMVDFTISKLGNNVEAISTEVDKNSNGLQQYVIAKGVNKGEKNKTIVCHKENYPYTVFYCHKTDSTEVYSVPLEGVDGNMVKTIVVCHTDTSEWNPKHLAFQVLKVQPGTVPICHILPQDHVVWVS 223
20 4.000e-73UniRef50_B9SB84 Polygalacturonase non-catalytic subunit AroGP2, putative n=7 Tax=Euphorbiaceae TaxID=3977 RepID=B9SB84_RICCO  ali  52  188IFFMYNDLHAGQKMKLHITKSTNKARILPRQVAESIPFSSDQLPEIFRRLSIKPESMEAKIIKKKVEDCESIGIKGEDRFCPTSLESMIDFVVSHVGNRVQVLYNKINKPT-RAQEYTILDV--KMVGENQVVCHKQKYPYAVYYCHSISSTKVYMAPLVGADGTKAIAVAVCHSDTSNWNPRHLAFLMLKAKPGEGPICHFIKSDALVWAS 396
21 4.000e-73UniRef50_UPI000CECF87E BURP domain protein RD22-like n=4 Tax=Rosales TaxID=3744 RepID=UPI000CECF87E  ali  61  61.FFLERDLHSGKKMKLYFPKTTNQAKFLPSDVANTIPFSTKKFLEILNHFSVKSESVEAKIMKETIEDCEEPSVKGEAKYCATSLRSLIDFSVSKLGRNVEVFATEVEKEAKMD--FVIGEKGVQKIGEKSVVCHKQNYVYAVFYCHEVHATRAYAVSLVAADGTKAKAVAVCHTDTRFWSAQHFAFQVLKVKPGTVPICHFLPKDNLVW.. 267
22 5.000e-73UniRef50_M5XQY4 Uncharacterized protein n=17 Tax=Prunus TaxID=3754 RepID=M5XQY4_PRUPE  ali  54  116IFFFEKDMRPGATMKFQFPRNSNTATFLPRESAQSIPFSSNKLSEIFNHFSVKPTSVEAKTIKQTIQECEAPGLKGEEKYCATSLESMVDFSTSKLGTRNVEAISTEVLETMSMHNYTTMPGLKKLAGDKVVVCHKENYPYAVFFCHAIKQTAAYVLSLKGDDGEKVKAVTICHLDTSEWNPEHLSFQILNVKPGTIPICHFISTDGIVWV. 329
23 6.000e-73UniRef50_F6H301 Uncharacterized protein n=7 Tax=Vitis vinifera TaxID=29760 RepID=F6H301_VITVI  ali  59  314..FLEKDLHPGTKMAVRFTKTSSAAHFLPHQVAESIPFSSNKLPEILKRFSVKENSAEAQIIQKTIKQCETPAIVGEVKYCARSLESLIDFSTSRLGKNIRVLSNEVE----ADIQEYKFGEGVKMVGEKSVVCHQLNYPYAVAFCHTLHMTKIYMVPLVGADGTGVEAVAVCHRDTSTWDPKALVFQSLKVKPGTLPICHFLPNGHTVWV. 518
24 2.000e-72UniRef50_Q942D4 BURP domain-containing protein 3 n=50 Tax=Mesangiospermae TaxID=1437183 RepID=BURP3_ORYSJ  ali  59  212LFFLEKDLHPGKTMAVHFTATTAGEKFLPRSEADAMPFSSEKVPEILSRFSVKPGSVEAAEMAQTLRDCEAPPAQGERKACATSLESMVDFATSSLGTHVRAASTVVGKEGSPEQEYTVTAVKRAAAGGDQVACHAEPYAYAVFACHLTRATRAYAVSMAGRDGTGVEAVAVCHADTAGWNPKHVAFQVLKVKPGTVPVCHFLPQDHVVWT. 426
25 3.000e-72UniRef50_A0A1D5WN13 Uncharacterized protein n=11 Tax=Poaceae TaxID=4479 RepID=A0A1D5WN13_WHEAT  ali  60  308LFFLEKDLHAGKKMNVHFMATGAGEKFLPRSEADAIPFSSEKAPEILSRFSVAPDSAEAAEMKQTLRECEATAAKGEKKSCATSLESMVDFATSSLGTHVRAASTVVGKEGSPEQEYTMAGVRRAAGADQLVACHAEPYAYAVFACHLTQATRAYTVSMVGKDGTAVEAVAVCHADTAGWNPRHVAFQVLKVKPGGAPVCHFLPQDHVVWT. 520
26 4.000e-72UniRef50_UPI000CECEB9E BURP domain-containing protein 5-like n=1 Tax=Morus notabilis TaxID=981085 RepID=UPI000CECEB9E  ali  51  131.FFLDTNLHAGQKLKLHFPNTQNDAKFLTRKAAESMPFSTNKLPEILKHLGIKPDSIQANRVKTAIEQCEAPAIRGEDKFCATSLESLIDFGVSKLGRGVQVYSTEVIKGDNGTKQVYSISKGVKKIGERSVVCHKQNYVYAVFYCHEIHATTAYKVSLVGSDGTNVEAVALCHADTSSWSPQHVAFQMLKVKPGSVPICHFVSRDNLVWV. 340
27 4.000e-72UniRef50_A0A151SGK1 Dehydration-responsive protein RD22 n=10 Tax=Pentapetalae TaxID=1437201 RepID=A0A151SGK1_CAJCA  ali  59  120LFFLEKDLHHGTKFNLHFTHTLNDATFLPRKIADSIPFSSNKVSDILNKFSITPGSDEAQTVKNTVSECEERGIKGEEKRCVTSLESMVDFATSKLGNSVDAFSTEVRKESEFQEEYRIASGVKKLGGEKGVVCHKESYPYAVFYCHKSDSTKVYSVPLEGADGSRVKAVAVCHTNTSPWNPKHLAFKVLKVQPGAVPVCHFLPRDHVVFV. 332
28 5.000e-72UniRef50_Q5ZFA0 BURP-domain containing protein n=1 Tax=Plantago major TaxID=29818 RepID=Q5ZFA0_PLAMJ  ali  52  133LFFLEKDMHAGTKMKLQFVKTSNQATFLPRQVADSIPFSSKRFPEILR--KFKPTSDEADIMKDTIKDCEDEGIKGEEKFCATSLESMIDFCTSKLGSRNVEAISTNAQENSSPKEYTLVGAPRKMPGNKAVVCHKMDYAYAVFYCHKIAKTVAYEVSLAAADGCKVEAVAVCHHDTSQWNPKHFAFQVLKVQPGSVPVCHFLPQQQIVWV. 345
29 6.000e-72UniRef50_A0A2C9W3T4 Uncharacterized protein n=2 Tax=Manihot esculenta TaxID=3983 RepID=A0A2C9W3T4_MANES  ali  62  85FFFLDKDLHPGTKINLYFTRRTTKVKFLPRQVADMMPFSSNKFSEILHTFSIKRNSTKAEIMRKTIKECEKPALQGEHKYCATSLEAMVDFSASKLGKNIQVLVTEIDKDSTQPQQFVITEGVKKV-GSKIVACHVQDYVYPIFYCHATHTAKAYMVPLVGTNDTNVKAVAVCHTDTSKWNPRHLAFQVLKVKPGAVPICHFLPTDHFVWVA 295
30 9.000e-72UniRef50_A0A251RD82 Uncharacterized protein n=6 Tax=Amygdaloideae TaxID=171637 RepID=A0A251RD82_PRUPE  ali  47  99IFFLEKEIKPGTTMKYSLGRNIAGETFLPRKTAESIPFSSAKLPEILNKFAMKPGSVEATVIQETIQDCESEVLRGEDRYCATSLESMVDFAMSKLGRNVQAISTEVEKGATLQNYTVKPGVKNVNEGGNFILCHKLTYAYAVFFCHTFGQTRAYAVPLQGADGTTANAVAICHLDTSAWNPKNHPLQEVKVKPGTVPVCHYLPQGHIAWV. 309
31 2.000e-71UniRef50_W9S2Y1 BURP domain-containing protein 3 n=2 Tax=Morus notabilis TaxID=981085 RepID=W9S2Y1_9ROSA  ali  50  94.FFLDTNLHAGQKLKLHFPNTQNDAKFLTRKAAESMPLSTNKLPEILKHLGIKPDSIQANRVKTAIEQCEAPAIRGEDKFCATSLESLIDFGVSKLGRGVQVYSTEGIKGDNGTKQVYSISKGVKKIGERSVVCHKQNYVYAVFYCHEIHATTAYKVSLVGSDGTNVEAVALCHADTSSWSPQHVAFQMLKVKPGSVPICHFVSRDNLVWV. 303
32 4.000e-71UniRef50_B9RKR7 Polygalacturonase, putative n=3 Tax=Euphorbiaceae TaxID=3977 RepID=B9RKR7_RICCO  ali  64  114.FFLDKDLHPGTKMNVYFTKIAADAKFLPRKVAKIIPFSSNKFSEIMRKFLVKPNSTKAEIMKKTMEECEEPAFEDEDKYCATSLEAMVDFSTSKLGKDVRVLVTKANKDDTLQQEFSITQG-VEMVGGKLVACHAKNYIYPVFYCHETHITKAYIVPLIGDDKTRVQAVAICHTDTSKWNPMHLAFQVLDVKPGTVPICHFLPENHIIWVT 323
33 5.000e-71UniRef50_A0A1D5VE69 Uncharacterized protein n=4 Tax=Poaceae TaxID=4479 RepID=A0A1D5VE69_WHEAT  ali  59  291LFFLEKDLHAGKKMKVHFMATGAGEKFLPRSEADAIPFSSEKVPEILSRFSVAPDSAEAAEMKQTLRECEATAAKGEKKSCATSLESMVDFATSSLGTHVRAASTVVGKEGSPEQEYTMAGVRRAAGADQLVACHAEPYAYAVFACHLTRATRAYTVSMVGKDGTAVEAVAVCHANTAGWNPRHVAFQVLKVKPGGAPVCHFLPQDHVVWT. 503
34 9.000e-71UniRef50_UPI00046E1DB9 BURP domain-containing protein 5-like n=2 Tax=Prunus mume TaxID=102107 RepID=UPI00046E1DB9  ali  47  194IFFLEMEIKPGTTMKYSLGRNIAGETFLPRKTAESIPFSSAKLPEILNKFSMKPGSVEAAVIQETIQDCESEVLRGEDRYCATSLESMVDFAMSKLGRNVRAISTEVEKGATLQNYTVKPGVKNVNEGGNFVLCHKLTYAYAVFFCHTFGQTRAYAVPLQGADGTTANAVAICHLDTSAWNPQNHPLQEVKVKPGTVPVCHYLPQGHIAWV. 404
35 1.000e-70UniRef50_A0A251RE81 Uncharacterized protein n=2 Tax=Prunus persica TaxID=3760 RepID=A0A251RE81_PRUPE  ali  54  165IFFFEKDMRPGATMKFQFPRNSNTATFLPRESAQSIPFSSNKLPEIFNHFSVKPTSVEAKTIKQTIEECEAPGTKGEEKYCATSLESMVDFSTSKLGTRNVEAVSTEVLETMSMHNYTTMPGLKKLAGDKVVVCHKENYPYAVFFCHAIKQTAAYVLSLKGDDGEKVKAVTICHLDTSEWNPEHLSFQILNVKPGTVPICHFISTDAIAWV. 378
36 1.000e-70UniRef50_G7J3E3 Dehydration-responsive protein RD22 n=37 Tax=Pentapetalae TaxID=1437201 RepID=G7J3E3_MEDTR  ali  57  106LFFLEKDLHPGTKMDLNFIRSSNVATFLPRQVASATPFSSEKLSHIFNKFSVKPESEEAHVMKNTIEECEDAAIQGEEKYCATSLESMVDFSISKLGKRVKVVSTTVVDNKSAGLKKYTLKSMKLTAEDKAVVCHKQNYPYAIFYCHKTESTRAYFVPLEADNGTRVKADAVCHTDTSKWNPEHIAFQVLKIKPGTLSVCHFLPVDHIVWV. 320
37 6.000e-70UniRef50_I1XB03 Dehydration-responsive protein n=3 Tax=Mesangiospermae TaxID=1437183 RepID=I1XB03_MORAL  ali  60  1...............MHFTKSSNRATFLPRQVAASIPFSSNKLPEILTKFSVTPQSEEADMIKETLNECDSPSVKGEEKYCATSLESMIDFSTSKLGKDVQALSTEVETETGV-QTYTVTRVEKKTSGEKSVVCHKQKYAYAEFYCHATQTTETYLVSMEGADGVKAKAVAVCHTDTAAWNPRHLAFQVLKVKPGTVPVCHFLPEDHIVWI. 195
38 7.000e-70UniRef50_A0A0Q3EYU4 Uncharacterized protein n=3 Tax=commelinids TaxID=4734 RepID=A0A0Q3EYU4_BRADI  ali  50  106LFFLESDIQPGKKLTLHFPAYVAGEKFLPRGEADAIPFSSDKIPEILSRFSLSPGSAEAAEVAETLRDCERPAAKGERKACATSLESMVDFAVSGLGTSHVRVTSTAVVAGGQKQEYTVAGVKRASAAQRLVVCHAEPYAYAVFSCHLARATRAYTVSVVGEDGTAAEAAAVCHTDTAGWNPKHLALQMLNVKPGTVPVCHFLPQNDVVWA. 325
39 1.000e-69UniRef50_B9SAG3 Polygalacturonase, putative n=11 Tax=rosids TaxID=71275 RepID=B9SAG3_RICCO  ali  55  95VYFLYNDLFPGKKMMLIFTKSTNGSNFLPRKIAETIPFSSNKFSEILNYFSIEPASKQSQIVKQTIEECETPGVKGEEKYCATSLESLVDFVVAKFGKEVQALSNEAEEEDKEQK--YTILKEIKMMGDDQIVCHKKRYTYAVFYCHIIMATKAYLIPLVGDNGSKAKAVVVCHTNTSSWNPGHFAFQVLKVKPGGPPICHFLNSDTIVWV. 303
40 1.000e-69UniRef50_B9SAG0 Polygalacturonase, putative n=12 Tax=Malpighiales TaxID=3646 RepID=B9SAG0_RICCO  ali  54  68IFFLYDDLLPGKRMMLVFTKSTSRSSFLPRKIAETIPFSSNKFSEILNYLSIKPTSKQSQIMKQTIEDCETPGVKGEDKYCATSLESLVDFVIAKLGKEVHALSNKGEEEDSKQN--YTILKEIKMMGGNQIVCHKMRYVYAVFYCHIIMPTMVYLVPLVGDNGCKAKAVVICHTNTSSWNPEHFAFRVLKVKPGGPPICHFLNSDTIVWVS 277
41 2.000e-69UniRef50_B9SAG2 Polygalacturonase, putative n=3 Tax=Ricinus communis TaxID=3988 RepID=B9SAG2_RICCO  ali  54  63VFFLFDDLLPGKKMMLVFTKSASDSNFLPRKIAEAIPFSSNKFLEILDYFSIKPASKQSQIMKQTIEECEAPGVKGEDKYCATSLESLVDFVVGRFGKEVQAFPNDVKEEDKKQK--YTILKKIKMMGDNQIVCHKTRYPYAVFYCHIIMATKVYLVPLVGDNGSKAKALVVCHTNTSSWNPRHFAFQVLKVKPGGPPICHFLNTDSVVWI. 271
42 3.000e-69UniRef50_A0A2P4KUH3 Burp domain-containing protein 3 n=4 Tax=Quercus suber TaxID=58331 RepID=A0A2P4KUH3_QUESU  ali  37  595.FFTMDDLFVGNIMPLYFPIQ-ELSEFLPREEADSIPFSMPQLPNVLQLFSIPIDSPNARAMEDTLQQCEATPITGETKLCATSLESMLAFVHSIMGSWANLNVLTTKHPTMSTQNYDVLRVSKELYAPKWVACHPLPYPYKIFFCHFIENTKIFKVLLGGENGHKVEAVAVCHMDTSDWDPNHILFRQLGVKPGSSPLCHFLPKYHLVWV. 806
43 3.000e-69UniRef50_F6H2Z9 Uncharacterized protein n=10 Tax=Pentapetalae TaxID=1437201 RepID=F6H2Z9_VITVI  ali  56  90.FFLQTDLHPGTKMVLQLPQTTNEAMFLPRQVADSIPFSSKKLPEILNRLSVKEKSAEAELMKKEIEKCEEPAMDGESRFCATSLESLIDFSTSKLGRNVNVLTNEVRMGSQEFE----FGVRMKKVADKSVVCHKMNYPYAVFYCHTFAKTRTYMIPLVGDDGSKAKAMAACHSDTSAWHPQHVAFQVLKIKPGTVPICHFLHNNAMVWI. 295
44 5.000e-69UniRef50_UPI000CED1026 BURP domain-containing protein 9-like n=1 Tax=Morus notabilis TaxID=981085 RepID=UPI000CED1026  ali  42  236.FFTPDDLYAGKIMPLYFPIEDHSSRFLPREVAESIPFSVSQLPNLLQLFSIPQGSPEANGMEETLRDCELKPINGEIKLCATSLESMVEFARSIIGSQVNLNTTHPTMATDITQNYTVLEGPKQVLAPKMVFCHPKPYPYAVFFCHFFGTTKVLQVPVRGDSGDDVEAMAVCHMDTSDWDPNHVLFSLLGVKPGSSPVCHFLPKNHLVWI. 450
45 9.000e-69UniRef50_A0A2C9W9F1 Uncharacterized protein n=10 Tax=Crotonoideae TaxID=235631 RepID=A0A2C9W9F1_MANES  ali  50  102VYFLYHDLLPGKNMKIIFTKSTNVSNFLPRKIAESIPFSSNKFPEILNYFSVKSSSKEAQILKQTIEECEALPIRGEDKYCATSLESLVDLVAAKFGQNVQAFYNEAEEENKKQE--YTILQGIKMMGENHMVCHKQRYAYAVFYCHRIKDTKVFKVPLMGVDGSKAEAAVVCHMDTSAWHPHHYAFQILNVKPGGPPICHFLNSDAIVWIS 311
46 2.000e-68UniRef50_A0A2I4GYS7 BURP domain-containing protein 9-like isoform X1 n=4 Tax=Fagales TaxID=3502 RepID=A0A2I4GYS7_9ROSI  ali  38  443.FFTMDDLFVGKTMPLRFPIQEF-PHFLPREEADSIPFSMAQLSNVLQLYSILPGSPSAQAMENTLQQCESLPTKGEIKHCATSLESMLGFVHNIMGSWANLTITHPTVATVSEQNYSVLRISEEIYAPKWVACHPLQYPYKVFYCHFIERSKIFKVLLGGENEHKVEAVAVCHMDTSDWDPDHILFRQLGIKPGTSPICHFLPVYHLVWV. 655
47 2.000e-68UniRef50_M5XEZ4 Uncharacterized protein n=3 Tax=Prunus persica TaxID=3760 RepID=M5XEZ4_PRUPE  ali  53  237IFFFEKDMRPGTTMKFQFPRNSNTATFLPRESAQSIPFSSKKLPEIFNHFSVKPTSEEAKTIKQTIEECEAPGLKGEEKYCATSLESMVDFSTSKLGTRNVEAISTQVLETKYMHNYTTIPGLKKLVGDKVVVCHKENYPYAVFLCHAIKQTEAYVLSLKADDGMKVKAVTICHLDTSEWDPEHLSFQILNVKPGTTPICHFLSTDAIAWV. 450
48 2.000e-68UniRef50_A0A1R3G374 Uncharacterized protein n=2 Tax=Corchorus capsularis TaxID=210143 RepID=A0A1R3G374_COCAP  ali  52  51VYFLESALHPGKKMNLDVVQKPTKAAFLPRPMAESIPFSIQELPQIYKYYSLEPKSAEANLLKETIENCERPAIQGEAKYCATSLETFIDLGVSKMGKNIQLLSNELEKETENQEF--SISQGVKMMGESEIVCHKMKYAYAVFLCHSIDETAVYRVPVVGADGTRAIALAVCHKDTSAWNPKHLAFQVLKVKPGTIPICHFLARETLVWIS 261
49 3.000e-68UniRef50_A0A1R3KV72 Uncharacterized protein n=4 Tax=Malvaceae TaxID=3629 RepID=A0A1R3KV72_9ROSI  ali  43  220IYFFQEDLRPGKKMNLRLTEKSDKALFLPQQIAKSMPISTDKLPKILKNFSIKAESSYAKGVGVTVMNCERAEMRGEEKYCATSLESFVDLGVAMFGKNIRLLSHQL--GKGLKNPLVTIDRGMRDMGENNIVCHKMQYPYAVYLCHSIKKTIVYDVPLIGVDGTKVNAVAVCHLDTSAWSPKHVAFQFLKVKPGSVPICHFLGRDTIVWVS 430
50 8.000e-68UniRef50_A0A2C9VRF5 Uncharacterized protein n=3 Tax=Crotonoideae TaxID=235631 RepID=A0A2C9VRF5_MANES  ali  50  167VFFLPNDLHAGKKMRLHITKSVNKARILPRQVADSLPFSTNKLAEIMKYFSVNPESSKGRMLKETVEDCESPGIKGEDRFCPTSLESLVDFSVKHVGNKAQVLMNEIDRP-KREQEYTI--KEVKFIGENHVVCHKQNYPYAVYYCHALNGTKVYTAQVVGADGTKAKAVAVCHTDTSAWNPGHLAFLVLKTKPGEGTVCHFIRSDTFVMVS 375
51 2.000e-67UniRef50_UPI000B7982D7 BURP domain protein RD22-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B7982D7  ali  52  108LFFLEKDMKFGHSMRLHFKQRTNDATFLPREKAKTLPFSTNKIIDILHEFEVEPNTEEAKVIEETIEGCKHKGIQGEQKYCATSLESLVDYAKNTLGKNVKAMSTEAKIIGNKVKNYTIAAKKIVAKDNEAAVCHKQRYAYAVFYCHKSKGTSAYKVTLISKDGSKAKAMAICHKDTSAWNPQHLAFQVLNVKRGSCPICHFLPEDHIVWIS 319
52 2.000e-67UniRef50_A0A0C9RPJ9 TSA: Wollemia nobilis Ref_Wollemi_Transcript_5294_1444 transcribed RNA sequence n=1 Tax=Wollemia nobilis TaxID=56998 RepID=A0A0C9  ali  50  165MFLLEKDLHPGTKITLHLVKTAQRTNFLPRSVADKIPFSSAKLSAATEALKVSEGSDVALAMKETLQTCESPAVRGESKYCATSLESIVDYATGRLGTNSVKVMLTDVAKDSVKQNYTITAVLFQSKGAKSVVCHSQAYAYAVYYCHEAKATKTVQVSLKGEDGTIAEGVAVCHADTSAWNPDHVAFKVLNVKPGGAAVCHFIPEDHVVW.. 377
53 2.000e-67UniRef50_A0A2H3X8V3 BURP domain-containing protein 3-like n=1 Tax=Phoenix dactylifera TaxID=42345 RepID=A0A2H3X8V3_PHODC  ali  51  43IFFLQKDLHPGANKTIHFIRTSSGATLLPRRMADSIPFSSIKLPEMLARLSINPNSTEAESMKKTLQDCEAPPVDGETKYCATSLESMVDFSTSTLGTRNIRALSTTLDNHATPKQVYTMSKVQKLAGSKFVSCHVMNYIYAVFYCHSQ-STVAYTLSMVGKDGTKVEAVAACHTNTAEFNPQYVAFQVLHVKPGTVPICHFLLENGILW.. 252
54 4.000e-67UniRef50_A0A067JE93 Uncharacterized protein n=3 Tax=Crotonoideae TaxID=235631 RepID=A0A067JE93_JATCU  ali  47  135IFFLYNNLRAGNSFSLIFTDLDNETSFLPRQVADSIPFSSDKLPEILNRFSINDTSIEANYIEQTLQECEAPIMNGEDKYCATSLESFVDFGVARLGKKVLVLSNE--GEEKNKEQNYRVLNGIKMLGEEQIVCHKEKYAYVVFYCHTLKATEVYMVPLLGANGRKAKALVICHKDTSAWDPNHIAFQLLKVKPGGPSICHFLYSDTFVWV. 343
55 5.000e-67UniRef50_A0A067LAS7 Uncharacterized protein n=4 Tax=Crotonoideae TaxID=235631 RepID=A0A067LAS7_JATCU  ali  48  327VFFVYNDLHAGQKMRVHITKSTNKARILPRQVAESIPFSTDKLSEIFHRFSVDPESRQSKVMKQTIEDCESPGIKGEDRYCSTSLESLIDFSVKHVGNKVQVLFNKVDEP-KRVQEYTIMDV--KFMGENHVVCHKQKYPYAVYYCHALNGTRVYTAQLVGADGTEAEAVAVCHSDTSDWSPKHMAFLLLNMKPGEGTICHFIRSDTLVMVS 535
56 8.000e-67UniRef50_UPI000BE26549 BURP domain protein RD22-like n=1 Tax=Vigna radiata var. radiata TaxID=3916 RepID=UPI000BE26549  ali  48  148LFFLEEGLRRGAKLDLYFPKTKYLTPLLPREITEHLPFSSEKINEILEILAVKPDSKNAENMEETLKNCEDPGMNGEEKHCATSLESMVDFVTSKLGKNVHVTSTEVEIESKS-QKFIVKDGVKLLAEEEIIACHPMDYPYVVFYCHKILNSTAHFMPLEGEDGSRVKAVAICHKDTSEWDPNYIAMQVLKVKPGTSPVCHFFPDGHLLWYA 358
57 1.000e-66UniRef50_K4B3G3 Uncharacterized protein n=23 Tax=Solanaceae TaxID=4070 RepID=K4B3G3_SOLLC  ali  40  180VFFLINDLKIGKTITVSFPRRDSSPSFLPKEEADSIPFSQKELPNLLQRFSFSRNSPQGKAMEDTLRECEAPHIKGETKYCATSAEAMLDFVQGIMGEKTQFKTTHFSNSTPPLQEYTILDAPQEVETPKMVACHTMPYAYAIFYCHYISKSKVFKVSLGGENGDRVEAIAVCHLDTSEWSPSHASFQLLGILPGTSPICHFFPSDNLVWV. 396
58 1.000e-66UniRef50_A0A1R3G8R8 Uncharacterized protein n=1 Tax=Corchorus olitorius TaxID=93759 RepID=A0A1R3G8R8_9ROSI  ali  42  261MYFFQEDLRAGRMMNLQLAQKGDRTPFLPQQIADSIPISTNKLPEILKKFSIKAESSYGKGVRITVMNCERAEMRGEEKYCATSLESFVDLGVAMLGKNIMLLSHQL--GKGLKNPLVTINRGMRNMGEKNIVCHKTKYPYAVFLCHSIKKTTVYDVPLVGIDGTKVNAVAVCHKDASGWSPNHIAFKFLKVKPGTVPICHFLRKDAIAWV. 470
59 1.000e-66UniRef50_F6H300 Uncharacterized protein n=6 Tax=rosids TaxID=71275 RepID=F6H300_VITVI  ali  57  88.FFLETDLHPGKKMKLNLATTTNGAVFLPHQVAESMPFSSNKLPEILNRFSLKENSAEAEIIKKELEECEEPAMEGEARYCATSLQSLIHFSTSKLGRNVNVLTNEVKTGSQE----YEFGVGMKRVADKSVVCHKMNYPYAVFYCHTFTKTRTYMIPLVGADGSKAKAMAACHSDTSAWHPKHVAFKVLNVKPGTVPICHFVHNNAMVWI. 293
60 2.000e-66UniRef50_Q08298 BURP domain protein RD22 n=157 Tax=Magnoliophyta TaxID=3398 RepID=RD22_ARATH  ali  58  175LFFLEKDLVRGKEMNVRFNAEDGKTAFLPRGEAETVPFGSEKFSETLKRFSVEAGSEEAEMMKKTIEECEARKVSGEEKYCATSLESMVDFSVSKLGYHVRAVSTEVAKKNAPMQKYKIAAGVKKLSDDKSVVCHKQKYPFAVFYCHKAMMTTVYAVPLEGENGMRAKAVAVCHKNTSAWNPNHLAFKVLKVKPGTVPVCHFLPETHVVWFS 391
61 2.000e-66UniRef50_Q8GSG3 Resistant specific protein-1(4) n=7 Tax=Vigna TaxID=3913 RepID=Q8GSG3_VIGRA  ali  46  192.FFSEERLRRGAKLDVLFRKRNFSTPLLTREIAEHLPFSSEKINEILEILAVKPDSKDAKNVEETLNHCEKPALKGEEKQCATSVESMVDFVTSKLGNNARVTSTELEIGSKF-QKFIVKDGVKILAEEKIIACHPMSYPYVVFYCHKMANSTAHFLPLEGEDGTRVKAVAICHKDTSQWDPHHVAFQVLKVKPGTSSACHFFPEGHLVWYA 401
62 2.000e-66UniRef50_A0A2P6PP13 Putative BURP domain-containing protein n=2 Tax=Rosa chinensis TaxID=74649 RepID=A0A2P6PP13_ROSCH  ali  38  409.FFTFEDFYKGNALPLNFPKQDHSR-FLPKATADSIPFSTSQLPHLLQLFSTPRDSRDAKHMAWTLDQCELKPIKGETKFCATSLESMIDFVQKIIGSGVNFNTTHPETSTAITQKYTILDEPKQVLASKMVFCHPVPYPYAVFFCHHFENTKFFKVSLGGENGDKVEAVAVCHMDTSDWDPNHSLFSLLGIKAGSSPVCHFFPGNHLVWI. 622
63 2.000e-66UniRef50_Q0JEP3 BURP domain-containing protein 5 n=12 Tax=BOP clade TaxID=359160 RepID=BURP5_ORYSJ  ali  49  108LFFLETNLQSSKSIKLHFANMMAGTKFLPRGEADAVPFSSKDLQEILARFGVRPGSVDASVVKNTLLECELPANKGEKKACATSLESMVDFVASSLGTRDIKAASTFKDGDTPAQEYTVTGARRMAETGQLIACHPESYPYAVFMCHLTEATRAYKASLVGKDGAAVEAVAVCHTDTAEWNPKHAAFQVLGVKPGTVPVCHFVQPDVVVWT. 321
64 2.000e-66UniRef50_A0A0D3HIQ8 Uncharacterized protein n=2 Tax=Oryza TaxID=4527 RepID=A0A0D3HIQ8_9ORYZ  ali  51  153LFFLEKNLQQGKKINLHFANATTNSKFLPRGKADSIPFSSKKLPEILDRFGVRPGSDDAAEMSATLHDCELPANKGEKKACATSLESIVDFVTSSFGASDVDAASTVVESSSLAQDYTVSGVRRMAGTGQLIACHPESYPYAVFMCHLTETTRAYKASLVGKDGTAVEAVAVCHTDTSDWNPEHAAFHVLGVKPGTVPVCHFMQPDAVVWT. 373
65 2.000e-66UniRef50_A0A251RD90 Uncharacterized protein n=4 Tax=Prunus TaxID=3754 RepID=A0A251RD90_PRUPE  ali  44  34.FFLEKEMQPGTTMKYSLGRNINGECFLPRNIAQSIPFSSAKLPEVVNKFSMEPTSVEAAVIQETIQDCESGTLNGEDRYCATSLESMADFAMSKLGRNVQAFSTEVEKGATLQKYTVKPGVKKVNDGGNFILCHKLTDANAVFFCHTFGQTRAYVVPLKGADRTTASAVAICHLDTSAWDPKNHPLQEVKVKPGTVPVCHYLPQGHIAWV. 243
66 4.000e-66UniRef50_A0A199VZW5 BURP domain-containing protein 3 (Fragment) n=1 Tax=Ananas comosus TaxID=4615 RepID=A0A199VZW5_ANACO  ali  52  46LFFLEKDLRPGKKMTLHFAEVASSPAFLPRKEADAIPLSVEKLPEVLGRFGIQPDSVEARWMRKTARECQEPAVGGEKKFCATSLESMVDFSTSSLGTRDVRAVSTTV---TKKEYTIVQSGIYKLAGDELVACHVETYAYAVFYCHLTGSTRAYMVKMVGKDGAAVDAAAVCHADTAAWNPKHLAFQVLNVKPGTMPICHFLPQDHVVWT. 253
67 4.000e-66UniRef50_A0A2I4GYR9 BURP domain-containing protein BNM2A-like n=7 Tax=rosids TaxID=71275 RepID=A0A2I4GYR9_9ROSI  ali  40  153IFFTMKDLKVGKTMPVYFPKRDPSPRFLPREEADSIPFSLNELPRLLEIFSFSPDSHQAKAMEDTLRQCEIEPIKGETKLCATSLESMLDFARGMVGLNSRFQTSHLTKSSTLFQNYTFLSMPQEISAPKMVACHTMPYPYAVFYCHGQEKNKGFKVTLGGENGDRVEAIAVCHTDTSQWSPDHVSFRVLGVKPGTSNVCHFFPADNLVWV. 369
68 1.000e-65UniRef50_A0A2C9W731 Uncharacterized protein n=11 Tax=Euphorbiaceae TaxID=3977 RepID=A0A2C9W731_MANES  ali  51  108VYFLYHDLLPGKSMRIIFTKSTNGSNFLPRKIAESIPFSSNKFPEILNYFSIKSTSKEAEIMKQTIEECEAPPIRGEDKYCATSLESLVDLVAAKFGQNVQAFYNEAEEENKKQE--YTILQGIKMMGENHMVCHKQKYAYAVFYCHRIKDTKVYKVPLMGVDGSKAEAAVVCHMDTSAWHPHHYAFQILNVKPGGPSICHFLNSDTIVWIS 318
69 2.000e-65UniRef50_UPI0005118F80 BURP domain-containing protein 3-like n=2 Tax=Maleae TaxID=721813 RepID=UPI0005118F80  ali  49  125IFFLEKDLHPGRAMNYRLAGSGNSSPFLSRKTAERIPFSSSQLPEILDKLSVKPGSDEADLIKGTIQNCDSPGASDEAKQCVTSLESMIDFATSTLGKNVLAIATEVEQGAAPMQKYTITDGAKRLAASNIVVCHKMSYAYAVFYCHSIEKTTTYVVPLQGADGSKAKAVAACHQDTSQWYPNHYAFKELNVERGTVPICHFLKAEDVAWVT 340
70 2.000e-65UniRef50_UPI0005FB3F7D BURP domain-containing protein 5 n=1 Tax=Jatropha curcas TaxID=180498 RepID=UPI0005FB3F7D  ali  48  102.FFVYNDLHVGQKMRLHITKSTNKARILPRQVADSIPFSVDHLPAILQRFSVKPESPQAKFIKQTIKDCESSGIKGEDRYCATSLESLVDFTVKHVGDNAQILFNEIDEQ-RREQEYTITDV--KLIGENHVVCHKQKYPYAVYFCHALNGTKVYIAGLVGGDGIKAKGVVACHSDTSAWNPGHLAFLLLNMKPGDGTVCHFIKSDTIAVVS 309
71 3.000e-65UniRef50_A0A2P5W432 Uncharacterized protein n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5W432_GOSBA  ali  48  231.FFFQRDLRTGKLVNLPLIATGDKTPFLPDRVAKSIPFSSAKLPEILNHFSLKPQTRETNTIGETIRGCERAAINGEQKFCATSLESFIDLSISKLGKQIQLLSIEFSKETKNPLF--TISRGMQNMGEHELVCHKMEYPGAVFLCHALNKTGVYKVPLVGRDGTKANALAVCHKDTSGWNPKHMAFQILKVKPGTVPICHFLFRDTLVWVS 440
72 3.000e-65UniRef50_A0A1R3GUV2 Uncharacterized protein n=4 Tax=Pentapetalae TaxID=1437201 RepID=A0A1R3GUV2_COCAP  ali  64  51.......................KSTFLPRQIAQKIPFSSNKLPEILNKFSVTPGSAEAEMMKNTIKECEAPQIRGEKKYCATSLESMIDFSTSKIGKNVQAISTEVEKQTPL-QKYTIAYGVQKISGDKSVVCHKQNYLYAVFYCHRSEKTRAYMVPLEGADGTKAKAVAICHTDTSAWNPKHVAFQVLKVEPGTIPICHFLPKDHI.... 234
73 6.000e-65UniRef50_M0TXQ6 Uncharacterized protein n=3 Tax=Mesangiospermae TaxID=1437183 RepID=M0TXQ6_MUSAM  ali  54  22LFFLEKDLHPGAKMKLHFTNTISGASFLRRRAADSIPFSSTRLREILDRFSVEPNSAEAAAIKQTLRDCEEPAVRGERKTCATSLEAM--------------------EGTPAQEYTVAASGVREMGGEELATCHAEPYAYAIFYCHATSTSRGYEVDMVGKDGTTVEAAAVCHTDTTAWNPEHVAFKVLDIKPGSAPVCHFLPQDHVVW.. 211
74 7.000e-65UniRef50_I1LJF4 Uncharacterized protein n=27 Tax=Pentapetalae TaxID=1437201 RepID=I1LJF4_SOYBN  ali  40  72VFFTIEDLKVGKTMPIHFPKRDPSPKLWPREEADSLPFSLNKLPNLLKIFSVSQNSPKAKAMEDTLRECETKPIKGEVKFCATSLESMLDFTQSILGFTSDLKVLSTSHQTKTFQNYTMLENIIEIPASKMVACHTMPYPYTVFYCHSQESNKIYRVPLAGENGDRVDAMVVCHMDTSQWGHGHVSFQVLKVKPGTTSVCHFFPADHLIWV. 288
75 7.000e-65UniRef50_A0A0D2QXF8 Uncharacterized protein n=3 Tax=Gossypium TaxID=3633 RepID=A0A0D2QXF8_GOSRA  ali  48  62.FFFQRDLRTGKLVNLPLIATGDKTPFLPDRVAKSIPFSSAKLPEILNHFSLKPQTRDANTIGETIRGCERAAINGEQKFCATSLESFIDLSISKLGKQIQLLSIEFSKETKNPLF--TISRGMQNMGEHELVCHKMEYPGAVFLCHALNKTGVYKVPLVGRDGTKANALAVCHKDTSGWNPKHMAFQILKVKPGTVPICHFLFRDTLVWVS 271
76 8.000e-65UniRef50_A0A251V5S3 Uncharacterized protein n=6 Tax=Asteroideae TaxID=102804 RepID=A0A251V5S3_HELAN  ali  37  53VFFHVNDLHSGKKMPIYFAVNDPSPRLLTREQSDSIPFSSSKLSYILELISLANGSPQALAMQQTLKQCELEATPGETRFCASSLESMLDLTRGIMGMVKLKALTTNIHNNTLLQEYTFLNEPLEINVSNMVACHTMAYPYVVYYCHGQKGNRVFEISLGGENGNIVDAIAVCHMDTSNWDSDHVAFRVLGVQPGSSPVCHFLPADNIVWI. 268
77 1.000e-64UniRef50_F6HQK9 Uncharacterized protein n=9 Tax=Pentapetalae TaxID=1437201 RepID=F6HQK9_VITVI  ali  38  57IFFTITELKVGKRIPVYFSKRDPSPHLLPREEVESIPFSSAQLPYLLQFFGFSQGSPQAIAMENTLRHCETEPIEGETKSCVTSLESMLDFSQKIFGLKASFEVISTKLGTSLLQNYTILKLPKPISAPKMVACHTLPYPYAVFYCHFQEGNKVFEVSLGGENGDRVEAVAVCHMDTSQWNQDHVSFRLLGVQPGASPVCHFFPADNLIWV. 273
78 1.000e-64UniRef50_A0A1S3U2I0 dehydration-responsive protein RD22-like n=4 Tax=Vigna radiata TaxID=157791 RepID=A0A1S3U2I0_VIGRR  ali  48  64IFFFEEELKQGAKFDTHFRKMEYLAPLLSREITENIPFSSEKIKEILEILAVKPESWNAKNVEKSLEICEEPAMNGEEKQCATSVESMVDFVTSKLGKNVHVTSTEVEIESKS-QKFIVKDGVKILAEEEIIACHPMNYPYVVFYCHKISNSTAHFVPLEGEDGTRIKAIAVCHKDTSEWNPDHIAMQVLKVKPGTSPVCHFFPDGHLLWYA 274
79 2.000e-64UniRef50_UPI000B8EEDBF protein RAFTIN 1A-like isoform X1 n=2 Tax=Helianthus annuus TaxID=4232 RepID=UPI000B8EEDBF  ali  51  285LLFLENNLHQGEELKLHFIKNYHKTGFLPKHISDSIPFSLKDIPQIYNKFSVKPDSLEAKIMKQTLSLCEVKGIEGEETFCVTSLESMVDLSTTKLGKKVKALSTEVNAKESTPSQTYKIEFVKKLIVNKALICHRQNYAYAVFYCHTIIGTESYVVSLEGVDGTKVKAVAICHTDTTKWNPKSLAFEVLKVSPGTT-ICHFLHEEHVIWV. 494
80 2.000e-64UniRef50_A0A2K2AU90 Uncharacterized protein n=2 Tax=Populus TaxID=3689 RepID=A0A2K2AU90_POPTR  ali  48  35IFYLYNDLHPGKKMKLLFTNSGTKVSFLPRRVAESIPFSSDEFPEILKYFSLQVNSKEAQIISDEIGNCESPNMEGEEKYCATSLESLIDFNVARLGQNVQVLSTEP----GKKQEYTVSAKAEMRGEHKAAVCHKIRYPYAVHYCHVIEGTEVYVVPLIAAGGAEVKAVTVCHLNTSAWSPDHMAFEVLKIKPG-PAVCHFLATDTLIWV. 240
81 2.000e-64UniRef50_UPI000D627C1B LOW QUALITY PROTEIN: BURP domain-containing protein BNM2A-like n=1 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI000D627C1B  ali  38  2LFFTMEELMVGKILPVYFRRTNPSPHFLPREEADSIPFSLKELPNLLQFFSFSQNSPQAKAIEDTLRQCEIEPIKGETKLCVTSLESMLDFARSVFGLNSDFATTYHGNSNIRFQNYTILQVPKENLASEMVACHSMLYTYAVFYCHSQKSNKVYRISLGGDDGERVEAVAVCXMDTSQWSPNHASFRVLRILPGTSPVCHFFPADTLIWV. 218
82 3.000e-64UniRef50_A0A2C9VSU9 Uncharacterized protein n=7 Tax=Crotonoideae TaxID=235631 RepID=A0A2C9VSU9_MANES  ali  49  231VFFLPNDLHAGKKMRVHITKSANKARILPRQVADSLPFSTNKLAEIMKRFSVNPESRQGKILKQTVEDCESPGIKGEDRFCPTSLESLVDFSVKHVGNKAQVLMNEIDKP-KREQEYTI--KEVKFIGENHVVCHKLQYPYAVYYCHALKGTKVYTAQVVGADGTKAKAVAVCHTDTSAWNPGHLAFLVLKMKPGEGTVCHFIRSDTFVMVS 439
83 3.000e-64UniRef50_A0A1J6ITY3 Burp domain-containing protein 3 n=2 Tax=Nicotiana attenuata TaxID=49451 RepID=A0A1J6ITY3_NICAT  ali  49  197.YFFETDLHQGKKMNLPSLKNHNPAPILPRKIADSIPFSSDKMEEILNHFSVDKDSEVAKMIKKTIKMCEEPAGNGEKKYCATSLESMVDFATSHLGTNNIIALSTEVEKETPQVQIYTIEEVKEKANGKGVICHKIGYPYAVHFCHDVGSTRTFMVSMVGADGTKVNAVAECHEDTSLMNPKALPFQLLNVKPGDKPICHFILDDQIALV. 406
84 3.000e-64UniRef50_A0A1U8PQS8 BURP domain protein RD22-like n=16 Tax=Malvaceae TaxID=3629 RepID=A0A1U8PQS8_GOSHI  ali  51  91MYFFENDLYPGKKVKLYFSKARNEVPFLSRRVAESIPFSSDEFPGILKLFSLKPESKEAKAMNRTIAMCERRVIEGEDMYCATSLESLVDLSVRKFRNDIQVLSSEVEKETENH-DFSVANEGTILMGEKDIVCHKMKYPYAVFLCHSLDKTAAYRVPLVGKHGTKANALAVCHRDTSAWNPNHIAFLLLKVKPGTVPICHFLMRESLVWV. 303
85 4.000e-64UniRef50_UPI00077E77BE BURP domain-containing protein 3-like n=1 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI00077E77BE  ali  40  273.FFTPDDLGVENIMPLHFAIQQHSR-FLPKQVADSIPFSKSQLLQVLQLFAIPQGSSEAKDMEQTLRDCSLRPITGEIKLCATSLESMVDFTSEIIGPGIEFSTTHPTISKAFTQNYTILEVPKEVVAPKMVFCHPVPYPYAVFFCHYFGTTKVFKVSLGGENGDKVKAIAVCHMDTSDWDPKHMLFRLLRTKPGNSPVCHFLPANHLVWT. 486
86 6.000e-64UniRef50_A0A251RXF8 Putative BURP domain-containing protein n=2 Tax=Pentapetalae TaxID=1437201 RepID=A0A251RXF8_HELAN  ali  36  56VFFHVNDLYLGKKMPIYFAVNDPSPRLLTRELSDSIPFSSKRLAYLLELISLAAGSPQALAMEQTLKQCELEATPGETRFCASSLESMLDLTRGIMGMDKLKALTTNIHNNTLLQEYTFLKEPMEINVSDMVACHTMAYPYAVYYCHGQKGNRVFEISLGGESGNIVDAIAVCHMDTSNWDSDHVAFRVLGGQPGSSPVCHFLPADNIVWI. 271
87 8.000e-64UniRef50_B9G9L9 BURP domain-containing protein 17 n=2 Tax=Oryza sativa subsp. japonica TaxID=39947 RepID=BURPH_ORYSJ  ali  51  362LFFLEKNLQQGKKINLHFANATTNSKFLPRGKADSIPFSSKELPEILDRFGVRPGSDDAAEMSATLQDCELPANKGEKKACATSLESIVDFVTSSFGASDVDAASTVVESSSLAQDYTVSGVRRMAGTGQLIACHPESYPYAVFMCHLTETTRAYKASLVGKDGTAVEAVAVCHTDTSDWNPEHAAFHVLGVKPGTVPVCHFMQPDAVVWT. 582
88 9.000e-64UniRef50_UPI000B7B0666 uncharacterized protein LOC110770402 n=1 Tax=Prunus avium TaxID=42229 RepID=UPI000B7B0666  ali  39  446.FFTFDDLYKGKIMPLNFPKQEHSR-FLPKEVADSIPFSMPQLPHLLQLFSIPQGSRDAKHMAYALEQCEMKPITGETKFCATSLESMIEFVTKIIGSSVSFNTTHPTTSTAITQSYTILEEPKEVLASKMVFCHPMAYPYAVFFCHNFEKTKFFKVSLEGENEDKVEAMAVCHMDTSDWDPNHSLFGLLGIKAGSSPVCHFFPENHLVWI. 659
89 1.000e-63UniRef50_A0A1D1ZCE8 Dehydration-responsive protein RD22 (Fragment) n=3 Tax=Anthurium amnicola TaxID=1678845 RepID=A0A1D1ZCE8_9ARAE  ali  50  118IFFLEKDLLPGSKLRLDFTRRAPTVAFLPRGEAEAIPFATQKIPTILNHFSVQPSSAIAKAMKETLGWCEMKDPAAESRYCATSLESMVDYATSALGTRSITAVSSEFAKLGAAKQEYLVLGSQKLHGSSCVACHQQPYPFAVFYCHVTRATKAYVVPLVGMDEARVDAVAVCHTHTSAWNPSHLAFRVLKVRPGTLPICHFLPQDGLVWA. 331
90 1.000e-63UniRef50_UPI000C226D25 BURP domain-containing protein BNM2A-like n=2 Tax=Cucurbita TaxID=3660 RepID=UPI000C226D25  ali  37  202VFFILSDLKVGKKMPLYFPYSRPSPKLLPREEAESIPFSTSQLEYLLTLFSFPRDSPQAKAVEYTLKQCELESINGETKFCATSLESMLDFAIKMLGSETQLKVLTSSRLSNSTQNYTILEEPRETVAVKMVACHSMPYPYAIFYCHCQENNRLFEILLGADNGDRVKASAICHMDTSQWDKDHASFKVLKTKPGASHVCHFVSTDSLVWLA 419
91 1.000e-63UniRef50_A0A0A0LL47 Uncharacterized protein n=7 Tax=Pentapetalae TaxID=1437201 RepID=A0A0A0LL47_CUCSA  ali  36  87VFFTLSDLKVGKKMPIYFPYSRPSPKLLPKEEADSIPFSSSQLEYLLTLFSFPKDSPQAKAVEYTLKQCELESIKGETKFCATSLKSMLDFATKMLGGDTQLKVLTTTRLSNSTQNYTILEEPRETVSAKMVACHSMPYPYAIFYCHCQENNRLFEILLGADNGDRVKASAICHMDTSQWDKDHASFKVLKTKPGASHVCHFVSTDSLVWLA 304
92 2.000e-63UniRef50_A0A2P5W6T2 Uncharacterized protein n=2 Tax=Gossypium TaxID=3633 RepID=A0A2P5W6T2_GOSBA  ali  50  178MYFFQEDLHPGKWVNLPLAKTRDLATFLPQQVARSIPFSSNEFPQILNLFSLDPESMEATDMEQTINVCEREGMRGEEIFCATSFESFVDSSVSKLGKNIQLLANELAKETNNPVF--TIGRGIQNMGEEELVCHKMSYPYAVFLCHSIDSTMVYKVPLVGMDGTKAKALVICHKDTSAWSPSHPVFEILKVKPGTVPICHFAVRDTLAWV. 387
93 2.000e-63UniRef50_G7J6J4 Dehydration-responsive RD22-like protein n=24 Tax=Pentapetalae TaxID=1437201 RepID=G7J6J4_MEDTR  ali  39  58VFFTLKDLKVGKIMQIYFPKRDPSPKLWPKEEAESLPFSSNQLSYLLKFFSFSRGSPQGIAMESTLKECESKPIKGEVKFCATSLESMLEFTQNILGSESDYATLHKTKSSVTFQNYTIVEIMMEIRAPKMVACHTVPYPYAVFYCHSQESNRVYKVLLGGENGDKVEAMVVCHLDTSQWAPSHVSFQVLGVTPGSSSVCHFFPADNYIWV. 274
94 3.000e-63UniRef50_A0A061DZ15 Uncharacterized protein n=14 Tax=Pentapetalae TaxID=1437201 RepID=A0A061DZ15_THECC  ali  35  70IFFKIDDLKVGKTMPVYLPSKDASPHLLSREAANSIPFSSKQLPQLLEFFSFSKDSRQAKAMDYTLRQCELEPTKGEIRFCATSLESMLDFSRSVFGSDAHLKVLTTKEPTVSLQNYTILDMPKQIPSSRIIACHTLPYPYAVFYCHSQKSTRLFQVSLGAENGDRAQASAVCHMDTSQWDHDHVSFRVLKIKPRSSPVCHFLPPDSLVWV. 286
95 4.000e-63UniRef50_K7KSH2 Uncharacterized protein n=8 Tax=50 kb inversion clade TaxID=2231393 RepID=K7KSH2_SOYBN  ali  38  129VFFTPNDLKVGKIMPVYFSKKNSSPKFLTREEADQIPFSCKHLPSLLKFFSIPQHSPQAKAMKYTLKQCEFEPMEGETKFCATSLESLFDFAHYLFGSNAQFKVLTTVHNSTALLQNYTISEVKVISVPNVIGCHPMPYPYAVFYCHSQHSTNLYEVMVEGENGGRVQAAAICHMDTSKWDRDHVSFRVLKVQPGTSPVCHFFPPDNLVWV. 344
96 5.000e-63UniRef50_A0A067JQ73 Uncharacterized protein n=1 Tax=Jatropha curcas TaxID=180498 RepID=A0A067JQ73_JATCU  ali  48  442.FFVYNDLHVGQKMRLHITKSTNKARILPRQVADSIPFSVDHLPAILQRFSVKPESPQAKFIKQTIKDCESSGIKGEDRYCATSLESLVDFTVKHVGDNAQILFNEIDEQ-RREQEYTITDV--KLIGENHVVCHKQKYPYAVYFCHALNGTKVYIAGLVGGDGIKAKGVVACHSDTSAWNPGHLAFLLLNMKPGDGTVCHFIKSDTIAVVS 649
97 6.000e-63UniRef50_A0A251MVU6 Uncharacterized protein n=7 Tax=Amygdaloideae TaxID=171637 RepID=A0A251MVU6_PRUPE  ali  40  327.FFTFDDLYKGKIMPLNFPKQEHSR-FLPKEVADSIPFAMQQLPHLLQLFSIPQGSLDAKHMAYALEECEMKPITGETKFCATSLESMIEFVTKIIGSGVSFNTTHPTTSTAITQSYTILEEPNEVLASKMVFCHPMAYPYAVFFCHNFEDTKFFKVSLEGANGDKVEAMAVCHMDTSDWDPNHSLFGLLGIKAGSSPVCHFLPENHLAWI. 540
98 7.000e-63UniRef50_A0A0B2QZ92 Putative polygalacturonase non-catalytic subunit n=3 Tax=rosids TaxID=71275 RepID=A0A0B2QZ92_GLYSO  ali  30  125.FFRETMLKEGTVMPMPIRDKMPKRSFLPRAILTKLPFSSAKVDELKRVFKVSENSSMDKMIMDSLGECEREPSVGETKRCVGSVEDMIDFSTSVLGRNVAVWTTENVKGSNKNVMVGRVKGMNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKAKINHGVAICHLDTTAWSPTHGAFLALGSGPGRIEVCHWIFENDLTWT. 337
99 7.000e-63UniRef50_A0A1U8A6W5 BURP domain-containing protein 16-like n=1 Tax=Nelumbo nucifera TaxID=4432 RepID=A0A1U8A6W5_NELNU  ali  52  251FFFLEENLHSGTKMNLDLSGITNGETLLSRQVADAIPFSSNKLPEILHRLSIEPKSKMAEATKETLELCEAPAKEEKDDLCVTSLESMIDFSTSKLGKNIEAVSTEVGVGKEETQHKYVVGPGLEKLVGSPVVCHALTYAYAVYYCHKVEATRAYMVPLVGGDDDAAKAVAVCHTDTSRWNPHHLAFQLLKVKPSTVPICHFLQEDTIAW.. 468
100 8.000e-63UniRef50_A0A2H3YFC2 BURP domain-containing protein 3-like n=6 Tax=Arecaceae TaxID=4710 RepID=A0A2H3YFC2_PHODC  ali  51  70LFFIEKDLRPGARMTLHFTRTTSAANFLPRKAADSIPFSSAKLPAVLARLSIDPNSEKAQAMKKTLQECEEQAIDGETKRCATSLESMVEFSTSSLGTQDVRALSTTVEKKSTPKQQYTIASVQKVAGPTLVACHAESYAYAVFLCHTT-DARAYTVSMVGKDGTKVEAVAACHADAAALSPK--AFEVLKVKPGTVPVCHFLPQNDLVW.. 276
101 8.000e-63UniRef50_A0A103XIQ7 BURP domain-containing protein n=2 Tax=Cynara cardunculus var. scolymus TaxID=59895 RepID=A0A103XIQ7_CYNCS  ali  47  28LFFVEKEMRPGKKIKLHLSKTTTPPAFVSRQVANLSPLRSTRLDNIFEAFSVHPGSVEAKLIKQTVVKCEKARDQRQDQYCATSLESMVDYATSKLGKRVKPISTRVNGKESTALQEYRVEGVKKLAADNVVVCHQEYYAYAVHYCHKSSKINAYEVSLVGDNNMRGDAISICHEDTASWNPKHVAFQVLSVKPGTVSVCHFLVEDEVAWVA 240
102 1.000e-62UniRef50_A0A2P5VRP4 Uncharacterized protein n=6 Tax=Malvaceae TaxID=3629 RepID=A0A2P5VRP4_GOSBA  ali  49  117MFFFQEDLHPGKRVNLPLAKTRDLTTFLPQQVARSIPFSYNEFPQILNLFSLDPESMEANDMEQTINVCEREGLRGEEIFCATSFESFVDSSVSKLGKNIQLLANELAKETNNPVF--TIGRGIQNMGEEELVCHKMSYPYAVFLCHSIDSTVVYKVPLVGMDGTKAKALVICHKDTSAWSPNHPVFEILKVKPGTVPICHFAVRDTLAWV. 326
103 1.000e-62UniRef50_K4B3G0 Uncharacterized protein n=9 Tax=lamiids TaxID=91888 RepID=K4B3G0_SOLLC  ali  40  43IFFTPKDLKIGKMMPLFFKDPSTSPHLLPRKEANSIPFSSSNLTYLLKFFTFSKDSPQAKAMEDTFFHCEISAMNGESKFCATSLESMLDFVQEILGFNTKLDVYTTEFLKKSPQNYTILQKPKEILVPKLVACHTLPYPYAVFYCHMQKGNKLFKISLLGENGDRIEAAAICHMDTKEWNHDHVAFRVLKVLPGSSPVCHFFPVDNLVWV. 259
104 2.000e-62UniRef50_A9NZG2 Uncharacterized protein n=5 Tax=Picea sitchensis TaxID=3332 RepID=A9NZG2_PICSI  ali  43  147MFFLEKDLHTGTKLTLYLNRSSPDSRFLPRPLAEAIPFSSHKLSVALEKLEISEGSDTALVMKQTLKVCENPTASGESRYCATSLESMIDYATSTLETSRLNVLETNVPCNVESQQYTITGLPFQSKGLKSVVCHRQKYAHAVYYCHETQHTTTARVSLKGEDGSSGEGVAVCHSDTSGWNPKHLAFKMLNVKPGGSPICHFMLDGNVLW.. 362
105 2.000e-62UniRef50_A0A218XX13 Uncharacterized protein n=1 Tax=Punica granatum TaxID=22663 RepID=A0A218XX13_PUNGR  ali  38  110IFFTLEDLKIGKTMPLYFPRMPDPPRLLPREEAESIPFSSSQLSRLLDYFSFPKRSPQAKAMAYTLQTCELHPIKGEVKYCAASLEAILNGVRQILGPDTKSQTLTTTYLSMHNQNYTIQEAPKQVAASRMVACHPMPYPYAVFYCHSQPWSKLFQITLGGPNGERVEAVAVCHMDTSQWNHDHASFRVLNIEPGSSPVCHFFPVDSIIWV. 330
106 2.000e-62UniRef50_UPI00077EC3DA BURP domain-containing protein 3-like isoform X3 n=1 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI00077EC3DA  ali  47  97.FFFESDLHEGSKMKLSFPKIKNSAKFLPSQVSESIPFSTTKLPEILAHFSMKSKSLQAKAMEDTLKVCEAPALNGEDKYCATSLESLVDFGVSKLGNQIKIISPTQVQREDPHV--YTIGRGTKMIGDKSVECHKLNYVYAVFYCHEVQGTRAYRVPLQQPREDGDVALAVCHSDTSAWNPKNEAFQQLKVKPGTVPICHFLSSDTLFLVN 309
107 2.000e-62UniRef50_UPI00094F4CA7 BURP domain-containing protein 6-like isoform X1 n=2 Tax=Elaeis guineensis var. tenera TaxID=51953 RepID=UPI00094F4CA7  ali  49  76.FFLENDLHAGAKFTLHFTGTGSRPYLLTRREADSIPFTTTKLPEILARFSIEPGSHDAKAIETTLEECEEPSGYGQTKKCATSLESMLDFTTSALRRDIDTVSTRVGKEDSSEQQYNVVGVRGVTDSSDWVVCHVQPYAYAVFYCHTKSKAKAYMVSMVGEDGTKVEALAVCHDYLDSSNPKILAFQGFKPKRGTGNVCHFLPQDNIA... 284
108 2.000e-62UniRef50_A0A199V278 BURP domain-containing protein 3 (Fragment) n=5 Tax=Mesangiospermae TaxID=1437183 RepID=A0A199V278_ANACO  ali  53  46LFFLEKDLRPGKKMTLHFPEVASGPAFLPRKEADAIPLSVEKLPEVLGRFGIQLDSVEARWMRKTARECQEPAVGGEKKFCATSLESMVDFSTLSFGTRDMRAVSTTVAKKS---------GIYKLAGDELVACHVETYAYAVFYCYLTGSTRAYMVKMVGKDGAAVDAAAVCHADTAAWNPKHLAFQVLKVKPGTVPICHFLPQDHVVWT. 247
109 3.000e-62UniRef50_A0A251VA03 Putative BURP domain-containing protein 2 n=2 Tax=Asteroideae TaxID=102804 RepID=A0A251VA03_HELAN  ali  47  93LFFLENDLHAGKRINLHISKTTATPPFVPRDVAESMPIASNKLQDIYKEFKVKPDSIEAKLVKETVNECEMASNKDADQYCAASLESMVDFVASKLGKRVKAMETRVVGNESRSLQGYMVEEVKKLNGDDGVVCHQEYYGYAVYFCHKTPKISAYMVSLVGENNVRAKATFLCHEDTSSWSPKHLAFIVLNVKPGTSAVCHFLLENVVAWV. 304
110 4.000e-62UniRef50_B9T8G6 Dehydration-responsive protein RD22, putative n=1 Tax=Ricinus communis TaxID=3988 RepID=B9T8G6_RICCO  ali  49  24.....SNLHVGQKMKIYIPKPTNKAKFMPRQVAESMPFSSEKLPVILERFSVKRESLQAKKIKETIENYESTGIKGEDKYCPTSLESLIDFIVS-----------HIDRQATSMQEYTTMGV--KMLGENQVVCHKQKYPYAVYYCHSINATKVYAVALGGADGTKAKALAVCHLDTSSWNPRYLAFLMLKIKPGEGTICHFIKSNTLVWSS 217
111 4.000e-62UniRef50_B9S9R1 Polygalacturonase non-catalytic subunit AroGP3, putative n=1 Tax=Ricinus communis TaxID=3988 RepID=B9S9R1_RICCO  ali  46  268..FLYNDLHEGKKMRLHITKSTNKARILARQVADSIPFSTDKFPSILEHLSIKPESPQSKIIKKTLTDCEFPGIKGEEKSCVTSLESLIDFTVAHIGDNVQVLYNEIEKPT-MEQEYTILGV--KTMGKNPVVCHKQNYPYAVYYCHEIKATNVYMAPLMGADGTKAKAIVVCHSDTLNWNPKNVMFVLLNVKPGEGTVCHIIGSDTLVWLS 474
112 4.000e-62UniRef50_A0A2G2VMH7 Uncharacterized protein n=4 Tax=Pentapetalae TaxID=1437201 RepID=A0A2G2VMH7_CAPBA  ali  29  237.FFREKMLKRGTIMSMPIQDKMPKRSFLPRVIASKLPFSTSKIDELKKIFHAGDDSQMGKMIGDALAECEKSPSAGETKRCVSSIEDMIDFSTSVLGQNVVVRTSENIKGSKRDIMIGSVKGINGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEAEILDPNAKINHGVAICHVDTSAWGANHGAFIALGSEPGKIEVCHWIFENDMTWA. 449
113 4.000e-62UniRef50_Q40161 Polygalacturonase-1 non-catalytic subunit beta n=297 Tax=Eukaryota TaxID=2759 RepID=GP1_SOLLC  ali  30  415.FFREKMLKSGTIMPMPIKDKMPKRSFLPRVIASKLPFSTSKIAELKKIFHAGDESQVEKMIGDALSECERAPSAGETKRCVNSAEDMIDFATSVLGRNVVVRTTEDTKGSNGNIMIGSVKGINGGKVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADILDPNSKINHGVAICHVDTSSWGPSHGAFVALGSGPGKIEVCHWIFENDMTWA. 627
114 5.000e-62UniRef50_UPI000D62F26F BURP domain-containing protein 5-like isoform X1 n=2 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI000D62F26F  ali  47  144.FFFESDLHEGSKMKLSFPKIKNSAKFLPSQVSESIPFSTTKLPEILAHFSMKSKSLQAKAMEDTLKVCEAPALNGEDKYCATSLESLVDFGVSKLGNQIKIISPTQVQREDPHV--YTIGRGTKMIGDKSVECHKLNYVYAVFYCHEVQGTRAYRVPLQQPREDGDVALAVCHSDTSAWNPKNEAFQQLKVKPGTVPICHFLSSDTLFLVN 356
115 7.000e-62UniRef50_A0A1U8A3V3 BURP domain-containing protein 6-like n=2 Tax=Nelumbo nucifera TaxID=4432 RepID=A0A1U8A3V3_NELNU  ali  51  114.YFLEENLHPGRKMTLETSELSGGAILLSRQVADSIPFSSNKLPDILHRFSVNDRSIEAEAMKETIMSCERPGDEIEAKRCATSLESMIDFSISKLGKNIKAVTTEFEYGENYNKKQFIISSGIKKMTGNPVVCHGMTYPYAVYYCHVIRSTRSYVVPLVAADGTKAKAIAVCHTDTKDFSPDHIAFKLLNIKPGGVPICHFLPDDTIA... 327
116 1.000e-61UniRef50_A0A2H3Y8M7 BURP domain-containing protein 5-like n=5 Tax=Arecaceae TaxID=4710 RepID=A0A2H3Y8M7_PHODC  ali  51  79LFFLEKDLHPGAGMNLSFTRTLSGAAFIPRAQADGIPFSSDKLLEILHRLNVLPNSELAKEVKTTLSDCEEAAIEGEHKYCATSLESMVDFVLSELETDDVRATATTVHGDMKQQYTVAPSGVRRTPGTKLVTCHPEPYPHIVYYCHLTTATKAFLVTLVGRDGTAVEAVAACHSDTSNWKP--VFFEVLGVKRGT-PICHFLPQDHLIWT. 292
117 1.000e-61UniRef50_A0A1U8NXV6 BURP domain-containing protein 5-like n=1 Tax=Gossypium hirsutum TaxID=3635 RepID=A0A1U8NXV6_GOSHI  ali  47  141IYFFEDTLLPGTKVFLQLLQESDTTKFLPRQIAESTPLTNGELSQILKKFSLKPESKGASYVKNTVKNCERPEMRGETKYCASSLETFVDSGVSILGKNIKLLSNEIGDETKNPSF--KIGKGVRTVGGNEVVCHKMTYPHAVYLCHSIEGTEVYKVPLVSDDGTKVKAMAVCHKDTSAWSPNHIAFKILKVKPGTVPICHFLGRDTLVWVS 351
118 1.000e-61UniRef50_A0A2I0WW95 BURP domain-containing protein 3 n=3 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2I0WW95_9ASPA  ali  45  275LFFLRQDLRRGKQFTLQLAEGGGAASFIPRSSAESVPFSTAELPAILSRFSIPVGSAQAAATEKTLSECEAAPVAGEKKLCATSLESMVDFATTSLGTREVVAVATEGGSSAGERRVYKIGSVRTVAGKGVVSCHPEAYAYAVFFCHATASSEVYEVEMAAEGGKSVKAVAVCHTDTAGWNPNHLAFRVLNVKPGTVPVCHFLPQDHLVWA. 490
119 1.000e-61UniRef50_A0A1U8MN03 BURP domain-containing protein 13-like n=2 Tax=Gossypium TaxID=3633 RepID=A0A1U8MN03_GOSHI  ali  45  238VFFFQKDLRTGKLVNLPLIAASDRTPFLPDRVAKSIPFSSSKFPEIFNHFSLKPQTREAEIMKRTIRVCEREAVNGEQMFCVRSLESFIDLSIATLGKEIQLLSNHLSKETNNPLF--TIARGMQDMGENELVCHKDRYPRAVFLCHSINKTTVYKVPLVGRDGTKANALAVCHKDTSAWSPKHKAFQILKVKPGTVPICHFLAKDTLAWVS 448
120 2.000e-61UniRef50_A0A1U7Z7B0 BURP domain protein RD22-like n=2 Tax=eudicotyledons TaxID=71240 RepID=A0A1U7Z7B0_NELNU  ali  52  40.YFLEESLYSGKEMTLEVSGDYTRATLLSRQVADSIPFSSNKLPDILDEFSIEPGSIQAEAIEETITACEREDNEEEAMHCTTSLESMIDWSISKLGKNITAVGTEVDGENRHKNHFTISRGVKQMGEGNQVVCHGMTYPYAVYYCHVIHGTRSYMVPMVAADGTKAKAVAVCHIDTKEFSPDHVAFKLLNVKPGSVPVCHFLPDDTIFW.. 252
121 2.000e-61UniRef50_I1LQ51 Uncharacterized protein n=8 Tax=NPAAA clade TaxID=2231382 RepID=I1LQ51_SOYBN  ali  36  320.FFALDDLYVGNVMTLQFPIQ-DVSQFLPRKEAESIPFSISQLPSVLQLFSISEDSPEANAMRDTLEQCEAEPITGETKICATSLESMLEFIGTIIGSETKHNILTTTLPTAPLQKFTILEVSEDINAAKWVACHPLPYPYAIYYCHFITGSKVFKVSLGSENGDKIEALGICHLDTSDWSPNHIIFRQLGIKPGKDAVCHFFPIKHLMWV. 533
122 2.000e-61UniRef50_A0A2S1VW26 Burp domain-containing protein 6-like (Fragment) n=7 Tax=commelinids TaxID=4734 RepID=A0A2S1VW26_ELAGV  ali  53  82.YFFEKDLHPSANMTMHFIRTITGATLLPRQAADSIPFSSAKLPEILSRLSITPNSIEAKAMKKTLQDCEEPAIEGETKYCATSVEAMVDFSTSSLGTRDVQALSTAVDREGTPKQVYSISKVQKQPFSKVVICHGENYAYAVFYCHMM-SSEAYKVSMVGKDGTKVEAVAVCHTDTAGFNPKHFAFKVLNVKPGTVPIC............ 279
123 3.000e-61UniRef50_UPI000C1D138F polygalacturonase-1 non-catalytic subunit beta-like n=5 Tax=Pentapetalae TaxID=1437201 RepID=UPI000C1D138F  ali  30  429.FFREEMLRGGNVMPMPIRDKMPKRSFLPRIILSKLPFSTSKLGELKKIFHADDDSSMAKMLADSLSECERAPSPGETKRCVASIEDMIDFATSVLGRNVVVRTTESTRGYNSNIIIGKVKGLNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDPNSKINHGVAICHLDTSSWSPDHGAFIALGSVPGKIEVCHWIFENDMTWT. 642
124 3.000e-61UniRef50_A0A067L7K3 Uncharacterized protein n=6 Tax=Pentapetalae TaxID=1437201 RepID=A0A067L7K3_JATCU  ali  37  62IFFTLDDLKIGKKMPIYFPDSSSTPPMLHKAEADSIPFSYKDFPYLLKLFSISPNSPQAIAMENTLKECELKPIKGETKICATSLESMVDFVRETFGLETKFKTTHLIKSKTHLDNYTIMQEPKEIPVPKMVACHTMPYAYTVFYCHSQQTNKVFVLSLKGENGGRVEAVAVCHMDTSQWSHNHASFRVLGIKPGTIPVCHFFKGDNLVYV. 278
125 4.000e-61UniRef50_A0A1J7HNC9 Uncharacterized protein n=5 Tax=rosids TaxID=71275 RepID=A0A1J7HNC9_LUPAN  ali  29  420.FFREKMLKQGIVMPMPIRDKSPKRSFLPRPILSKIPFTSSKISELKEIFKVSDNSSMEKMMIDSLGDCERAPSMGETKKCVGSVEDMIDFATSVLGHNVAARTTENVNGSKTNVMVGKVKGINGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEAELLDPKTKINHGVAICHLDTKAWSPSHGAFLALGSGPGRIEVCHWIFENDLTWT. 632
126 5.000e-61UniRef50_G7J6I5 Dehydration-responsive RD22-like protein n=2 Tax=Trifolieae TaxID=163742 RepID=G7J6I5_MEDTR  ali  35  474.FFTMDDLYVGNVMTLQFPVREY-ANFLPKKVADYIPFSKSQLPSLLQLFSLTKDSPQGEDMKDIIDQCEFEPTKGETKACPTSLESMLEFVHSVLGTEARYNIHTTSYPTTRLQNYTILKISKDIYAPKWVACHPRPYPYALYYCHYLDGSKVFKVLLKGQYGDIMDALGICHLDTSDMNPNHFIFQLLGIKPGEAPMCHFFPVKHVLWA. 686
127 5.000e-61UniRef50_A5AVU0 Uncharacterized protein n=9 Tax=eudicotyledons TaxID=71240 RepID=A5AVU0_VITVI  ali  27  20.FFRESMLKKGTVMPMPIRDKMPKRSFLPRTISSKLPFSTSKLEEMKKIFHAADNSSMEHMFTEALDDCERAPSKGETKRCVPSIEDMIDFATTVLGRNVVVRTTQSVEGSKQNVMIGSVKGINGGQVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKVNHGVAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWIFENDMTWT. 232
128 7.000e-61UniRef50_A0A068VC95 Uncharacterized protein n=1 Tax=Coffea canephora TaxID=49390 RepID=A0A068VC95_COFCA  ali  58  146LFFLKKDLHRGTSMNLQFVKSSNPATFLPRKVADSIPFSSKYIPEIFDKFSVKPESVEAETIKNTIKECEEPGIKGEDKYCATSLESMVDFSTSKLGNNVQAVSTEAEEDTK-AQKYGIVDV-KKLNNNKAVVCHKQNYAYAVFYCHSTQATEAYEVTLVGTDGKKAKAVAV--------------------KPGTVPICHFLPEDHVVWV. 334
129 8.000e-61UniRef50_A0A2C9VRD8 Uncharacterized protein n=2 Tax=Manihot esculenta TaxID=3983 RepID=A0A2C9VRD8_MANES  ali  49  409...........KKMRLHITKSANKARILPRQVADSLPFSTNKLAEIMKRFSVNPESRQGKMLKQTVEDCESPGIKGEDRFCPTSLESLVDFSVKHVGNIAQVLMNEIDKP-KREQEYTI--KEVKFIGENHVVCHKQKYPYAVYYCHALNGTKVYTAQVVGADGTKAKAVAVCHTNTSAWNPGHLAFLVLNMKPGEGTVCHFIRSDTFVMVS 606
130 8.000e-61UniRef50_A0A2I0JR72 Uncharacterized protein n=2 Tax=Punica granatum TaxID=22663 RepID=A0A2I0JR72_PUNGR  ali  39  204VFFTLEDLKIGKTMPLYFPRKPDPHQLLSREESESIPFSSSELPHLLDYFSFSECSPQAKAMEYTIEQCELQPIKGEVKYCATSLEAMFDYAQQILGPRTKSRVLTTTYLSMKKQNYTILKAPKQVAAPRMVGCHPMPYPYVVFYCHSTSENKLFQVSLGGPDRQRVEAVAVCHMDTSQWDPNQVSFRALNIEPGSSPVCHFFPVDSLIW.. 423
131 8.000e-61UniRef50_G7J6I1 BURP domain protein n=2 Tax=Medicago truncatula TaxID=3880 RepID=G7J6I1_MEDTR  ali  35  292.FFTLDDLYVGNVMTLQFPIREY-ARFLPRKVADYIPLSKSQLPSLLQLFSLTKDSPQGEDMKDIIDQCEFEPTKGETKACPTSLESMLEFVHSVLGAEARYNIHTTSYPTTRLQNYTILEISKDIYAPKWVACHPRPYPYALYYCHYLDGSRIFKVLLRGQYGDMMDALGICHLDTSDMNPNHFIFQLLGMKPGEAPLCHFFPVKHIVWA. 504
132 8.000e-61UniRef50_A0A2U1N881 BURP domain-containing protein n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1N881_ARTAN  ali  49  72LLFLEKDMIQGHEMNLQFAKTTPSSNFFPRKVAEMIPFSLKNLPQLYTRFSIKPETVESESMKTTISRCEEAGEKGEKKFCATSLEAMVDFIISKLGKKVMTISTDVKSNKVTPLQKYTFEGSKKVATDKYIVCHKQKYPYPVYYCHRAASTRVYSVSLVGEDGTKGRAVAICHKNASKLYPKDLVFKVLKVKPGTINICHFLPEDHVVWV. 285
133 9.000e-61UniRef50_S8DX19 Uncharacterized protein n=2 Tax=Genlisea aurea TaxID=192259 RepID=S8DX19_9LAMI  ali  43  93LIFFQQDLRIGKSMNLNFRKPSDLAPFLPRHLADSIPFSSKNFSQILQKFSLVPDSPKARVLKTTLHDCEVKAVRGEEIFCPTSLESMIDFTFSRLGKPAIPLST--NPNAARTRQYRITRVKKSSDAKGLVACHGLPYAYAVFLCHRVTNAAAYEVELTADDGSKSDAVAVCHMDTSEWGSNHVAFRVLGVKPGEVPVCHFLEEGNVIWV. 303
134 1.000e-60UniRef50_UPI000787DA16 BURP domain protein RD22 n=4 Tax=Arachis TaxID=3817 RepID=UPI000787DA16  ali  50  125.FFFEHDLLPGKKLILGRIKTSDVFTFLPDTIAKAIPFSSSRLPEILNRFNIEAESTEAESMKKTLALCESPTMHGEEKYCATSLESLLDFAVSQLGKNIRLLSTEFERETQDRQ--YTVAEGVKKNGEKAVVCHKMNYPYAVFYCHKT-DTRSYSVPLMATDGTKVKAIVVCHTDTAHWPSNHVAFKMLNTKRGTTPICHFLPTDNVIWV. 332
135 2.000e-60UniRef50_P92990 Polygalacturonase 1 beta-like protein 3 n=55 Tax=Mesangiospermae TaxID=1437183 RepID=PGL3_ARATH  ali  29  411.FFRESSLKEGTVIPMPIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGIITDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTENVAGSKEKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKNHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVCHWIFENDMNWA. 623
136 3.000e-60UniRef50_A0A1R3HYR8 Uncharacterized protein n=4 Tax=Pentapetalae TaxID=1437201 RepID=A0A1R3HYR8_COCAP  ali  34  52IYFKINDLNIGKTIPVYLPSKNASPHLLSREEANSIPFSSKNLPQLLDFFSFSKDSTQAKAMEYTLKQCELEPIKGETRFCATSLESMLDFARSVFGLDSGLKVLTTTFLKKPTQNYTVLDMPKQISASRMVACHTLPYPYAVFYCHSQKSNRLFQVSLGTENGDRVEASAVCHMYTSQWDIDHVSFRVLKIKPRSSPVCHFFPPDNLVWV. 270
137 3.000e-60UniRef50_A0A2P5W456 Uncharacterized protein n=4 Tax=Malvaceae TaxID=3629 RepID=A0A2P5W456_GOSBA  ali  42  9IYFFPRDLRTGNLI-----AASDRTPFLPDRVAKSIPFSSSKFPEILNHFSLKPQTREAEIMKRTIGVCEREAINGEQMFCVRSLESFIDLSIATLGKEIQLLSNQLSKETNNPLF--TIARGMQDMGENELICHKERYPRAVFFCHSINKTTLYKVPLLGRDGTKANALAVCHKDTSAWSPKHIAFQILEVKPGTVPICHFLAKDTLAWVS 213
138 4.000e-60UniRef50_A0A2P6PP12 Putative BURP domain-containing protein n=4 Tax=Rosaceae TaxID=3745 RepID=A0A2P6PP12_ROSCH  ali  35  242.FFTLVDFHKGSTMPLNFPNQ-DHSPFLPKKTADSLPFSTSQLPHLLQLFSIPRDSRDSKHMAYTLDQCEQKPIKGETKFCATSLESMNDFVHKIIGSGIKFNILHPSTSTSITQKYTILEEPKQVIASKMVFCHPVPYPYAVFFCHHFESTRFFQVSLGGENGDKVEAVAVCHMDTSDWDSKLSLFRNLGIKSASSPVCHFFPENHLVWI. 455
139 4.000e-60UniRef50_A0A0D3CXG4 Uncharacterized protein n=16 Tax=eudicotyledons TaxID=71240 RepID=A0A0D3CXG4_BRAOL  ali  29  436.FFRESTLKEGTVIAMPIKDKMPKRSFLPRSIVSKLPFSTSKLAEVKTIFHVGDNSSMEKIISDAVTECERPPSVGETKRCVGSAEDMIDFATSVLGRSVVLRTTESVAGSKQKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNTKINHGIAICHIDTSSWSPTHGAFLALGSKPGRIEVCHWIFENDMNWA. 648
140 5.000e-60UniRef50_UPI0008FFC3A8 BURP domain protein RD22-like n=1 Tax=Vitis vinifera TaxID=29760 RepID=UPI0008FFC3A8  ali  55  1.............MKLNLATTTNGAVFLPHQVAESMPFSSNKLPEILNRFSLKENSAEAEIIKKELEECEEPAMEGEARYCATSLQSLIHFSTSKLGRNVNVLTNEVKTGSQE----YEFGVGMKKVADKSVVCHKMNYPYAVFYCHTFTKTRTYMIPLVGVDGSKSKAMAACHSDTSAWHPQHVAFQVLKIKPGTVPVCHFLHNNAMVWI. 194
141 6.000e-60UniRef50_A0A2K3PGK6 Polygalacturonase non-catalytic protein n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A2K3PGK6_TRIPR  ali  29  146.FFRERMLKQGMVMHMPIRDKLPERSFLPRSILTKLPFASSKLDDMKQVFKVSKNSSMEKMIVNSLRECERVPSKGEVKRCVGSLEDMIDFATSILGRNVTVRSTQNVNGSNKNVMLSQVRGINHGKVIESVSCHQTMFPYLLYYCHSVPKVRVYEADLLDPQSKINRAVAICHLDTTSWSPTHGAFVALGSGPGRIEVCHWIFENDMIWT. 358
142 6.000e-60UniRef50_Q8RUD9 Seed coat BURP domain protein 1 n=3 Tax=Soja TaxID=1462606 RepID=Q8RUD9_SOYBN  ali  44  92LFFLEEDLRAGKIFNMKFVNNTKATPLLPRQISKQIPFSEDKKKQVLAMLGVEANSSNAKIIAETIGLCQEPATEGERKHCATSLESMVDFVVSALGKNVGAFSTEKERETESGKFVVVKNGVRKLGDDKVIACHPMSYPYVVFGCHLVPRSSGYLVRLKGEDGVRVKAVVACHRDTSKWDHNHGAFKVLNLKPGNGTVCHVFTEGNLLW.. 302
143 6.000e-60UniRef50_A0A072U2I6 Polygalacturonase non-catalytic protein n=2 Tax=Medicago truncatula TaxID=3880 RepID=A0A072U2I6_MEDTR  ali  28  159.FFRERMLKEGTVMPMPTRDKLPPRSFLPRSILIKLPFASSKLNNMKQVFKVSENSFMEKMIVDSLSECERAPSKGEIKRCVGSLEDMIDFATSILGSNVTVRSTENVNGSNNNVMVGQVKEINGGNVMESVSCHQSLFPYLLYYCHSVPNIRIYEANLLDPKSKINHGVAICHLDTTAWSPTHGAFMTLGFGPGQIEVCHWIFENDMTWTT 372
144 1.000e-59UniRef50_UPI000A2B2B03 BURP domain-containing protein 13-like isoform X1 n=2 Tax=Arachis ipaensis TaxID=130454 RepID=UPI000A2B2B03  ali  34  361.FFAMDDLYIGNIMTLQFP-VEDFSHFLSKKEADSIPFSIPQLPSVLQLFSISQDSSQAKSMRGTIEQCEAGTITGETKICANSLESMLEFVHNIIGSEEKHNIHTTSPSSGAPQKYTILKISEDIYAPKWVACHPLPYPYGVYYCHFISGTRVFKVLLDGENGDKVEALGVCHLDTSDWSPNHILFKQLGFMPGEAPVCHFFPVKHLMWV. 571
145 1.000e-59UniRef50_U5D5M8 Uncharacterized protein n=2 Tax=Amborella trichopoda TaxID=13333 RepID=U5D5M8_AMBTC  ali  40  128VFFHMKDLKVGNKLDLYNMKTLAATSPLPRQEADSIPFASASLPDILHRFSIPPDSPLAKKVARNLHICESPPLMGERKFCATSLESLHDFVLSILGPKAKPQVHNEENRPPLVQSYIVKEIMLRLTPPYLPVCHPMTYPYTVFYCHVVVKTTALMVKLEDEDGSKMDAAAACHLDTSDWDPDHVSFKVLGIKPGTEPVCHFFPETHLAFIT 346
146 4.000e-59UniRef50_UPI0009E23BD6 polygalacturonase 1 beta-like protein 3 isoform X1 n=2 Tax=Phalaenopsis equestris TaxID=78828 RepID=UPI0009E23BD6  ali  31  718.FFRERNLKKGTVMPMPIRDRMPPRSFLPRSIAGKIPFSAAAVDGIFQIFHILPDTAMGKAVDSTIADCERAPSRGETKRCAASAEDMIDFAVAVLGDDIEVRSTANTKGSKGNILIGMVRGVNGGKVTKSVSCHQSLFPYMVYYCHSVPRVRVYVAEILAVDEKINQGVAICHIDTSDWSPTHGAFVALGPGPGKIEVCHWIFEGDMTWT. 947
147 4.000e-59UniRef50_A0A2P4KSK9 Burp domain protein rd22 n=2 Tax=Quercus suber TaxID=58331 RepID=A0A2P4KSK9_QUESU  ali  53  153.FFIETDLRPGKKMKLHFS-TANGATFLPHQVAKSVPFSSDKLLEILNLFSVIDKSEEAKVIKSTIVTCETKCVDREGGLCATSLESLVDFSVSKLGKNVQVLSTQVPKETEKQE--YRITGVHRINANKGVVCHKQNYVYAVFYCHEIHDAGTYMVPLVSSDGTKVNAIAACQADAFVGN----AFNVLKVKPGTVPICHFLDGDSLLWV. 355
148 5.000e-59UniRef50_UPI000870ACDB BURP domain protein RD22-like n=6 Tax=Maleae TaxID=721813 RepID=UPI000870ACDB  ali  49  106....EKDLHRGKTVKYGFPRTSKSSRFVSRLTAESIPFSSNKMEEILKRFSLRPESSEANTIKETIDYCEMPAMKGEERYCATSLESLVDFATSELGSNIRTMSTEVERGANNDQTYTITDGVKVLAEDKVVTCHKMSYPFAVFLCHAIEKTRAYMVPMEGADGTKANAVIICHRDTSKFAPNNWGLSQLHLKPGEGPLCHLLSDGHLTW.. 315
149 5.000e-59UniRef50_A0A2I0VHW5 BURP domain-containing protein 12 n=8 Tax=Petrosaviidae TaxID=1437197 RepID=A0A2I0VHW5_9ASPA  ali  30  410.FFRESSLKKGTVMPMPIRDRMPPRSFLPRSIAGKIPFAAA---DVVRIFKIPLGTAMANAVYTTVGDCERWPSRGESKRCTASAEDMIDFAVSVLGSDVAVKSTKNTEGSNENILIGEVKGLNGGKVTSSVSCHQSLFPYLVYYCHSVPLVRVYEAEIMAVDSKKNEGIAICHIDTSDWSPKHGAFVALGPGPGKIEVCHWIFEGDMTWT. 619
150 6.000e-59UniRef50_A0A151TGQ6 Putative polygalacturonase non-catalytic subunit JP650 family n=2 Tax=Pentapetalae TaxID=1437201 RepID=A0A151TGQ6_CAJCA  ali  28  379.FFRQKMMKEGTVMPMPIRDKMPERSFLPRTILSKLPFSVSKIDELKRVFRASDNGSMERLMRESLEECERAPSRGETKRCVGSLEDMIDFATSVLGRNVAVRSTQNVNGSKKNVMVGHVSSINGGRVTQSVSCHQSLFPYLLYYCHAVPKVRVYQADLLDPKTKINHGVAICHLDTSDWSPTHGAFLSLGSGPGRIEVCHWIFQNDMVWT. 591
151 6.000e-59UniRef50_I1JX51 Uncharacterized protein n=4 Tax=Phaseoleae TaxID=163735 RepID=I1JX51_SOYBN  ali  46  344..FFEEGLRPGTKLDAHFKKRENVTPLLPRQIAQHIPLSSAKIKEIVEMLFVNPEPENVKILEETISMCEVPAITGEERYCATSLESMVDFVTSKLGKNARVISTEAEKESKS-QKFSVKDGVKLLAEDKVIVCHPMDYPYVVFMCHEISNTTAHFMPLEGEDGTRVKAAAVCHKDTSEWDPNHVFLQMLKTKPGAAPVCHIFPEGHLLWFA 552
152 7.000e-59UniRef50_UPI0009054DA0 BURP domain-containing protein 9-like isoform X1 n=3 Tax=Nicotiana attenuata TaxID=49451 RepID=UPI0009054DA0  ali  44  559.YFFEKNLEKGKIINFPSLKNKNKAPFLSRQFVESIPFSLEKVLEILNYFSIDSISKDAQTIEETIRHCEEPAMKGEKKICATSLESMVDISLTMLGTNNVHAVTTEVEGETQMLQKYTIKKVQKIADGDNLICHKLSYTYAVYNCHVGGRTKIFMVSMVGADGTKVKAVLVCHKDTSFWNPKGLPFVLLKVKPGTTPVCHFLQDDQIAF.. 767
153 1.000e-58UniRef50_A0A0J8CWN6 Uncharacterized protein n=3 Tax=Chenopodiaceae TaxID=1804623 RepID=A0A0J8CWN6_BETVU  ali  44  237VFFVEKSLNLGTKMTLHFQKSVKKGFFLPREVSNKIPFSSKKVQETLQILSLDPKSNEAYVLSKRIELCEEPTVEGVEKKCVTSLESMVDYVISKIGTNVKALTTEVDKDHSMMEYTIKGMKNLVKNDHETVVCHKMGYPYAVFFCHRTKTIRSYMVSLVGKDGTKIEAIAACHKETNEFLDNY-AKNVLKVVPGSTRICHFAAKDTIIWV. 447
154 2.000e-58UniRef50_A0A1U8GVW8 BURP domain-containing protein 5-like n=9 Tax=Solanoideae TaxID=424551 RepID=A0A1U8GVW8_CAPAN  ali  46  106.FFFETDLHQGKKVNLKSLKNNNPAPLLPRKVVDSISFSSNRIEEILDHFSVDNNSEDAKVIKRTVELCEQPAADGEIKYCATSLESIIDFASSRLETNNILAIHTEVEKETPVLQTYTIKEVKEKANGKCVICHKVPYPYAVHFCHDVGSTRAFRVTMVGADGTKVNAVSVCHEDTASMNPKALVFQLLNIKPGDKPICHFIMDDQIA... 313
155 2.000e-58UniRef50_A0A2N9H0T9 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9H0T9_FAGSY  ali  27  295.FFRESMLKGGNVMVMPIKDRMPKRSFLPQAILSKLPFSTLRLSELKGIFHVRENSSMERMLVNALAECERAPSLGESKQCVGSVEDMIDFAVSVLGHNVVVRSTKNVNGSKQNVMIGSVKEINGGEVTNLVSCHQIMYPYLLYYCHSLPKVRVYQADIVESKAKINHGVAICHLNTADWSPKHVAFLALGFSPGQIEVCHWFYENEMAWTT 508
156 2.000e-58UniRef50_J3LW38 Uncharacterized protein n=1 Tax=Oryza brachyantha TaxID=4533 RepID=J3LW38_ORYBR  ali  45  42LFFLEKNLQQGKKISLHFTNTMASSTFLPRSEAKSIPFSSNDMPVILARLGVGRGSGDAAVMSRTLHYCELP-----------SLESMVDFVTSTSGFETRDVNAESTVRSPPAQEYTVAGVKPMGGTGQLIACHPRTYVYAVFLCHRTEATRAYTASLVSEDGTAARAVAVCHTDTAGWNPEHAAFQILGVKPGTVPVCHFVKPDAVVWT. 248
157 2.000e-58UniRef50_A0A2C9VRF4 Uncharacterized protein n=9 Tax=Crotonoideae TaxID=235631 RepID=A0A2C9VRF4_MANES  ali  49  432VFFLPNDLHAGKNMRLHITKSANKARILPRQVANSLPFSTNKLAEIMKHFSVNSESRQ-----------------GEDRFCPTSLESLVDFSVKYVGNKAQVLMNEIDKP-KREQEYTI--KEVKFIGENHVVCHKQKYPYAVYYCHALNGTKVYTAQVVGADGTKAKAVAVCHTNTSAWNPGHLAFLVLNMKPGEGTVCHFIRSDTFVMVS 623
158 2.000e-58UniRef50_A0A067LG35 Uncharacterized protein n=2 Tax=Jatropha curcas TaxID=180498 RepID=A0A067LG35_JATCU  ali  38  55VFYRLKDFKKGNKLPLYLPPFDPLSYPLRKEVADSIPFSSKYLPSILRYFSYSPDSIQGRAVKHTIKICESPPFEGETQFCATSYQSMVDSVRRIFGSDAKAITSHLTSSKTHVQNYTILEEPEQILAPKFLGCHILNYPYALYHCHGQSSNKVFRVSLAGNDGDRIEGIAACHFDTSLWYPNHLAFKETGTKPGQSEICHFFPSDHLVWV. 269
159 2.000e-58UniRef50_U5D5P2 Uncharacterized protein n=5 Tax=Amborella trichopoda TaxID=13333 RepID=U5D5P2_AMBTC  ali  41  189VFFHMKDLKVGNKLDLYNMKTLAATSPLPRQEADSIPFASASLPDILHRFSIPPDSPLAKKVARNLHICESPPLMGERKFCATSLESLHDFVLSILGPKAKPQVLATTLHNGENQSYIVKEIMLRLTPPYLPVCHPMTYPYTVFHCHVVVKTTALMVKLEGEDGSKMDAAAACHLDTSDWDPDHVSFKVLGIKPGTEPVCHVFPETHLAFIS 407
160 3.000e-58UniRef50_Q70KG3 Protein RAFTIN 1B n=14 Tax=Poaceae TaxID=4479 RepID=RAF1B_WHEAT  ali  37  141VFFHEEAVRVGRRLPFHFPPATPAAGFLPRQVADSVPFTTAALPGILATFGIASDSTTVPSMEATLRACESPTIAGESKFCATSLEALVERAMGVLGTRDIRPVTSTLPRAGAPQTYTVVAVQPVEGGPVFVACHDEAYPYTVYRCHTTGPSRAYTVDMEGARGDAVTIAAVCHTDTSLWNPEHVSFKLLGTKPGGTPVCHLMPYGHIIWA. 354
161 3.000e-58UniRef50_B8LLB0 Uncharacterized protein n=1 Tax=Picea sitchensis TaxID=3332 RepID=B8LLB0_PICSI  ali  31  440.FFRENLLVQGSSLPLPLRDFMPRRSFLPRSLADKLPFSSQSLAELVRMFRIPENSSMEGMMAKTLKECERPAVKGEIKKCVTSVEGMAEFAVGILGKKVEVLTTASTAGSGERVQVGEVNGKDGGRVTRSVSCHQSMFPYLVYYCHSVPKVKVYEAALLRNSEKINDGVAICHLDTTQWSAGHAAFVALGHKPGQIEVCHWIFENDLIWV. 663
162 5.000e-58UniRef50_UPI00098AB1F4 BURP domain-containing protein 14-like n=2 Tax=Aegilops tauschii subsp. tauschii TaxID=169297 RepID=UPI00098AB1F4  ali  32  170.FFRERDLITGNRMPMPITDKMPPRAFLPRDIAAKILF---EAGAVSALFGAPSGNAMRQVVASTVDECARPPSRGETKRCATSAEDMLDFAVEMLWDNVAVRSTESAAGSSWDIRIGRVAGVAGGHATRSVSCHQSMFPYLVYYCHSVPSMRVYEAEILATDSKINRGVAICHLDTSDWSPGHGAFAALGGKPGEMEVCHWILQGDMVWT. 379
163 5.000e-58UniRef50_A0A0K9PXS0 BURP domain-containing protein n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9PXS0_ZOSMR  ali  45  130.FFLEMDLIDPRKMDLHLDRVAPMSGFIPRSIANSIPISSQKFPDILKHFSVQPNSVAANMMRESIEDCETPSMENEKRYCATSLESMIDFAISSLETNDLKAISTLTKNSGSLRQRYSIISSEVLENIDSVVCHASSYPYALFLCHMIDNTKVYTVSLVGGDGIKIEATAICHEDTANWSPEHIAFKILNVKPGDDPICHFLPEDTIVWT. 344
164 6.000e-58UniRef50_A0A2I0WMJ0 BURP domain-containing protein 12 n=1 Tax=Dendrobium catenatum TaxID=906689 RepID=A0A2I0WMJ0_9ASPA  ali  31  410.FFRESSLKKGTVMPMPIHDRMQPRSFLPRSIAGKIPLSVTAVTEIFK---IPPGTAMAKAVASTVADCERLPSRGETKRCATSAEDMIDFAVSTLGSNVEVRSSTNTKGSKGNILIGEVKGVNGGNITESVSCHQSLFPYLVYYCHSVPRVRVYEAEILAVDSKINHGIAICHIDTSDWSPNHGAFVALGPGPGKIEVCHWIYEGDMTWT. 619
165 6.000e-58UniRef50_A0A251RZZ2 Putative polygalacturonase 1 n=10 Tax=Pentapetalae TaxID=1437201 RepID=A0A251RZZ2_HELAN  ali  30  418.FFRERMLKKGTVMMMPIVDKNPKRSFLPRAITSKLPFSSDKLFDVKEVFGAQDHSVLESVLTNTLSECERAPSPGETKRCVGSIEDMIDFAVSVLGHDVVARTTENVRGSKKEVMIGEVKGVNGGKLTKSVSCHQSLYPYLLYYCHSVPKVRVYMAEIVSSKTKMNNGVAICHIDTSSWSPGHGAFVALGSGPGHIEVCHWIFENDMTWT. 630
166 1.000e-57UniRef50_A0A2I0XAN3 BURP domain-containing protein 12 n=8 Tax=Petrosaviidae TaxID=1437197 RepID=A0A2I0XAN3_9ASPA  ali  29  459.FFRERSLKKGTVMPMPIRDRMPPRSFLPRSISGKIPFSAASVDGIF---RILPDTAMGKAVDSTLADCKRAPSHGETKRCAASAEDMIDFAVSVLGNDIEVRSTANTKGSKGNILVGDVRGVNGGKVTESVSCHQSLFPYLVYYCHSVPRVRVYVADILAVDEKINQGVAICHLDTSDWSPTHGAFVALGPGPGKIEVCHWIFEGDMTWT. 668
167 1.000e-57UniRef50_A0A0E0KZV1 Uncharacterized protein n=6 Tax=commelinids TaxID=4734 RepID=A0A0E0KZV1_ORYPU  ali  44  64VFFLEKDLFPGSKMTLHFTSATAGAALLPRARAESIPFASSKLPEILTQLSIPAGSPTADAMQSTLAECEAARIAGHKHYCATSLESMVEFVASSLGTRDVHALSTERDEPTPRQAYRVEAVPVPVSGGDIVACHGMAYAYAVFGLHGLKAT-AYTVAMAGADGSMVEALAACHADVAAHGVPAETYKRLGVAPGSVPVCHFLPQDDMLWV. 279
168 1.000e-57UniRef50_A0A2P5W6U8 Uncharacterized protein n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5W6U8_GOSBA  ali  54  92VFFFESKLRPGTKMNLKLTSKASKTAFLPRPVADSLPFSTKKFAQVLNYFSVQPKSAESKILKKTIEDCETPTIEGEEKFCATSLESFVDF------------------------------GGVKLMGKTEIVCHKMDYAYAVFFCHSIAKTNVYRVPLVGADGTRATILAICHEDTSAWSPGHLAFQTLKVKPGTVPICHVLSIDALVWI. 273
169 1.000e-57UniRef50_A0A2C9U7N1 Uncharacterized protein n=3 Tax=Pentapetalae TaxID=1437201 RepID=A0A2C9U7N1_MANES  ali  36  68VFFTVDDLKAGKKFPIYFPDHSASPHLLSREEANSIPFSSSQLPHLLELFSVPKHSPQAKAMEYTLRLCDFEPTKEETKICATSLESVLDFVRAVFGLDTQFKVLTTNHLTNPVQNYTVLEEPKVIVADKIVGCHVMPYPYAVYYCHKAEGDRLFEMLLGGEDGERVEAPGICHMDTSHWDRDHVSFRVLKMEPGTSPVCHFFPASNLVWV. 284
170 2.000e-57UniRef50_S8CN73 Uncharacterized protein (Fragment) n=1 Tax=Genlisea aurea TaxID=192259 RepID=S8CN73_9LAMI  ali  35  5VYFHYGDLKLGAEIPIYFSRKDPSRRFLSREESDAIPFSAGKISEILEFFGIPADSPRAAAVNATLRHCEAGALPGETKFCVSTLESLLDSVVRTFGGSSSGRLLRTSERIPLLQNYTVIRPPTAIATEMVVGCHVMPYPYAVLYCHAQGDTAAYKVNLVGSDGGHVDAAAVCHMDTSRWDPLHVAFRVLKMSPGESPACHFFPGHDLVWV. 225
171 2.000e-57UniRef50_UPI000B933B8C BURP domain-containing protein BNM2C-like n=1 Tax=Momordica charantia TaxID=3673 RepID=UPI000B933B8C  ali  36  211IFFTMEDLKLGKKLPFYFPTKDSFPHYFPKEIADSIPFSLKQLPQILSLFSLPSGSPQAQAVEDTLWLCEQHPMKGEIKLCRTSSKSMLDSARSILGPMKNLTTSHLSNPHTIFQNYTLSQMPKEIAVPKFFACHSLPYPYAVYLCHSPGGAKVMQLPLEGDNGDRVEAIAVCHMDTSDWRSNHPSFRVLKTKPGT-PVCHVFAETDFLWMS 427
172 3.000e-57UniRef50_A0A0A0LIY2 Uncharacterized protein n=7 Tax=fabids TaxID=91835 RepID=A0A0A0LIY2_CUCSA  ali  36  52VFFTPDDLKLGKTMPIFFPIKNFSPKQLPKEMAEKIPFSLANLSYLLQFFSISKDSPQAKAMKYTLTQCELEPMEGETKFCATSLESLYFSTHDFFGFDGSMKAVATVYPKNFKQKYTILEEPIKILAQRILSCHMMPYPYLVLYCHSQVSDNIYKVIVEGENGDRVESLAICHVDTSEWDSDHVVFRVLNVEPGESSVCHFYPEDNIVFVS 269
173 3.000e-57UniRef50_A0A059D917 Uncharacterized protein n=6 Tax=rosids TaxID=71275 RepID=A0A059D917_EUCGR  ali  29  1......MLKSGNVMPMPIRDNLPRRSFLPRGISSEMPFSTSKLAELKQIFHATENSAMEKIMAQILGQCEVAALQDETKRCVASIEDMIDLATSVLGHDVMVRSTESAGGSKQEVLIGVVKRIDGSEVSKPVACHQILFPYAVYYCHAFPNVRIYEADILDPKSKINHGVAICHMDTSAWGPTYEAFLLLGSGPGQIEVCHWIYENNMIWT. 208
174 3.000e-57UniRef50_A0A1S3U1B9 dehydration-responsive protein RD22-like n=4 Tax=Phaseoleae TaxID=163735 RepID=A0A1S3U1B9_VIGRR  ali  43  160..FFQEQLRPHTELDIIFKKRKSERPLLPRQIAQRIPFASAKIKEIFQMLSMKPEVENVKIVTETISLCEAPSIRGVEKNCATSLESMVDFITSKLGNNAQVISTEAEKISKSE-KFLVKDGVKILAEENIIVCHPMNYPYVVFYCHKISNTTARFMPLEGEDGSRVKAVAVCHKDTSEWDPNHGFLQALKVQPGTVPVCHILPEGDLLWFA 368
175 5.000e-57UniRef50_F6H2Z8 Uncharacterized protein n=4 Tax=Pentapetalae TaxID=1437201 RepID=F6H2Z8_VITVI  ali  53  1.............MKMNLATTTNGAVFLPHQVAESIPFSSNKLPEILNRFSLKEKSTEAEIIKE-LEECEEPAMEGEAKYCTTSLESLIDFSTSKLGRNVNVQANEVKTGSQE----YEFGVGMEKLADKSVVCYKMNYPYAVFYCHTFTKTRTYMIPLVGADGSKAKAMSACHSDRSAWHPKHVAFKVLNVKPGTVPVCHFVHNNAMVWI. 193
176 5.000e-57UniRef50_A0A2R6RBX0 BURP domain protein n=1 Tax=Actinidia chinensis var. chinensis TaxID=1590841 RepID=A0A2R6RBX0_ACTCH  ali  36  84VFFTVDELKLGKTIPIYFSDLSNSPHLLSREETDSIPFSLSQFQEILEFFSFPKHSPQAKAMEYTLSQCEMEPLKGETKFCATSLEAMLDSTRGIFGLATKFQVLTTKHLSNHTQNYTILGVPRVVATKKMLACHTMPYPYAVYYCHGQDGDKLYELVLGGDNGERVEAVGVCHVDTSQWDPDHVAFRVLKTSPGKSPVCHFFPAENLIWVA 301
177 6.000e-57UniRef50_A0A072UL76 BURP domain protein n=1 Tax=Medicago truncatula TaxID=3880 RepID=A0A072UL76_MEDTR  ali  34  247.FFNLDDLYVGNVMTLQFPVQV-VSPFLSKKEADSIPLAMSQLPSVLQLLSIPEDSPQAKSMINSLGECESETITGETKTCANSLESMLEFVNTIFGSDAKISILTTNKPSPPLQKYTILEVSHDIDAPKWVACHPLSYPYAIYFCHYITGTRVFKVSLVGENGDKMEAVGICHLDTSDWNPDHIIFRQLSIKAGKSPVCHFLPVNHLLWV. 461
178 7.000e-57UniRef50_UPI000B8C994B BURP domain protein USPL1-like n=2 Tax=rosids TaxID=71275 RepID=UPI000B8C994B  ali  37  79IFVTINTLEIGKRMRLYFNSKDPSPHLLPREETDSIPFSSSKLPYLLEFFSLSATSPQAKSMAYTLKECEADAVKEEVKFCATSLESMLDSLQTIFGSNPHLKVLTTRFKTKLPQNYTILEAPKEIFGAKMVACHTMPYPYAVFFCHESGWNRVFEVSLGGDNGESVEAVVVCHMNTSEWDPDHASFRLLNVQPRTCPVCHVLPLDDLVWV. 299
179 8.000e-57UniRef50_B7ZYY9 BURP5 n=19 Tax=Petrosaviidae TaxID=1437197 RepID=B7ZYY9_MAIZE  ali  31  428.FFRERELVAGNRMPMPIRDKMPPRAFLPRAIAARIPFEPNAVSEAF---GLPLDTALGKAVASTVAECERAPSKGETKRCATSAEDVVDFAVEVLGDDIVVRSTASTAGGGGRVQLGAVAGVDGGRVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAADGKINRGVAICHLDTSDWSPAHGAFVALGGKPGEVEVCHWIFEGDMTWT. 640
180 9.000e-57UniRef50_Q6I5W0 BURP domain-containing protein 2 n=5 Tax=Oryza TaxID=4527 RepID=BURP2_ORYSJ  ali  40  66VFFLEKDLFPGSKMTLHFTRATAGAALLPRGRADSVPFASEKLPEILSQLSIPAGSPTADAMRSTLAVCESETAPKHKHYCATSLESMVELVASSLGTRDVHAVSTNRAGPTPRQAYRVEAVPVPVPGGDMVACHRMPYAYAVFGVHGIKGA-AYTVTLAGADGTMAEAVAACHGDVDGHGAVAEAYKRLGVAPGKVAVCHFLPQDDMLWV. 285
181 1.000e-56UniRef50_A0A1R3G8P0 Uncharacterized protein n=2 Tax=Malvaceae TaxID=3629 RepID=A0A1R3G8P0_9ROSI  ali  48  3............NLPL-LIETRDTTTFLPDQVSKSIPFSSDKLPEILKHFSFETESSEANAMKQAMKACERKAMHGEAMYCATSFESFVDWSVSKLGKNIKLLSNELEKETKNSVFKI--GKGIQNMGENEIVCHKMSYPYAVFLCHSIDKTVVYKVPLVGIDGTKVNALAICHKDTSAWDPNHPALLFLKVKPGTVPICHFVVRDTLVWVS 199
182 1.000e-56UniRef50_A0A1J6KEW6 Burp domain-containing protein 3 n=31 Tax=Solanaceae TaxID=4070 RepID=A0A1J6KEW6_NICAT  ali  47  123.YFLEKELAKGKVINFPSFKNKNEAPFLSRQFVESIPFSLKKIPEILNHFSIDSSSKDAQTIEETIKFCEELEVKHKEKKCATSLESMVDFSLSMLGNNNNIVSTRVQGETPMLEEYTIQEVQQIGDGDNMV-CHKLNYAYAVHFCHVGGHTKTFAVSMIGADGTKVKAISVCHKDTSLWNPRGLPFVVLKVKPGTTPICHFLQDDQIVFI. 334
183 2.000e-56UniRef50_M1CD21 Uncharacterized protein n=3 Tax=Solanum tuberosum TaxID=4113 RepID=M1CD21_SOLTU  ali  37  1....MDDLKLRKEIFISFPRRDPSPKFLSKEEANSIPFSLKELPNLLQRFSFSRNSPEAKVMEETLKVCGIPPIKGETKYCATSPKAMVDFVQEIMGDKTEIKTTHFSNSTPLLQKYIILDTPEEVETPKMVACHTMPYAYAIFYCHHTSKSKVFKVSLGGENGDKVKAIAVCHLDTSEWSPSHVSFRVLGISSGTCPICHFFPSDNLLWV. 213
184 2.000e-56UniRef50_K3YJ42 Uncharacterized protein n=5 Tax=Poaceae TaxID=4479 RepID=K3YJ42_SETIT  ali  37  49VFFREEALRVRQSLPFRFPAAVTAPGFLPRHIADAIPFSSSALPGVLAQFNVAEGSAQAAKMEETLGMCEDPGLEWEAKFCATSLEALVEGAQGVLGTRSITEMISRVPRAGSPLQPYTIRAVQPVRGSSFVGCHQKEYPYTVYMCHSTGPARAYKVEMEGAGGDKVTLFSVCHTDTSEWDKDHVAFRFLDTKPGGPPVCHVLPYGHILWA. 260
185 2.000e-56UniRef50_A0A2G5EA09 Uncharacterized protein n=1 Tax=Aquilegia coerulea TaxID=218851 RepID=A0A2G5EA09_AQUCA  ali  36  90VFLVEKSLKVGNTMPIYFPHRNPSPHFLPREEADALPFASDKLPYLLQTFSFSDGTPQAKATSLTLEQCEAAPIDGETKFCATSLEAMLDFARSIFGMGTHFKVVSTIHHAKPVLHNYTMVNIRDLSATSMVACHTMPYPYTVFYCHHTESTKVFKVSLISEDADKVEAVVVCHMDTSEWNPAHVSFRILKIKPGTDPVCHFFPQDHLVWV. 312
186 3.000e-56UniRef50_A0A2I0VYF7 BURP domain-containing protein 3 n=7 Tax=Dendrobium catenatum TaxID=906689 RepID=A0A2I0VYF7_9ASPA  ali  39  85LFFLKDSLNLGTKMTLDLTKSISAPPFLSVEMANATPFSSTKVTEILSLFSIKHGSAEDIAIQRTLAECEELPLDGERKSCVRSMEAMVDFVEAELGNRDVQVFETAMADVGDPQEYMIGQKEVKIEAKALVSCHPEPYPRAVYYCHTAKNIEAYAVHLYGANGAAVDAVATCHTDTSAWDPNYVGFKMLKVKPRTEPICHFLPQGHLIFA. 300
187 4.000e-56UniRef50_A0A1S3BQR7 BURP domain-containing protein 5-like n=1 Tax=Cucumis melo TaxID=3656 RepID=A0A1S3BQR7_CUCME  ali  42  58IFFLDNMLSIGSTYNLYFLNISSKSPFLVRVAANKYPFSSNKLLDILARFSIKPNTDEAKLIENTIMDCEVPPIKGEERYCATSLESMVDVVIMKMGKEVKVMSATVEDGMNPT--YSQVSTVVEKSKVNNLLCHKETYPYAVFYCHSNRGTRVYEVGFIDKDGKRANVLAVCHNDTSGWDPKHFAFKYLKVKPGGATICHFLPPYDLAF.. 266
188 6.000e-56UniRef50_U5D7Y0 Uncharacterized protein n=3 Tax=Amborella trichopoda TaxID=13333 RepID=U5D7Y0_AMBTC  ali  38  90VFLHESDLRLGNKLNSYYVNISQTPSPLPRQEADSIPFSSKSVADLLHHFSINPNSPQAKQAKKTLQICEEPLAKGEHRVCATSLESMHDFVSSIFGPKVATTIHNREIHSPAVQSYTVKGIIFRSTTPSLVACHALPYPYTLYYCHEVIKAKVFKVMLKGEDGNKVDAAVVCHLDTSHWDPNDEAFKVLKNKSGE-PVCHLLPENNLVWLS 307
189 7.000e-56UniRef50_A0A2C9U9E9 Uncharacterized protein (Fragment) n=1 Tax=Manihot esculenta TaxID=3983 RepID=A0A2C9U9E9_MANES  ali  53  126VFFLKKDMYPGKTMNLHFPEILNVVTFLPRRIANSIPFSSNKLPKIYNQFSIKQGSMEAEIMKKTIRDCEDPGIKGEVKYCATSVESMIDFSTNILGKNVQTISTDVNQI--QLQKYTITTGAKKIGSDKMVTCHMMSYTYAVFYCHTTQNTTVYRVSLEGADGTKT--------------------QLLKVKPGTVSICHFLPQDHLAWV. 314
190 7.000e-56UniRef50_UPI000B934EBA BURP domain-containing protein BNM2C-like n=3 Tax=Momordica charantia TaxID=3673 RepID=UPI000B934EBA  ali  34  69IFFTTDDLKLGKKLPLNLPPKDPSPPMWPKEMADSIPFSLEQLPQILNFFSFSLGSPQAQAVESALHRCDIEPNKGETKFCGTSMESMADSARSAFGLGSKSSVHSTRSRPPYLQNYTLLQMPNEIAAPKFLACHAIPYPYAVHYCHYLEGNKVLQIPLEGENGNVVMAAAVCHVDTSEWSPEHVSFKVLKSKPGMTPVCHVFPPNDLIWI. 289
191 8.000e-56UniRef50_A0A2T7C6U4 Uncharacterized protein n=2 Tax=Panicum hallii TaxID=206008 RepID=A0A2T7C6U4_9POAL  ali  39  147LFFHEELVQVGKTITLYFPLAASAPGLLPRHVADSIPFSTSSLPSALARLGISNNSVQAANMEETLYMCDLPPKAGEAKFCATSLEALVEGSMAALGTRNIRPMTSDLPRSGAPKQTYIVRAVHPVDGSSFVSCHDHNYPYTVYMCHNTPSTRAYMLELEGARGLVVTVAAICHADTSLWNSEHVSFKILGTKPGGAPICHYLPYGHNVWVN 360
192 8.000e-56UniRef50_A0A2P4KUI0 Burp domain-containing protein bnm2a n=3 Tax=Quercus suber TaxID=58331 RepID=A0A2P4KUI0_QUESU  ali  36  155.LFPVKDLFVGNIMPLYFPVKEF-PQFLPREEADYIPFSMAQLPNILQLFSVPIDSPSARAMEATLHECEVTHIPGEIKLCATSLESMLDFVHRVMGPNVLTTTVHPTMSTALTQNYSVLRVSKEIYAPKWVACHPLPYPYLTFFCHFTENTKIFKVLLGGENGHKVESAAVCH-NTSGWDPNHIVFRELGPKYGSTSVCHFLAKYHLVWV. 366
193 9.000e-56UniRef50_A0A2U1Q1X3 BURP domain-containing protein n=2 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1Q1X3_ARTAN  ali  36  63VFFRVGDLYLGKKMPICFADNSNPTHLLSQDEANSIPFSSSKLPYLLEFFSIPKNSPQAKAMEATLNQCEHKPAKGEVKFCANSLESMMDMTLGVLGKVKPKVLTTKIFSSNHFQNYTFVKKPLEIYASKKVACHAMAYPYKVYYCHKGHTDRLFKIDLHGENGERVDAIAVCHMDTSMWDSNHIAFRVLGVQPRSSPVCHFLPPDNLAWI. 279
194 1.000e-55UniRef50_A0A0K9NLI0 BURP domain-containing protein n=2 Tax=Zostera marina TaxID=29655 RepID=A0A0K9NLI0_ZOSMR  ali  43  144.FFLESALAQKSSLKLHFYLTTALSGFMDRSVADSIPISSQNLPNILKRFSVEPNSMVANMIKESIEDCEIPALPNEKKLCATSLESMVDFATSILETTNVKALSTVNKNDGLKQRYSITSSVLKGTRSRSVACHPSTFPYALYFCHTVHNTRTYSVSLVGENGSKIEAIASCHQETSDWSPEHISFRILNVKPGEGSICHFLAQDSIAWIA 357
195 1.000e-55UniRef50_UPI000B8A94F0 BURP domain protein RD22-like isoform X1 n=3 Tax=Chenopodioideae TaxID=1307796 RepID=UPI000B8A94F0  ali  43  247VFFVEKKLNLGTKMTLHFQKSIQTGVFLPREVSNKIPFSSDKIQETLKILSLDPKSEEAKVLSHRIELCEEPTIEGVEKKCVTSLESMVDYVISKIGTNVKALTTQVEKDSTM--EYTIKGVKKLVKDDRTVVCHKMGYPYALFFCHRTKTIRSYMVSLIGKDGSIIEAVAACHKETNDFLDNY-AKNVLNVVPGSTHICHFPPEDTIIWV. 456
196 1.000e-55UniRef50_A0A072UL19 BURP domain protein n=4 Tax=fabids TaxID=91835 RepID=A0A072UL19_MEDTR  ali  35  120.YFSFDDLHVGNVMTLQFPVQ-EVSPYLSKKEADSIPFSMSQLPSILQLFSIPEESPQAKSMRGALEECEGETVTGETKICANSLESMLEFVDTIIGSNVKYSILTTSNPTTPLQKYTVLEVSHDIDVPKWVACHPLPYPYAIYYCHYITKTKVFKVSLVDENGDKMEALGVCHFDTSEWNPNHIIFKQLGIKAGKSPVCHFFPVNHLMWI. 334
197 2.000e-55UniRef50_UPI00077E53AA BURP domain-containing protein 5-like n=1 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI00077E53AA  ali  44  102.YFLVSDIQQGRTVKMLFPKAMNITKFLPRQVAESIPFSSTKLPEIFAHFAIDPKSLEAKTMEIVLKDCEQPFPEEEERRCVTSLESLVDFVVSKIGNKVDVHVTEVENEEA--QEFIIGKKTELKNGDVSVICHKENFAYAVFYCHKIYGTKAYWVPLKGAKISKNFAVAICHTETSSWDPNIVPFQQLKVKPGTA-FCHFIRSDTLL... 313
198 2.000e-55UniRef50_S8BTZ3 Uncharacterized protein (Fragment) n=1 Tax=Genlisea aurea TaxID=192259 RepID=S8BTZ3_9LAMI  ali  44  8LFFTEKDIPTWKTLTLTFHNTTQQPPFLPRELADALPFSSAHLPEILHKFSVTP--TEARSLRATIRECETRALNENQKSCATSLESMLDFSVAHLGKDVAAASTHGAEESNGKEYTVTSVKKSPDGAKGLVVCNREDYPYAVFFCQRTTTAAAYQLDLTAADGSKAELVAVCHRETSSWNPESVPFKVLKVKPGEVPICHVLPQDNVVWI. 217
199 3.000e-55UniRef50_A0A2I0LF18 Uncharacterized protein (Fragment) n=1 Tax=Punica granatum TaxID=22663 RepID=A0A2I0LF18_PUNGR  ali  44  19LFFAEDDLHPGKTMSMRFIKSTNPVSFLPQKEAAFMPFSSRRLSEIFRLYSGKSGSAEAQKISYTIERCGPSLVSTEDTSCVMSLESMVDFATTRLGNNLQVFNTEVKEQAVGKQDYTIQSRIKKVEGDRLAVCHKLHYPYAVFTCHSFKSTDSYVVPVKGPDGTTTEAIAVCHENTSEQNPE--PLKMLNIKPGIVPLCHFLARDSIV... 228
200 4.000e-55UniRef50_A0A2P4K034 Polygalacturonase-1 non-catalytic subunit beta n=2 Tax=Quercus suber TaxID=58331 RepID=A0A2P4K034_QUESU  ali  26  360.FFQESMLKKGKVIPMDINDKLPEMSFLPRSISSKQPFSTLKVSELKHIFHTGDNSTTETMIVKSLSECKRAPNPGKTKRCVSSAEDMIDFAVSVLGRNIDILTTKNVNGSKQSIMIGSIEGINGWKVTDPISCHQLLFPYLLYYCHSVPKVRVYQVDILDPNSKINNSVAICHMNTSSWNPTHESFLALGSAPGRIEVCHWIFQNDLKWT. 572
201 5.000e-55UniRef50_A0A2P5RDK8 Uncharacterized protein n=3 Tax=Gossypium TaxID=3633 RepID=A0A2P5RDK8_GOSBA  ali  37  535..FTIDDVHVGRKLSTFFSIRNNSPGFLPKELADSISFSSSEIPKILKFFSIPAASQKAKVVKDTIRKCELEPVKGETKICATSLESMLEFVRNALGPDVDFSTSHLTMTTPILQSYTITEPPREIKSPKKVACHPLPYLYTIYMCHYTYETKIFKVALVGDNGDKVDALIVCHIDTSAWSPKHVAFSLLGTKPG-IPVCHTFTEGHGVWI. 751
202 5.000e-55UniRef50_A0A2C9VTF4 Uncharacterized protein n=2 Tax=Manihot esculenta TaxID=3983 RepID=A0A2C9VTF4_MANES  ali  48  204...............VHITKSANKARILPRQVADSLPFSTNKLAEIMKRFSVDPESRQGKMLKQTVENCESPGIKGEDRFCPTSLESLVDFSVKHVGNKAQYTI-----------------KEVKFIGENYVVCHKLHYPYAVYYCHALKGTKVYTAQVVGADGTKAKAVAVCHTDTSAWNPGSLAFLVLKMKPGEGTVCHFIRSDTFVMVS 383
203 5.000e-55UniRef50_A0A218WYT1 Uncharacterized protein n=1 Tax=Punica granatum TaxID=22663 RepID=A0A218WYT1_PUNGR  ali  44  86LFFAEDDLHPGKTMSMRFIKSTNPVSFLPQKEAAFMPFSSRRLSEIFRLYSGKSGSAEAQKISYTIERCGPSLVSTEDTSCVMSLESMVDFATTRLGNNLQVFNTEVKEQAVGKQDYTIQSRIKKVEGDRLAVCHKLHYPYAVFTCHSFKSTDSYVVPVKGPDGTTTEAIAVCHENTSEQNPE--PLKMLNIKPGIVPLCHFLARDSIVYA. 297
204 8.000e-55UniRef50_A0A2P4M3L4 Polygalacturonase-1 non-catalytic subunit beta n=14 Tax=Fagaceae TaxID=3503 RepID=A0A2P4M3L4_QUESU  ali  29  122IFFRESMLKKGKVLPMPIKDKMPKRSFLPRSISSKLPFSTSKVSELKKIFHVDDNSTMETMIVKSLNECESAPSLGETKRCVGSAEDMIDFAISVLGRNIVVRSTENFKGSKQNIMIGSVEGINGGKVTQIVSCHQTLFPYLLYHCHSVPKVRVYEVDILDPNSKINHGVASCHMHTSDSNPNQAELTIA-SGPGQIKACHWVVENHLIWT. 334
205 1.000e-54UniRef50_A0A1U8MJL8 protein RAFTIN 1A-like n=1 Tax=Gossypium hirsutum TaxID=3635 RepID=A0A1U8MJL8_GOSHI  ali  44  298....................ASDRTPFLPDRVAKSIPFSSSKFPEILNHFSLKPQTREAEIMKRTIGVCEREAINGEQMFCVRSLESFIDLSIATLGKEIQLLSNQLSKETNNPLF--TIARGMQDMGENELICHKERYPRAVFFCHSINKTTLYKVPLLGRDGTKANALAVCHKDTSAWSPKHIAFQILEVKPGTVPICHLLAKDTLAWVS 487
206 1.000e-54UniRef50_Q6K2M1 BURP domain-containing protein 14 n=25 Tax=Poaceae TaxID=4479 RepID=BURPE_ORYSJ  ali  31  477.FFRERDLVAGNRMPMPIADRTPPRAFLPRDIAAKIPFDAAA---VSALFGAAPGTAMRQVVSSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGGGGDVRLGVAGVPAGGNVTRSVSCHQSLFPYLVYYCHSVPTVRVYEADIVDSNQKINHGVAICHLDTSDWSPNHGAFIALGGKPGEMEVCHWIFQGDMTWT. 687
207 2.000e-54UniRef50_UPI000B8C7C00 BURP domain protein USPL1-like n=2 Tax=Carica papaya TaxID=3649 RepID=UPI000B8C7C00  ali  33  135VFFHITDVKVGEKIPIYFPRKEPMSSFLSKEQADSIPFSSGKLSYVLQMLSINPGSPQARAMRNTLAHCEAQPIQGETKTCATSLESLLDFVHALFGPQSDFNVLSTRYLKRSSQNHTVVAIIEEMWPSKMIACHKMPYAYPVLYCHGLEGSKVLKVLLGGENGDLVDAVGVCHIDTSHWSPTHASFRVLGAEPGKSPVCHFFPSYNLV... 354
208 2.000e-54UniRef50_A0A1S3TZ31 dehydration-responsive protein RD22-like n=2 Tax=NPAAA clade TaxID=2231382 RepID=A0A1S3TZ31_VIGRR  ali  43  2...........SELDIIFKKRKFERPLLPRQIAQRIPFASAKIKEIFEMLSMKPEVENVKIVTETISLCEAPSIRGVEKNCATSLESMVDFITSKLGKNAQVISTEVEKVSKSE-KFLVKDGGKILAEENIIVCHPMNYPYVVFYCHKISNITVRFMPLEGEDGSRVKAVAVCHKDTSEWDPNHGFLQALKVKPRTVPVCHILPEGDLLWFA 201
209 2.000e-54UniRef50_A0A1J3JCI5 BURP domain-containing protein 3 n=4 Tax=Noccaea caerulescens TaxID=107243 RepID=A0A1J3JCI5_NOCCA  ali  37  56MFFAIEKLKLGTKLPIYFDKNDKLPPLLTRQEADLIPFTNSKLDFLLDHFSISKDSPQGKAMKETLARCNYKPMEGQLKFCGTSLESMLDLVKETIGSNADLKVMTTKVTSYALHNYTFVEAPKELVGIKMLGCHRMPYPYAVYYCHHSSGSRVFEVNMVTDDGQRVIGPAVCHMDTSMWNADHVAFKVLKVEPRSAPVCHFFPLDNIVWVT 278
210 2.000e-54UniRef50_A0A151QV04 BURP domain-containing protein 17 n=4 Tax=50 kb inversion clade TaxID=2231393 RepID=A0A151QV04_CAJCA  ali  40  1.............MPIYFSKKNSSPKFLTREEADKIPFSSKHLPSLLKFFSMSKHSPQAKAMKYTLKQCEFESMEGETKFCATSLESLFDFAHYLFGSNAQFKVLTTVHLTSPLLQNYTVSEVKVISATNVIGCHPMPYPYAVFYCHSQHSTNLYEVLVEGENGGSVQAAAICHMDTSKWDPDHVSFRVLNVEPGTSPVCHFFPSDNLVWV. 203
211 2.000e-54UniRef50_U5D807 Uncharacterized protein n=1 Tax=Amborella trichopoda TaxID=13333 RepID=U5D807_AMBTC  ali  36  77FFFHMKDLKVGNKFDLYNMGDLEATSPLPRHEADSPPFAFASLTEILHHFSIPPDSPKAKKVAQNFQICESPQVGNEHKFCATSLESMYDFVSSILGPKAKPQVLATTAHNGENQSYIVKAIPVRVTTPSLPVCHPMTYPYALYFCHAAAKTTALMVKLEGEDGSKIDAAAVCHLDTSDWVSNHVSFKVLGIKPGTEPVCHFIPENNFLFIT 295
212 2.000e-54UniRef50_A0A1U8G015 BURP domain protein RD22-like n=11 Tax=Capsicum TaxID=4071 RepID=A0A1U8G015_CAPAN  ali  45  95.YFFEKKLKKGNIINFPTFKDKNDAPLLPRQVAESIPFSSKKILEILNHFSIDGNSEDAQTIKDSINICEKPEIHHKEKFCATSLESMIDFMLSELGTNNIQAITTEVEGSQIFQKYTVKKVEQIADGNNMV-CHKVDYPYAVHYCHIGGHTKTFIISMVGVDGTKVKALSVCHQDTSFWNPKGLPFIVLNVKAGTTPICHFLPNDQIV... 304
213 3.000e-54UniRef50_A0A1R3GP10 Uncharacterized protein n=4 Tax=Corchorus TaxID=93758 RepID=A0A1R3GP10_COCAP  ali  43  173IYFLQKDLRAGTKANLPFKQAMETKKFLPYTVAESMPFSSDKFPEILKHYSVKAGSMEAKAMNVTVRNCARASSYGEDKYCATSFKSFIDMGVTKLGKNIKLLACEIEDGTNSPLF--TIGNGVRIMGKKEIVCHSMPYPYVVFLCHSIENTVVYRVPLLGIDGGKALALAVCHLDTSGWDHNHPSFRILKIEPGTLPVCHFLYPDTVVWV. 387
214 4.000e-54UniRef50_W5EQW2 Uncharacterized protein n=11 Tax=Poaceae TaxID=4479 RepID=W5EQW2_WHEAT  ali  39  108LFFHEEAVQVGKTMTLYFPLAASAPGLLPRHVADSIPFSASSLPTALARLGVANNSVQAANMEETLYMCDLPPKAGEAKFCATSLEALVEGTMAALGTRNVRPMASDLPRSGAPKQPYAVRAVHPVDGSSFVSCHDHNYPYTVYMCHNTPATRAYMVEMEGAHGLAVTVAAICHTDTSHWDAEHFSFKVLGTKPGDGPICHYLPYGHNVWV. 320
215 4.000e-54UniRef50_A0A072UL46 Dehydration-responsive RD22-like protein n=2 Tax=Medicago truncatula TaxID=3880 RepID=A0A072UL46_MEDTR  ali  34  294.FFNLDDLHVGNVMTLQFPIQ-EISNFLSRKEADSIPLSISQLPSVLELLSIPEDSPQAKSMRETLEQCQAEPVTGESKTCANSIESMLEFVDKIIGSDSKHNVLTTTHPSPPLQKYTILKVSRDISVPKWVSCHPLPYPYAIYYCHYITGTRVFKVSLVGDNGDKIEAVGMCHLDTSDWNPDHIIFRTLRIKPGKVPVCHLLSINHLLWV. 508
216 5.000e-54UniRef50_A0A2P5YCQ8 Uncharacterized protein n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5YCQ8_GOSBA  ali  37  189..FTIDDVHVGRKLSTFFSIRNNSPGFLPKELADSIPFSSSEIQKILQFFSIPAASQKAKVVKDTIRKCELEPVKGETKICATSLESMLEFVRNALGPDVDFSTSHPTMTTPILQSYTITEPPREIKSPKKVACHPLPYLYTIYMCHYTYETNIFKVALVGDNGDKVDALIVCHIDTSAWSPKHVAFSLLGTKPG-IPVCHTFTEGHDVWI. 405
217 6.000e-54UniRef50_UPI0005276C12 polygalacturonase 1 beta-like protein 1 n=1 Tax=Eucalyptus grandis TaxID=71139 RepID=UPI0005276C12  ali  27  143.YFRESMLRSGNMIRMPLRVKAPKRSFLPRSISSGLLFSTSKLAELKQIFHAGDDSNMEKIMVRTLNQCEQAPIQGETKRCVSSVEGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKRLDGSKSSAPVACHETIFPYMVYYCHTFPTLRIYEADILDPKAKINHGIALCHMDTSIWSPNHEAFLALGSSPGRIEACHWVFGDYGVWT. 355
218 6.000e-54UniRef50_Q9XI99 BURP domain protein USPL1 n=30 Tax=Brassicales TaxID=3699 RepID=USPL1_ARATH  ali  35  57MYFTLNDLKLGTKLLIYFYKNDKLPPLLTRQQADLIPFTKSKLDFLLDHFSITKDSPQGKAIKETLGHCDAKAIEGEHKFCGTSLESLIDLVKKTMGYNVDLKVMTTKVMSYALHNYTFVEAPKELVGIKMLGCHRMPYPYAVYYCHHKGGSRVFEVNLVTDDGQRVVGPAVCHMDTSTWDADHVAFKVLKMEPRSAPVCHFFPLDNIVWVT 279
219 7.000e-54UniRef50_A0A175YDK1 Uncharacterized protein n=1 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=A0A175YDK1_DAUCA  ali  32  56VWFTPKDLYKGFTKPVYFEKEDPAPYFLSKEEADAIPFAIPELDNILARFSISRNSPQGKAIAYTIYNCDLHPTGHMIASCVSSLESMLDLVQKSYGPNTNFDLYTSVIHHSENQNYTFLDTPYQIPTQKMIACHPMPYPYAIFYCHGDGSTKVYKIPLGGEYGDRVEAIAVCHADTSGWDKDHISFKMLHMKPGSGPVCHVIPQNNFVWI. 274
220 8.000e-54UniRef50_UPI000B8CA366 BURP domain protein USPL1-like n=1 Tax=Carica papaya TaxID=3649 RepID=UPI000B8CA366  ali  37  59.LFTISDLHIGKTITIDFPNPDPSPRFLPRSEADKIPFSSKNLSTILGLFSISPDSHQARRIQHTLTHCESKPMQSETRFCATSLESMLDYVRAVFGPDTPFRPLTTKYSDNPKQRYTITESPREGSDAKMVGCHASVYPYAVFYCHRRGGNRAFRVWLRGENGDRVEALGVCHVDTSDWDPNHIVFQLLGSSPG-SPVCHFLSSNALLWV. 282
221 9.000e-54UniRef50_A0A061GRD4 BURP domain-containing protein, putative n=1 Tax=Theobroma cacao TaxID=3641 RepID=A0A061GRD4_THECC  ali  68  129........................ATFLPRHIAQKILFSSDKLPEILNKFSVKPGSAGAEIMKNTIKECEQPQIQGEDKYCVTSLESMIDFSTSKIGKNAQ----------------------------------KQNYAYAVFYCHKSETTRAYMVPLEGADGTKAKAVAVCHTDPSAWNPKHLAFQVLKVEPGTIPICHFLPQDHIVWI. 281
222 1.000e-53UniRef50_A0A059D891 Uncharacterized protein n=17 Tax=rosids TaxID=71275 RepID=A0A059D891_EUCGR  ali  29  149.YFQESMLRSGNVIRMPLRSKTPERSFLPRSISSGLPFSTSKLAELKQIFHAGDDSTMEKIMVRTLSLCEKAPIRGETKRCVSSVEDMIDFATSILGHDIKLHSTKSDEGSKHDILIGRVKRIGGSKLSVPVACHDSLFPYMVYNCHAVPTLHVYEVDILDPKAKINNGVAVCHMDTSAWNPNHEAFIALGSGPGRIEACHWIYGEYAVWT. 361
223 1.000e-53UniRef50_A0A1R3GBU8 Uncharacterized protein n=8 Tax=Malvaceae TaxID=3629 RepID=A0A1R3GBU8_COCAP  ali  36  293..FTIEDIHVGRKLSTFFAIRNPSPGFVPRQVADSIPFSSPDIPKILQFFSISPGSQKGKAIREAIKTCEIEPVRGETKICATSSEFMLEFLKNAFGENDFDRTSHPTMKRPILQNYTILESPREIESPRKVACHPLPYLYTIYMCHYDDTTKVFNVPLVGDNGDKVDAIIVCHMDTSAWSPDHVALTLLGAKPG-ISVCHALPEAHAVWI. 508
224 2.000e-53UniRef50_A0A1D1XSD7 Putative polygalacturonase non-catalytic subunit At1g60390 (Fragment) n=1 Tax=Anthurium amnicola TaxID=1678845 RepID=A0A1D1XSD7_9  ali  28  415.FFRKANLVTGKRIPMPIRDKMPPRSFLPRALADKLPFGSARLPELVGLLGVSSD-QQRVQMARTVEECERPPAKEETKRCVTSLEGMAEFAASVLGETAGVSTTASTAGWGETLVVGKVEGRQDVE-TRAVSCHQSLFPYMVYYCHMVPRVAVFDVELMRERGEVNQGVAICHLDTSQWSAGHAAFLALGPSPGKIEVCHWIFENDLLWV. 629
225 2.000e-53UniRef50_A0A0E0PJ04 Uncharacterized protein n=2 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0E0PJ04_ORYRU  ali  42  27VFFLEKDLFPGSKMTLHFTRATAGAALLPRGRADSVPFASEKLPEILSQLSVPAGSPAADAMRSTLAECEAAPQAGEAKRCATSLESMVEFAASSLGTRDVHAVSTERAGPTPRQAYRVEAVPVPVSGGDMVACHGMAYAYAVFGCHTTTAAAY-----------TAEALAACHTDAAP--RVAEAYKRLGVAPGSVPVCHFLPQDDMLWV. 227
226 2.000e-53UniRef50_A0A2U1KBE1 BURP domain-containing protein n=18 Tax=Pentapetalae TaxID=1437201 RepID=A0A2U1KBE1_ARTAN  ali  35  74VFYMLPDLIVGKVMPIHFPNRLSPSQLLSKQEADNIPFSLTELPNLLRMFSFPQGSPQAIAMESTLQECEVKPIKGETKFCATSMESVHEFARDIFGFDTQYKTMTTTHPSGLLQNYKVIEISQNIPSPKLVACHTMPYPYAVFYCHSQQSNKVLMVTLEGEDGDMVEALSVCHMDTSHWSRNHVSFGMLGVEPGMTSVCHFFPSDHFVFI. 290
227 3.000e-53UniRef50_A0A1R3GM73 Uncharacterized protein n=2 Tax=Corchorus TaxID=93758 RepID=A0A1R3GM73_COCAP  ali  33  56.FFVLNDLKLGKTMPLYFPYVDPSKSLLPKEKPDSVPFSPNSLPYLLQFFSISQDSPQAKAIEETLRICQDDQSKGETKYCATSLETLVGQASKIFRSDTGVQILMTSHTSKTKQNYTIVGKPKEIAAPNIIACHSMSYPYAVYYCHNPEGTKVFEVTLLGEDGDRIDAVSVCHMDTSQWDPHHVSFSVLGVLPGSSEVCHFFPPGD..... 277
228 4.000e-53UniRef50_A0A2K3LZR9 BURP domain protein n=10 Tax=Pentapetalae TaxID=1437201 RepID=A0A2K3LZR9_TRIPR  ali  56  1..........................................MENILHKFSIKKGSKEYEIVKNTINDCEEKGIKGEEKLCVTSLESMVDFAISKLGKNVEVVSTEVKKESNELQQYVIGKGVKKGDKNKTIVCHKENYPYAVFFCHKTDTTKVYSVPLEGVDGNRVKAVAVCHTDTSQWNPKHLAFQVLKVQPGIVPVCHFLPDDHVVWVS 172
229 4.000e-53UniRef50_A0A0J8D1F6 Uncharacterized protein n=3 Tax=Chenopodiaceae TaxID=1804623 RepID=A0A0J8D1F6_BETVU  ali  41  283VFFVEESLQVGGRMALKFQKGAKEGFFLPREISNQIPFSSDKIQETLRILSLDPKSKEAFVLSKRIELCEEPTVEGVEKKCVTSLESMVDYVISKIGTNVKALTTQVEKDHSMMEYTIKGVKDLAKDDHETVVCHKMGYPYAVFFCHRTKTIRSYMVSLVGKDGTKIEAVAACHKETNEFLDNY-AKNVLKVVPGSTRICHFAAKETIIWVS 494
230 5.000e-53UniRef50_UPI00077EBE66 BURP domain protein USPL1-like n=2 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI00077EBE66  ali  34  52.FFTVDDLYVGKAIQFYTRDPSSLPPFLSKEVADRIPFSVKELPLLLQLFGMAPGSPEAQLAERTLKTCAEEPIKGEQKTCATSIESFIEFASSMYGVDFRAMKTTHLGKPVSVYQNYTFLDIKEVHSPTMVACHIMDYPYIVYMCHSQ-TSRVYQIKIVGQEGDALNAIAVCHIDTSQWAPDHVSFKLLGVKPGTVSICHFFGPHNPVWV. 268
231 5.000e-53UniRef50_UPI000B932BF2 BURP domain-containing protein BNM2A-like n=1 Tax=Momordica charantia TaxID=3673 RepID=UPI000B932BF2  ali  36  150LYFTINDLKLGKKFPFYLHQNDPSTPSLSKEIADSIPFSLKQLPQILNFFSFPSDSSEAQIVENALRLCEREPVEGETKFCTTSMKSMVDFVSSALGFGKYLATTLLTKFHTNLQNYTLLQMPNEIKVSKYFACHALRYPYVIRYCHSFGDTKLLQFPMEGENGDRVQALAVCHMDXSEWNPKHPSFKVLNTVPGTFPICHIMPLTDFIW.. 367
232 6.000e-53UniRef50_A0A0K9Q3Z5 BURP domain-containing protein n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9Q3Z5_ZOSMR  ali  41  50.FFLEKDLQVKQNMHLHFYRAAPVSGFIPKSMAHTTPISSQKFLDVLKRFSIHPNSVTANVLKESIENCETPNSINEKRICATSLESMVDFATSVLETKNLLPLSTVNRNGTLNQRYSISSVKTVGSGSSSVICHAFIFPYTMFFCHMVPDTKVYTASLVGEDKSIIEAMAVCHQDTSQWNSQHIAFKLFNVKPGEGSICHFLAEDSVVWI. 265
233 8.000e-53UniRef50_A0A0A9ICW4 Uncharacterized protein n=2 Tax=Arundo donax TaxID=35708 RepID=A0A0A9ICW4_ARUDO  ali  29  1.............MPMPIRDKMPPRAFLPRDIAAKIPFEPNAVSEVF---GVPLDTAMGKAVASTVAECRRAPSRGETKRCATSAEDIVDFAVEMLGNDIVVRSTASTAGGGGDIKLGAVAGVDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMGSGEKINHGVAICHLDTSDWSPSHGAFMAIGGKPGEVEVCHWIFEGDMTWT. 198
234 1.000e-52UniRef50_W9R7E1 Uncharacterized protein n=3 Tax=Rosales TaxID=3744 RepID=W9R7E1_9ROSA  ali  38  79LFFNLNDLEVGKTIPFHFSKKTSSSHFLPRDEADSIPFSLKQLPSLVKLFSSPQGSKQAKAMEDTLRACECPPIKGETKFCATSLESMLDFALRIFHENHPTPLTSSFHSTTSFQNYTIMEMPREVLTSKMIGCHTMPYPYIVFHCHTQEGSKVYKILFRGENGDVLDAVAACHLDTSDWDPNHVSFRVLGIEPGN-PVCHFPPHGNLLWV. 306
235 1.000e-52UniRef50_A0A151S7U8 Dehydration-responsive protein RD22 n=3 Tax=Cajanus cajan TaxID=3821 RepID=A0A151S7U8_CAJCA  ali  50  1...........MKLEGHFYKRTYTTPLLARQIAERIPFSPEKTKEILEILFVNPKPKNVEIVKKATSRCQAPAMIGEEKHCATSLESMVDFITSKLGKNIHVVSTEVEKET-MSTKFLVKNGVKKLAEDKIIVCHPMNYPYVVFFCHEVLNTTAHFMPLEGEDGTRVKAVAVCHKDTSEWNPKHIFFQMLKIKPGTTPVCHMFPEGHLLWFA 200
236 2.000e-52UniRef50_UPI000B775A85 BURP domain-containing protein BNM2A-like n=4 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B775A85  ali  31  37VFFNYNDLRVGAKMPIYFGGAFDSPNFLPKDKADMIPFSSQKLPFLLNYFGFQPESPQAKAMEYSLKKCEEIPDAQGAKKCVTSLDSMIDFIRETFKISNTGNTSPLPKSAKVFQPYTIIEQPKRVPSPKMTACHMLTYPYAVYYCHNPPENRVYEITLMGEDGTRVNAVASCHMNSKAFDPNLMVFRMFNTQPG-SPVCHFLSSDGLLWV. 262
237 3.000e-52UniRef50_A0A072UL17 BURP domain protein n=3 Tax=IRL clade TaxID=2233839 RepID=A0A072UL17_MEDTR  ali  33  507.FFNLDDLYVGNVMTLQFPIQ-EISRFLSKKEADSIPLAMSQLPSVFQLFSIPEDSPQAKSMLGSLEQCEAETITGETKTCVNSLESMLEFVDTIIGSYAKHNILTTTKPSSPLQNYTILEVSHDIDAPKWVACHPLSYPYAIYFCHYITGTRVFKVSLVGDNGDKMEVVGICHLDTSDWNPDHIVFRQLRVTAGKSPMCHFLPVNHLMWV. 721
238 3.000e-52UniRef50_I3SBJ5 Uncharacterized protein n=3 Tax=fabids TaxID=91835 RepID=I3SBJ5_LOTJA  ali  39  64VFFTLKDLKVGKRMPIYFPKRDPSPKFWPREKADSVPFSLNQLPNLLNFFSFSPDSPPAKAMEDTLKECESKPIQGE--------------------------------------NYTILENIMRISAPKMVACHTMPYPYAVFYCHSQESNRVYNVSLVGDNGDKVEAMVVCHLDTSHWGSGHVSFQILGVTPGSSSVCHFFPADNLIWA. 239
239 3.000e-52UniRef50_A0A140KER1 Uncharacterized protein n=3 Tax=Rubiaceae TaxID=24966 RepID=A0A140KER1_9GENT  ali  36  86IFFNLKDLKLGMKMAICLENEDSNPPLSSKKEADAIPFSLKQLPKILEYFSIPQGSRKAQVMENTLQECEIKPIEGETKFCATSYESLVDLAREILGFETYPTSSTNNVGKAIVHEYTIVQLPQQISAPKMISCHTMHYPYLIIHCHSQKGNRIYRTSLLGENGEKVEALAVCHMDTSLWNHDHASFRLLGIQPGTAPVCHFLP........ 312
240 3.000e-52UniRef50_A0A1U8P4I5 BURP domain-containing protein 14-like isoform X1 n=8 Tax=Gossypium TaxID=3633 RepID=A0A1U8P4I5_GOSHI  ali  36  314.LFTIDELRVGKKLPIFFPIKNHSPPFLPKEVADTIPFSSSQLSNILQFFSVSPNSPKGKAVQDTLIKCELEAAQGETKICATSLESLLDFLSNAFGPDVDFKFISTRHPTPIFQNYTVLESPREIESPKKVACHPMPYLYAVHFCHDATETKAFRLQLVGDSGDKVDALVVCHMDTSGWSTDHAAFRMLGIKQGNA-VCHVFSQGNLVWI. 532
241 4.000e-52UniRef50_Q7F8U7 BURP domain-containing protein 13 n=23 Tax=Poaceae TaxID=4479 RepID=BURPD_ORYSJ  ali  36  189VFFHEEAVRVGERLPFYFPAATTSAGFLPRRVADSIPFTAAALPAVLALFGVAPDTAEAAGMRETLRTCEWPTLAGESKFCATSLEALVEGAMAALGTRDIAALASTLPRGGAPLQAYAVRAVLPVEGAGFVACHDQAYPYTVYRCHTTGPARAYMVEMEGDGGEAVTVATVCHTNTSRWNPEHVSFKLLGTKPGGSPVCHLMPYGHIVWA. 404
242 4.000e-52UniRef50_A0A251MVU3 Uncharacterized protein n=97 Tax=Pentapetalae TaxID=1437201 RepID=A0A251MVU3_PRUPE  ali  35  78IFFTLEDLKEGKTMAIYFPKRNPSPHLLPREEADQIPFSSKHLLHLLHFFSFSQDSPQAKAMEDTLRQCEIEPIKGEIKSCSTSLESMLDFTRGVFRLDTPFATTHLTNSTTNFQNYTILEEPKEILAPKMVACHTMPYPYAVFYCHSQKSVKVFKVLLGGEDGDRVEAVAVCHLDTSQWSPNHASSVCLGLSQG................. 278
243 6.000e-52UniRef50_UPI000C04A3AC BURP domain-containing protein 5-like n=1 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C04A3AC  ali  35  8.LFTVDELHAGKMLPIFFPNKDPASPFLPKKVADSIPFSSSKLAEILQLFSIPPGSSVAKSMEDTIKKCEYAPGKGETKTCATSLESMVDFVSGAPQDTRFITTTHPTMSTASLQNYRVLEAPKEIKSFRKVACHPMPYPYAVFFCHYDEDTRVFKVSMVGENTDKVDAAAVCHMDSTS-----AALLNLTDKHGKSPMCHFFSAGDLIWV. 225
244 1.000e-51UniRef50_UPI0005D3C00F BURP domain-containing protein 6 n=5 Tax=Amborella trichopoda TaxID=13333 RepID=UPI0005D3C00F  ali  36  161.FFLEEELKVGMNRVLYFPKSTYAAPFLAREIADAILFSSAELPQILKRFSLPTASVEANAVRETLAWCESLR---GKAQCLTSLEAVIDYATRSTMDRSITTLHTHIDKDSGLQAYTVKRVEHKVATPDSTVCHNMAYPYALYYCHHVGEGKIYEVRLEGEDKSIVEAIAACHSNTRTWHPHSFAALPAGVKADHSFACHFLPDTHIVWA. 369
245 3.000e-51UniRef50_A0A1U8GUI4 BURP domain protein USPL1-like n=3 Tax=Capsicum TaxID=4071 RepID=A0A1U8GUI4_CAPAN  ali  36  141LYFLIDDLKIGKTIKDFSFPSRSSLPFFPKEAADSIPFSLKELPNLLQRFSLSKDSPQAKAMEDALRVCENSSIKGETKYCATSAEAMLNFVQEILGERTQIKTHSPKDSNSALQNYTILDSPKEVVVPKMVACHIMSCAYTVFYCHPSVSTKMFKVPLGNENGDRVEAIVVCHLNTSDWSPSHFSFQVLGILPGASPVCHFLPSNDLVWV. 361
246 3.000e-51UniRef50_A0A061GSI3 BURP domain-containing protein, putative n=1 Tax=Theobroma cacao TaxID=3641 RepID=A0A061GSI3_THECC  ali  48  39VYFFQEDLYPGKMVKLPLTRTRDMTTFLPYQLAESVPFSSDKLPEILNRYSLEAGSREANAMKETI----------------------------KLGKNIELLSNELGKEKKNPVFTIDREIQN--MGEEELVCHKMKYPYAVFLCHSIDRTAVYKVPLVSIDGTKANALAICHEDTSAWNPDHPAFWILKVKPGTVPICQFIVRDTLVWVS 221
247 4.000e-51UniRef50_Q7XES5 BURP domain-containing protein 16 n=9 Tax=Oryza TaxID=4527 RepID=BURPG_ORYSJ  ali  29  127IFFREQELKEGNVVRMPNELTTARSSFLPRSIADRIPF---KAEAVKSLFGLEPNTTLAKAVDETVAQCQSSPSKGETKRCVTSAEDMIDFAVAMLGDDIVVRSTVLPNGPGESIMIGKVKGINGGKITSSVSCHEYLFPYMVYYCHSVPKIRVYEAEIVQTKEKINSGVAICHIDTSAWNAGHPAFVALGGKPGQNKVCHWIFNGSMTWV. 339
248 5.000e-51UniRef50_A0A0Q3NM03 Uncharacterized protein n=3 Tax=Pooideae TaxID=147368 RepID=A0A0Q3NM03_BRADI  ali  33  532VFFFHNMLRPGSMITPTIPPTTSLPMFLPRHVASSIPFSTSRLADIIAM-FAPASLAMRREIRWTLDTCEHPRTPGQAARCATSLESLADVPASLLGTQDIRAFSEAPGTSALRSRYNVTALRKVGESEEIVTCHDLTYPYAVYYCHTANPTAAYMVTLQASQPAEMEALAVCHLDTSQWSPKNPFFELHSVKPGDVAVCHFLTKLSIIWV. 758
249 5.000e-51UniRef50_A0A2I0XJ99 BURP domain-containing protein 3 n=2 Tax=Dendrobium catenatum TaxID=906689 RepID=A0A2I0XJ99_9ASPA  ali  37  1.............MTLELSKSISMQPFLSVEMAKATPFSSTKLTKILGLFNITRVSIEAKAIQQTLEDCEEQPIEGEIKRCVTSLEDMADFVKAEIGNRDVNVIETTVKGGVHQQVYLIRSKEDMVEAKALVSCHPVSYPKAVYNCHTITNVEAYKVHLLGSNGVVVDAAAICHLDTSAWAPHYLGFKILKVKPGTEPICHFLPRGHLIFV. 204
250 7.000e-51UniRef50_A0A2G3CDG8 Uncharacterized protein n=10 Tax=cellular organisms TaxID=131567 RepID=A0A2G3CDG8_CAPCH  ali  36  187IFFLQDDLKMGKTVTLSFQKSNSPQNFFPKKAADSIPFSFKELQNLLQRFSLSENSPQAKSMEDALRICESSPITGETQYCATSAEGMLDFVHEIMGEKTQVKTLSTTTHTPHPQNYTIVDVPQEVSAPKMVMCHILSCDYTVFYCHHTDERKVSKVSLRNENGDTVESIAVCHLDTSEWDPSHVSFRVLGVLPGASPICHFFPSNDLVWV. 416
251 3.000e-50UniRef50_W9S3P4 Uncharacterized protein n=1 Tax=Morus notabilis TaxID=981085 RepID=W9S3P4_9ROSA  ali  36  56IFFTLKDMKVGQNIPIYFPKKDPSPHLLARYEASSIPFSLKELPNLLNFFCFSQDSPQAKAMESTLSLCEIEPIKGETKFCATSLESMLDFVRGAFGLEESFSVVTTTFLTKS-----------------------------MYYCHYQESNKVYKISLGGENGDKVEAVAVCHMDTSHWSRDHVSFRVLRIEPGTFPVCHFFPADHLVWV. 240
252 3.000e-50UniRef50_A0A2P4K028 Polygalacturonase non-catalytic subunit arogp2 n=3 Tax=Quercus suber TaxID=58331 RepID=A0A2P4K028_QUESU  ali  24  158.FFRESMLKKGKVIPMPINDKLPEMSFLPRSISSKQPFSTLKVSELKHIFHASDNLTMDTMIVKSLSEYKRASNPGETKRCMSSAEDMIDFAVLVLGRNIDILTTKNVNGSKQSIMIGSIEGINDGKVMDLVSCHQLLFPYLLYYCHSIPKVRVYQVDILDLNSKINNDVAIGHMNTSSWNPTQEAFLALGLALGRIEVCHWIFQNDLTWI. 370
253 3.000e-50UniRef50_A0A199V8D7 BURP domain-containing protein 6 (Fragment) n=2 Tax=Ananas comosus TaxID=4615 RepID=A0A199V8D7_ANACO  ali  50  43VFFLEKDLHPGSKMTLHFTRTT-SAALLPRRVSDSVPFSSAKLPEILSRFSVDAASARADAIKSTLAECEAPALAGEAKLCATSLESMVDFATASLGTRDLQAVSTAVGREGTPKQAYTVESVKKMPGSELVACHGMKYAYAVFHCHTTTAA-AYTVSMAGADGMRVEALAACHTDAAA--GVEEAFKKLNVKPGSVP.............. 238
254 4.000e-50UniRef50_A0A1D5VE71 Uncharacterized protein n=1 Tax=Triticum aestivum TaxID=4565 RepID=A0A1D5VE71_WHEAT  ali  60  222LFFLEKDLHAGKKMK-----------FLPRSEADAIPFSSEK------------------------------------KSCATSLESMVDFATSSLGTHVRAASTVVGKEGSPEQEYTMAGVRRAAGADQLVACHAEPYAYAVFACHLTRATRAYTVSMVGKDGTAVEAVAVCHANTAGWNPRHVAFQVLKVKPGGAPVCHFLPQDHVVWT. 386
255 4.000e-50UniRef50_UPI000B3F4B16 BURP domain-containing protein BNM2A-like n=1 Tax=Herrania umbratica TaxID=108875 RepID=UPI000B3F4B16  ali  37  75..FTVDDVHVGRKLSTFFSIRNPSPGILPGEIADSIPFSSSETSKILQFFSVSPESPKGKAIKDTLRKCEIEPAKGETKICATSSESMLEFLKNAFGESDFKLISTSHMTTPTLQSYTILEPPREIESPKKVACHPLQYLYAIYMWHYATETKIFKVPLVGDKGEKVDALIVCHMDTSAWSPKHTAFSLLGTKPG-IPVCHAFSEGHGVWI. 290
256 7.000e-50UniRef50_A0A2G5FAM1 Uncharacterized protein n=1 Tax=Aquilegia coerulea TaxID=218851 RepID=A0A2G5FAM1_AQUCA  ali  45  48.....KDLRVGKEMNLQFPRATKKSKFLVHEVAGKIPISSEALPELLNQFSIKPLTREAEAMKQAVYMCERPAQKNEEKLCATSIESMISFIKSKLGNHVVPMSTELND--TKEVNYIIAGVREIV----------------IFYCHQVHDTKAFKVPLVGKYGANVSTIAVCHMDTSNWNPKHLAFVHHKAKPG-VPICHFLTQNDVVWVS 235
257 7.000e-50UniRef50_A0A2T8JDP3 Uncharacterized protein n=2 Tax=Panicum hallii TaxID=206008 RepID=A0A2T8JDP3_9POAL  ali  31  516VFFFHDVLRPGSVITPTIPVTATLPSLLPRREADSLPFSSARLGDILAM-FAPASLTMEDEIRTTLDSCEHPPLPGEKAGCATSLESLARLPAALLGTRDVRMPVDPAGTTARRGRYNVTAVRKLSESPVAATCHDLTYPYAVFYCHTTNQVAAYQVTLAAEDGRAMEALAVCHLDTSQWTPRQPFLVAHNLKPGDVAVCHFLSKLSIIWV. 733
258 9.000e-50UniRef50_I1GYU9 Uncharacterized protein n=19 Tax=Pooideae TaxID=147368 RepID=I1GYU9_BRADI  ali  33  290VFFFHNMLRPGSMITPTIPPTTSLPMFLPRHVASSIPFSTSRLADIIAM-FAPASLAMRREIRWTLDTCEHPRTPGQAARCATSLESLADVPASLLGTQDIRAFSEAPGTSALRSRYNVTALRKVGESEEIVTCHDLTYPYAVYYCHTANPTAAYMVTLQASQPAEMEALAVCHLDTSQWSPKNPFFELHSVKPGDVAVCHFLTKLSIIWV. 516
259 1.000e-49UniRef50_M8D1Y6 Uncharacterized protein n=2 Tax=Triticinae TaxID=1648030 RepID=M8D1Y6_AEGTA  ali  31  249.................IGDKIPPGASLPRDIAGKIPFEPNAVSEVF---RVPLDTAMGKAVASTVAECERAPSQGETKRCATSAEDIVDFAVEMLGSDIVVHSTASTAGSGADIRLGNVTGVHGGKVTRPVSCHQSLFPYLVYYCHSVPKARVYEADITAADSKINHGVAICHLDTSDWSPAHGAFIALGGKPGKIEVCHWIFEGDMTWT. 441
260 1.000e-49UniRef50_A0A2I0KE21 Uncharacterized protein n=2 Tax=Punica granatum TaxID=22663 RepID=A0A2I0KE21_PUNGR  ali  51  85.FFLEKDLTKGNAVTLHFTKSTNLATFLPQQERNRP--NTKNLPEALKRFSVKPGSVEAELMATTIKECKEPGNEGEEKYCATSLESMVDYAESKLGKNMRALSTEI-KKKNRMQKYQIEEDVKKIMAEGS--------------------------KYVGEDGSEVKTLAVCHINTSQWNPKHLAFRVRMVKPGAVPVCHFLPQDHLVWYS 266
261 2.000e-49UniRef50_UPI00098DE98B LOW QUALITY PROTEIN: BURP domain-containing protein 12 n=1 Tax=Asparagus officinalis TaxID=4686 RepID=UPI00098DE98B  ali  26  414.FFRESNLRKGAAMRCRLRDKMPARSFLPRSISSKIPFSPATSGGYSRSRDATA--MGTRPXGDTVAECGRAPSRGETKRCAASAEDMIDFAVEVLGXNVVVRDTESTRGSKGSILIGDVXGVNGGKVTRSVSCHQSLFPYLLYYCHSVPRVRGRNIHDPETKQRINRGVAICHLDTSDWSAGHGAFVALGSSPGKIEVCHWIFEGDMTWAT 626
262 2.000e-49UniRef50_UPI000C042170 BURP domain-containing protein 3-like n=1 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C042170  ali  35  415..FTVDDVYAGRELSTFFSIRNHSPGFLPREVADSIPFSSSESLKILQFFSVSPDSPKGKTVKDTLRRCEIEAAKGEIKICATSSESMLEFLRNAFAPEADFKFITTTHPTMTTQSYTVLEPPREIKSPKTVACHPFPYLYSIYMCHDATETKVFKVPLVGDNGDKVDALIVCHMDTSAWSPKHVAFSLLGTNPG-IPVCHAFSEGHGVWI. 631
263 2.000e-49UniRef50_A0A2G2XAB2 Uncharacterized protein n=2 Tax=Capsicum TaxID=4071 RepID=A0A2G2XAB2_CAPBA  ali  36  263IFFLQDDLKMGKTVTLSFQKSNSPQNFFPKKAADSIPFSFKELPNLLQRFSLSENSPQAKSMEDALRICESSPITGETQYCATSAEGMLNFVHEIMGKKTQVETLSTTTHTPHPQNYTIVDVPQEVSAPKMVMCHILSCDYTVFYCHHTDERKVSKVSLRNENGDTVESIAVCHLDTSEWDPSHVSFRVLGVLPGASPICHFFPSNDLVWV. 492
264 3.000e-49UniRef50_A0A2N9IFH8 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9IFH8_FAGSY  ali  40  267.YFTMDDLVEGNIMPIHFPIQK-ISQFLPREEADSIPFSIPQLPNLLQLFSIPIDSPNARAMEDTLLNCEAAPMNGDQALC---------------------------------------YLIREIYAPKWVACHPLPYPYKVFFCHFVEKSKIFKVSLGGEDGHKVEAVAVCHLDTSDWNPDHIIFRQLGVKPGLSPICHFLPIHNLVWV. 437
265 3.000e-49UniRef50_A0A251RCT7 Uncharacterized protein (Fragment) n=1 Tax=Prunus persica TaxID=3760 RepID=A0A251RCT7_PRUPE  ali  47  133VFFLEKDVQPGTTMKYSLARNSTRATFLHRKTAESIPFSSTKLPDILNQLSLVK-----------------PILRGEERYCATSLESMVDFTTSKLGRNIQAISAEVERGATMLQKYTIKPGVKKLAGKRLI---------DVFYCHAMGKTRAYMVPLEGADGTSAKAIVVCHVDTSVWHPKNFSLQALNCKPGTVPVCHFLPDAHIA... 316
266 3.000e-49UniRef50_A0A1U8IFV6 BURP domain protein USPL1-like n=6 Tax=Gossypium TaxID=3633 RepID=A0A1U8IFV6_GOSHI  ali  36  168.LFTIDELHVGKKLPIFFPIKNHSPPLLPKQIADTIPFSSSQVSNILRFFSVSPDSPKGKAVQDTLAKCELGAAQGETKICATSLESLHGFLSNAFGPHVDFKFISTRHPTPLFQSYTVLESPEEIESPKKVACHPMPYLYAVYFCHDATEIKAFKLRLVGDTGDKVDAVVLCHMDTSGWSSDHVAFRMLGIKQGNT-VCHVFSQGNLVWIN 387
267 3.000e-49UniRef50_A0A1R3KL92 Uncharacterized protein n=1 Tax=Corchorus capsularis TaxID=210143 RepID=A0A1R3KL92_COCAP  ali  32  61.....HNFHVGRKLPIFFPIKDHSPPFLPKQISDSVPFSSSQLSNILQLFSLSPDSPKAKAVRDTLKKCELEAAQGETKICATSLESLLGFLRNVFGHDSDFKYISTKHPTPILQSYRVLEAPREVESAKKVACHPMPYVYAIYFCHDATETKVFKLKLVGDTGDIVDALVVCHMDTSGWSSNHMAFGMLGINPGN-PVCHVFSQGNIVWI. 272
268 3.000e-49UniRef50_UPI00077E71DB BURP domain-containing protein BNM2A-like n=3 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI00077E71DB  ali  32  78.FFTVDQLYVGKTMPISFPDFSSLPRFLQKREADIIPFTSSKLPQLLQFFSFPQESLQASQIETTLKTCELKPIKGETKFCATSFESLLDFVRDVLGKENHYKVLTTQHIKNPVAQNYTFLEISQVSSNKIVACHILPYPYAVFYCHSPEASKLFKIRVRGENGDKVDGLAVCHMDTSDWISDDM-FILLGVKRGN-PICHFFSPATLIWVS 291
269 5.000e-49UniRef50_Q93X11 A2-134 protein n=1 Tax=Megathyrsus maximus TaxID=59788 RepID=Q93X11_9POAL  ali  33  87LFFNEHDVLEGKTFPMYFPPSTAKLGFLQRRVVQEIPFTSARLADILALFHIPPGSSEAADVATTLGLCDAAAH-GDVVRCVTSPDDMVGRAAAVLGTSNMQVLAPSIPTGGMSLQPYTVRAVKPVDGSDFVGCHPELYPYSVYRCHTSVQTGTYVMEMQSSNGGALKLVAVCHRNTTSWDPEHVSFKVLASKPGGLPICHFVPYGHVIF.. 298
270 6.000e-49UniRef50_UPI00071C8CE5 BURP domain-containing protein 11 isoform X3 n=1 Tax=Brachypodium distachyon TaxID=15368 RepID=UPI00071C8CE5  ali  33  287VFFFHNMLRPGSMITPTIPPTTSLPMFLPRHVASSIPFSTSRLADIIAM-FAPASLAMRREIRWTLDTCEHPRTPGQAARCATSLESLADVPASLLGTQDIRAFSEAPGTSALRSRYNVTALRKVGESEEIVTCHDLTYPYAVYYCHTANPTAAYMVTLQASQPAEMEALAVCHLDTSQWSPKNPFFELHSVKPGDVAVCHFLTKLSIIWV. 513
271 7.000e-49UniRef50_A0A0D9WPL7 Uncharacterized protein n=1 Tax=Leersia perrieri TaxID=77586 RepID=A0A0D9WPL7_9ORYZ  ali  35  558VFFLEDNLRTGSVITPTIPRTTSLPPLLRRDVANSIPFSIDHLSDILSM-FAPASLAIADEIRWVLEKCNTSENKKNNKACATSMEDLVELPMSLLRTRHLQAFSPKMPASNEPRGRYAVTSLRRIVSGEMVTCHDMTYPYAVFYCHMTPATRAYTVALASENDGAMEAVAVCHLDTSGWSPEHPFLHATHAKPGDVEACHFLPKSSMVWV. 781
272 7.000e-49UniRef50_A0A1R3G8I4 Uncharacterized protein n=1 Tax=Corchorus olitorius TaxID=93759 RepID=A0A1R3G8I4_9ROSI  ali  40  166MYFFQEDLRAGRMMNLQLAQKGDRTPFLPQQIADSIPISTNKLPEILKNFSIKVESSYGKGVRITAI------------------------------------VTSAWKRFEKPIGYITINREMRNMGENNIVCHKTKYPYAVFLCHSIKKTTVYDVPLAGVDGTKVNAVAVCHKDSSAWSPNHIAFKFLKVKPGTVPICHFLRRDAIAWV. 342
273 1.000e-48UniRef50_A0A1D1XSF4 BURP domain-containing protein 3 (Fragment) n=1 Tax=Anthurium amnicola TaxID=1678845 RepID=A0A1D1XSF4_9ARAE  ali  35  44.YFLESDLHVGAKFEAMFQRPLNGDHFLPQRMANIIPFSSGKLPEILKLFSIAPNSFKAEKMKEVVQACERPPLLGVKNHCATSLESMVDFVTSSMHTVINAISPEPENETTSMEAYTVASFTAVMEATTSIVCHLQPYLYTVYHCHTDQSVMPYIVRLVQSDGFTAEATAMCHHDTTNWDPEFYGLRALNARPGGASVCHLLPVGDIAFV. 261
274 2.000e-48UniRef50_UPI000B779BA4 BURP domain-containing protein 9-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B779BA4  ali  34  393VFFIEKSLRLGDKLKHDFQKT-PSVPFLPKHIAKSIPFSEDKFTEILNLFSIKPGSVEATGIKGTLDVCLHRPKVEKENRCAQSMEDVVDFVVRELGSNDRMMKNDIEVPKGIQDYVITKVKKLVVPGNTAAACHRMSYPYVVYYCHHQQDIGHYDVTLVSPTGNAIQTTAVCHYDTYAWKPNVPALQYLGIRPGDAPVCHFSAINDMFW.. 606
275 2.000e-48UniRef50_UPI0008707333 BURP domain protein RD22-like n=1 Tax=Pyrus x bretschneideri TaxID=225117 RepID=UPI0008707333  ali  49  1.............MNWPFTRNTNTATFLTRRTAESIPFSSTKLLEILKHFSLEPSSVEANTIKETIQDCEAPGFKGKEKYCATSLESMIDFTTSKLGTSVEALISTEEEKTMFMHKYTIMPRVKKLEGEKAVLCYKQNYTYAAFYCHAIKQTRAYIVPLVGADGVKTKAVAVCHIDTSEWNPKNLDIKA....................... 178
276 5.000e-48UniRef50_K3XVU2 Uncharacterized protein n=12 Tax=Panicoideae TaxID=147369 RepID=K3XVU2_SETIT  ali  35  395VFFFHDVLRPGSIITPTIPPTTSLPPLLPRHEAETIPFSTKRFGDILTM-FAPASHAMADEIRWTLDTCEHPQTAGEKASCATSFESLAKLPAALLGIRNVHAFSDPAGTTARRGRYNVTAVRKLSDSPMVAACHDLTYPYAVYYCHTTNPAAAYLVTLAAEDGGAMEALAVCHLDTSQWTPRHPFLVAHNLKPGDAVVCHFLSKLSIVWV. 612
277 5.000e-48UniRef50_A0A2U1MQW7 BURP domain-containing protein n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1MQW7_ARTAN  ali  58  88.FFLERDMYQGHELNSHFPKENNPSTFLPRKVAETIPFSSNNLRELYTRFAIKPDSAESEVMKKTINQCEEKGMEGEKKYCATSLEAMVDYTTSTL----------------------------------------------VFYCHKTTTTRAYLVSLVGEDGKKAKAVAICHKYAAKLYPKDMAFKVLKVKPGSTPVCLFLPEDHIVWV. 254
278 5.000e-48UniRef50_A0A1D1XUX1 BURP domain-containing protein 3 n=1 Tax=Anthurium amnicola TaxID=1678845 RepID=A0A1D1XUX1_9ARAE  ali  41  1.............MNASFDRGLTGDRFLHREVAETIPFSSKEIQEILRRFAVPLGFALANKFEYTIRTCEMAPTPSEKKLCATPLESMVEFVISTLGTKDLQTLTTATRKGAPTQLYTVQSWTVVPTPNWMATCHVQKYPCTVFNCHGIPQTKPYVLKMVGEDGTLVEAATLCHLDTSEWSLTFYALRLLKVRPGETTVCHLLPDGDIVW.. 198
279 6.000e-48UniRef50_Q75G46 BURP domain-containing protein 8 n=7 Tax=Oryza TaxID=4527 RepID=BURP8_ORYSJ  ali  38  97VFFLEKDLFPGSKITLHFTRGGACAMVLLRGRADAIPFASEKLPEILTQLSVPAGSRAAEDMRTTLAECEAAGARDQAKHCVTSLESMVEFAAASLGTRDIRAVSTEVIGTGPRQEYTVEAVKPVVSGGNMVTCHGMPYAYAVFGCHTTTATAY-AVTLAGADGTRAEALATCHGD--AFPGVAEAYERVGVAAGSVPVCHIMPLGDMLWV. 312
280 7.000e-48UniRef50_A0A0V0HX01 Putative BURP domain-containing protein 17-like (Fragment) n=3 Tax=Solanum TaxID=4107 RepID=A0A0V0HX01_SOLCH  ali  34  117FFFLMDDLKIGKIMTLSFQTRRNLTSF-PKKAVDSIPFS------------------QVKSMENTLKICEDSPIKGEGKYCATSAEAMLDFVQGVIGEKTQIKTITTHDISPLLRRYTILDTPQQITTPKMVACHLLSSPYAVFYCHHTNKIKVFKVSLGEANGDRVEAMVVCHLDTSEWNPSHESFRSLGVLPGTSPICHFFSSNDLVWI. 318
281 7.000e-48UniRef50_A0A0E0L9V1 Uncharacterized protein n=2 Tax=Oryza TaxID=4527 RepID=A0A0E0L9V1_ORYPU  ali  33  364MFFFEDNVAPGSVLTTRILSTRSSSIFLHRNSSKHIPFSMKNFANIVSM-FAPVSVTMANDIASTLEACEHPAHGEDKARCAASIESFLDIVVSSLGDNVRALSPEVPMEGVPSLRYTVASATPVTNSRSILACHDLPYPYKVFFCHMAMQARAYQVSLVSEESGGVDALAVCHLNTSNWDPGHPFFKLMDVKPGETTACHFLGRGSIIWV. 580
282 8.000e-48UniRef50_A0A1D5YM71 Uncharacterized protein n=10 Tax=Triticeae TaxID=147389 RepID=A0A1D5YM71_WHEAT  ali  31  409VFFFHDMLRPGSVITPTIPLTTSLPARLPHGIAKSIPFSKERLSDIMAI-FAPASLAMAREIRWTLDTCDHPPLPGQKAGCATSLESLAELAASLHGTHNVRAFSAANLPPALRGMYNVTAVRKLSDSPEIVTCHDLTYPYTVYYCHTANPTSAYTVTLESVDGAMMEALAVCHLDTSRWSPKNPFFELHNLKPGDVAVCHFLTKLSIIWV. 629
283 1.000e-47UniRef50_K3ZJN2 Uncharacterized protein n=3 Tax=Poaceae TaxID=4479 RepID=K3ZJN2_SETIT  ali  41  31.FFLDKDLYPGSKMTLHFTLAAAGAA-LPRALADAIPFASARIQEILSRLPVPAGSPAAAAVRSTLAACEAAPVPGVEARCVTSPDSMADLAASILGTRNIRAATSTEGATTRQEYTMVSVRPLPVAGGDMVACHRMPYPYAVFACHATTAA-VYAVSLAGADGTKGEALAACHADAFP-GISQSAYEKLGVEPGSVPVCHFLPQDSMLW.. 243
284 1.000e-47UniRef50_M5XNR2 Uncharacterized protein n=1 Tax=Prunus persica TaxID=3760 RepID=M5XNR2_PRUPE  ali  50  106VFFLEKDVQPGTTMKYSLARNSTRATFLHRKTAESIPFSSTKLPDILNQLSVKPG--------------------GEERYCATSLESMVDFTTSKLGRNIQAISAEVERGATMLQKYTIKPGVKKLAGKRLIVCHKLSYP-------------AYMVPLEGADGTSAKAIVVCHVDTSVWHPKNFSLQALNCKPGTVPVCHFLPDAHIA... 282
285 2.000e-47UniRef50_A0A287WB15 Uncharacterized protein n=4 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287WB15_HORVV  ali  34  451VFFFRDMLRPGSMIIPTIPPTTSLPTLLPRHIADSLPFSTKRLSDIIAM-FAPTSLTMTRDIRWTLDTCEHPRTPGEEAGCAASLESLAALATSLLGTSNVRAFSEAPGTPALRGKFNVTAARRLSESPEIVTCHDLTYPYAVYYCHTSNPTAAYAVTLESVEGGTMEALAVCHLDTTQWSPEHPFFALHSVKPGDVAVCHFLTKLSIVWV. 671
286 2.000e-47UniRef50_A0A0E0E167 Uncharacterized protein n=1 Tax=Oryza meridionalis TaxID=40149 RepID=A0A0E0E167_9ORYZ  ali  36  468VFFFRDALRPGSVITPTIPPTTSLPAFLPRHVADAIPFSADRFADVLAM-FAPASLAMAREIRWALDTCGQRAAPGEKAGCATSLESLADLAASLLGTRDVSAFSAADLPTDTATTPARRGRYNVTSAREVVACHDLTYPYAVFYCHSTEPTAAYAVTLVAADGDKMEALAVCHLDTSRWRADNPFFVAHGVKPGEVSVCHFLTKLSIVWV. 710
287 2.000e-47UniRef50_F2D4N8 Predicted protein n=10 Tax=Triticeae TaxID=147389 RepID=F2D4N8_HORVV  ali  33  472VFFFQDMLRPGSLITPTIPPTTSMPALLSGDVADSIPFSAEHLSDIITM-FAPASLAMTREIRWTLDTCEHPRTPGQKAGCATSLESLAELPASLLGRRNIRAFSAMDLPMDAPGTPALRGKYNVTAARKVVTCHDLTYPYAVYYCHTSSPTAAYMVTLTSVEEDTSPAMAVCHLDTSLWSPKNPFFELHKVGPGDVAVCHFLTKLSIIWVS 694
288 3.000e-47UniRef50_B8BC35 Uncharacterized protein n=4 Tax=Poaceae TaxID=4479 RepID=B8BC35_ORYSI  ali  36  138...TRSAVRVGERLPFYFPAATTSAGFLPRRVADSIPFTAAALPAVLALFGVAPDTAEAAGMRETLRTCEWPTLAGESKFCATSLEALVEGAMAALGTRDIAALASTLPRGGAPLQAYAVRAVLPVEGAGFVACHDQAYPYTVYRCHTTGPARAYMVEMEGDGGEAVTVATVCHTNTSRWNPEHVSFKLLGTKPGGSPVCHLMPYGHIVWA. 350
289 4.000e-47UniRef50_Q5VN46 BURP domain-containing protein 10 n=7 Tax=Oryzinae TaxID=1648021 RepID=BURPA_ORYSJ  ali  30  111LHFLEDALKPGSIITPYITGIATRAPFLRRDIADSIPVSTKNFADILAMFS-PISLVMADGIQSALDTCEHHPIKGEERACATSIESVVEFAMSVLGTRDLRAFSPDVPPEGIMPGNMYKVVAVRTVAGDTVTCHTMRFPFAVFYCHAINPTRVYAVVLESEEDGKMEALAVCHLDTSRFDPKTPLFVEHNLRPGDASVCHFVSRDSVIWA. 333
290 5.000e-47UniRef50_A0A0V0HR40 Uncharacterized protein n=5 Tax=Solanum TaxID=4107 RepID=A0A0V0HR40_SOLCH  ali  37  58IFFLMDDLKLGKTLTISFPTAE-------RKAADSIPFSLKELPNLLRRF-----SNDAKSMEQTLRVCEDSPTKGETKYCATSVEAMRDFVQHILGEKTQIEALTTMKTHSHLQNYTILNHDPEDVGTKMVACHTMTSAYTVYYCHYIGKSKVFKVSLRNDNGDKVEAIAVCHLDTSEWSPSHVSLRVLGILPGTSPVCHFFPSHSLVWV. 272
291 5.000e-47UniRef50_A0A059D898 Uncharacterized protein n=1 Tax=Eucalyptus grandis TaxID=71139 RepID=A0A059D898_EUCGR  ali  27  12.YFRESMLRSGNMIRMPLRVKAPQRSFLPRSISSGLPFSTSKLAE--------------------LNQCEQAPIQGETKRCVSSVEGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKRLEGSKSSAPVACHETIFPYMVYYCHTFPTLRIYEADILDPKAKINHGIALCHMDTSIWSPNHVAFLALGSSPGQIEACHCVFGDYGVWT. 204
292 1.000e-46UniRef50_A0A0E0E163 Uncharacterized protein n=6 Tax=Oryza TaxID=4527 RepID=A0A0E0E163_9ORYZ  ali  36  875VFFFRDALRPGSVITPTIPPTTSLPAFLPRHVADAIPFSADRFADVLAM-FAPASLAMAREIRWALDTCGQRAAPGEKAGCATSLESLADLAASLLGTRDVSAFSAADLPTDTATTPARRGRYNVTSAREVVACHDLTYPYAVFYCHSTEPTAAYAVTLVAADGDKMEALAVCHLDTSRWRADNPFFVAHGVKPGEVSVCHFLTKLSIVWV. 1117
293 2.000e-46UniRef50_UPI000B776F97 BURP domain-containing protein BNM2C-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B776F97  ali  33  136LFFIEKNLQVGMKLPQDFQK-IQIRPILPKHIVQSFPFAYENFTDILSLFSIKFESEDAIDVKDTLHLCFKRPKTKEISTCAQSIEEVVDFVVRELGTNEVEVKTMMEVPNGRQDYMIKKVKKLDVPGNNAAVCHRIRYPYTVYYCHHQIGIGHYDVTLVSLAGTEVQTTAICHYDTYAWNPKSTPLRALGLKPGDSPLCHFAFLNDMFW.. 348
294 4.000e-46UniRef50_A0A2N9IKG1 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9IKG1_FAGSY  ali  33  87IFFTINDLHVGKTMSIKFTPQDPSPLFLAREEADSIPFSMTELPKLFQLFSISQASPQAKAIENTLKECESKPIKGETKFCATSLESMVDYVHDIFGSQTHCKILTTTRSSKSTQHNYTFQEVKEVSTSNVVACHTAPYPYAVYQCHSQKKKKVFKISLRGDEERVITAIFVCHMDTSAWPPNHISFRLLGLKPGT................ 289
295 5.000e-46UniRef50_A0A0E0HPE7 Uncharacterized protein n=1 Tax=Oryza nivara TaxID=4536 RepID=A0A0E0HPE7_ORYNI  ali  35  261VFFFRDALRPGSVITPTIPPTTSLPAFLPRHVADAIPFSADRFADVLAM-FAPASLAMAREIRWALDTCGQRAAPGEKAGCATSLESLADLAASLLGTRDVRAFSAADLPTDAATTPARRGRYNVTSVREVVACHDLTYPYAVFYCHSTKPTAAYAVTLVAASPAKMEALAVCHLDTSRWRADNPFFVAHGVKPGEVSVCHFLTKLSIVWV. 504
296 6.000e-46UniRef50_UPI000C04571E uncharacterized protein LOC111298675 isoform X1 n=2 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C04571E  ali  35  375.LFTIDELRVGKKLPLFFPIKDHSPPFLPKEVADTIPFSSSQAPTILQLFSVSPDFPKGKVVRETLRKCELEAAQGETKICATSLESLLGFLRKAFEPEVDFKTSHPTITTPTLQNYTVLEPPREIQSAKKVACHPLPYLYAIYFCHDASETKAFKLSLVGDSGDKVDAVVVCHMDTSGWSSDHISFRMLGIKQGNS-ICHVFAEGNMVWI. 592
297 6.000e-46UniRef50_UPI000B8AB7AA filaggrin-like n=1 Tax=Spinacia oleracea TaxID=3562 RepID=UPI000B8AB7AA  ali  33  891LFFLEEDLSLGKKMSLHFIKSTNPTTFLTRDMVEKLHFSLANLPEILKHFNLKQNSLEATMMDETLHYCE---DDKGGDKCCYSLESMVDFATSIIGKQV--KAISANIDKDIMMEYKVQGIKKLPCGAQAIICHKIPFPCAVFYCKKTEKMDVYITTLAGSDGSMLNAPAVCHRKSNSEDHTHSLSLQSESK--TCAICHFLLDDDVLWIA 1095
298 1.000e-45UniRef50_A0A2K1JM56 Uncharacterized protein n=9 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A0A2K1JM56_PHYPA  ali  28  131.FFLEENLAKGASMNLNLHDPIPKRSFLPKAVADTLPVTTSNLPKLRQTFNIGENTKMATIMGTAAYLCENPPLPGEERACPASVESMAKFVSSQLGRNATMLKTRGAPGNAPAQKVKDFTKHSVEEGKKIVVCHNLMFPSQLYYCHHVTGTKVVEASLAAADGYIIRGVAVCHLNTTMWGSEHPAFAALKIPRG-AEACHWTSQNDLIWV. 346
299 1.000e-45UniRef50_UPI000510E5A7 BURP domain protein RD22-like n=1 Tax=Pyrus x bretschneideri TaxID=225117 RepID=UPI000510E5A7  ali  53  3...................KYSTRAIFLSRKTAEWIPFSSHKMPEILNQFSLKSGSVEAMRINETIQECESQAIKGEEKQCATSLESMIDYATSKLG-----------------------RGGKRVDKNKVIVCHKLSYPYAVFYCHSFQRIRAYMVPLRGSDGTTAKVVAICHADTSRWNPK--ILQGLKVEPGTVPVCHFLSDAIL.... 166
300 1.000e-45UniRef50_J3MCU5 Uncharacterized protein n=3 Tax=Oryzinae TaxID=1648021 RepID=J3MCU5_ORYBR  ali  33  536VFFFEDSIAPGIVLTTRILSTRSSPIFLHRDTNDHIPFSMKNLTDILAM-FPRASRTMADDIVATLQMCEHPEMHGEKAGCAASIESFLELVVSLLGHDVRALSPEAPMEGVPSVRYTVASATPLTTSSSVLVCHDMPYPYKVFFCHAATPVRAYRMSLVVAGDGRMDALAVCHLNTSHWSPDHPFFRLKHVKPGQTTACHFLARGNIMW.. 753
301 1.000e-45UniRef50_A0A2P6SHL9 Putative BURP domain-containing protein n=1 Tax=Rosa chinensis TaxID=74649 RepID=A0A2P6SHL9_ROSCH  ali  53  52.FFQGKDLHLGKTVTLRFLKTSNKATLLPRRVAESIPFSSSKLPEILTYFGVKPKSVVAEIMKRTIEEF------------------------SKLGKYVQVYATEAENENK--QDYSIEITGVQSIGDRSIVCHKENYVYGVFYCHKFTTTRAYMLPLVGADGTKAKAVAICHTDTTSWNPKHLAFQVLKIKPGTIPVCHFLPTTGFLWAS 242
302 1.000e-45UniRef50_M7ZMF1 Uncharacterized protein n=3 Tax=Triticum TaxID=4564 RepID=M7ZMF1_TRIUA  ali  33  327IIFFEESLKPGSTITPYIPSATSGAPLLQREVANTIPMSTENFTDILAM-FAPVSSAMADDVWVMLDLCERPSVKGEKKTCATSVESMVEFAASVLGLRAFSSPDVPAEGVTSSRKYKVVAARRATESSKTMTCHGMSFPFVVFMCHAVNPTRTYEVTLESEDTSRIVLLAVCHLDTSEFDPMKMP---GHAKPGDAPACHFIPRDSVLW.. 541
303 1.000e-45UniRef50_A0A2N9GGG9 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9GGG9_FAGSY  ali  30  310.FFRESMLKEGNVIVMPIRDRMPKRSFLPRVILSKLPFSTLHLSEMKELFHAQEKSSMERVLINALAECERAPSLGETKRCVGSVEDMIDFAVSVLGHNVVVRSTENVSGSKQNVMIGSVKGINGGEVTNLVSCHQRMYPYLLYYCHSVPKVRVYQADIVESKAKINHGVAICHIDTSAWGPEHGAFLALGVQPRT................ 507
304 1.000e-45UniRef50_UPI0009C01C76 BURP domain-containing protein 2 n=3 Tax=Amborella trichopoda TaxID=13333 RepID=UPI0009C01C76  ali  35  83.LFLEEDLKVGMKKLFHFYKSNNASPFLSREVADTVPFSSAEIPHILQHFMLPPASSEAYEVRGTLSLCES---LEAKDKCLTSLEAMIDYTTPTSMDHNITMLHTNIEAPSVLLAYTVKKLVRKATKPNSAVCHNMPYPYAVYLCHYIGEGRIYQVSYEGEDGSMVEGIVSCHENLKNWSMPYQALPAGVKKADHMLACHTLPDTHIVWAS 294
305 3.000e-45UniRef50_Q67VD7 BURP domain-containing protein 9 n=6 Tax=Oryza TaxID=4527 RepID=BURP9_ORYSJ  ali  30  291LYFFEDNLAPGSVLITRILSARQSSIFLHRNNSKHIPFSMKNITDILTMFS-PVSATMADGIAATLQACEHTGMHGEKAKCATSIESLLDVVVSSLGTKLVRALTPAPMEGVPSLRYIVASATPVPNSQSMLACHDMLYPYKVFFCHTPKQTRLYQVSLVSGESGIDGLLAVCHQNTSDWDTGHPFFHFMDVKPGETTACHFFGRGSIIWV. 505
306 3.000e-45UniRef50_Q5Z5C9 BURP domain-containing protein 11 n=13 Tax=Oryza TaxID=4527 RepID=BURPB_ORYSJ  ali  36  73VFFFRDALRPGSVITPTIPPTTSLPAFLPRHVADAIPFSADRFADVLAM-FAPASLAMAREIRWALDTCGQRAAPGEKAGCATSLESLADLAASLLGTRDVRAFSAADLPTDAATTPARRGRYNVTSVREVVACHDLTYPYAVFYCHSTKPTAAYAVTLVAADGDKMEALAVCHLDTSRWRADNPFFVAHGVKPGEVSVCHFLTKLSIVWV. 316
307 3.000e-45UniRef50_A0A1D5Y8M0 Uncharacterized protein n=3 Tax=Triticum TaxID=4564 RepID=A0A1D5Y8M0_WHEAT  ali  30  413.FFRERELVAGNRMPMPIRDKMPPRAFLPRDIAGKIPFEPNAVSEVF---RVPLDTAMGKAVASTVAECERAPSQGETKSTASTAGSGAD------------------------IRLGNVTGVHGGKVTRPVSCHQSLFPYLVYYCHSVPKARVYEADITAADSKINHGVAICHLDTSDWSPAHGAFIALGGKPGKIEVCHWIFEGDMTWT. 598
308 4.000e-45UniRef50_A0A068TLF1 Uncharacterized protein n=1 Tax=Coffea canephora TaxID=49390 RepID=A0A068TLF1_COFCA  ali  36  122VFFLLDDLKLGKTMPIYFPDRDSSPPLLSETEADDIPFSSQQLPNLLRLFSFSPGSPQAIAMEDTLRQCEIAPIKGDTKFCATSYESMINFAREILGSEANIQVLSTIHLTRSV---------------------------------AGSESRVYEVSLYGENGERVEAIAVCHLDTSRWSPNHVSFRVLGIKPGTSPVCHFFPADNFVLVA 304
309 5.000e-45UniRef50_A0A1D5T2N9 Uncharacterized protein n=7 Tax=Triticinae TaxID=1648030 RepID=A0A1D5T2N9_WHEAT  ali  32  288MVFLEEALKPGSTIPCYIPSATLGAPLLRRDVADSIPMSTGNFIKILTM-FAPASNDMATKIWSTLDDCEHPAIKGETKACVSSVESMVEFAASVLGVSTYNLAAVPVDGVMTGRGYKVAAVTRVREAGDTMTCHRGSFPFAMFMCHAVNPTRVYSVTLEGEDGQRMEVLAVCHLDTSDFHPAKMPL---HVKPGDAPLCHFISRDSILW.. 506
310 5.000e-45UniRef50_N1R0P5 Uncharacterized protein n=3 Tax=Triticinae TaxID=1648030 RepID=N1R0P5_AEGTA  ali  33  243VFFFHDTLRPGSLITPTIPPTTSMPALLSGNVADSIPFTTEHLSDIITMFAPATMTREIREIRWTLDTCEHPRTPGQKAGCAPSLESLAELPASLLGRRNVRAFSAVDLPMDAAGTPALRGRYNVTAARKVVTCHDLTYPYAVYYCHTSSPTAAYMVTLEGASPATMEVMAVCHLDTSLWSPKNPFFELHKVRPGDVAVCHFLTKLSIIWVS 468
311 7.000e-45UniRef50_A0A0E0FQZ0 Uncharacterized protein n=2 Tax=Oryza TaxID=4527 RepID=A0A0E0FQZ0_ORYNI  ali  30  136LYFFEDNLAPGSVLITRILSARQSSIFLHRNNSKHIPFSMKNITDILTMFS-PVSATMADGIAATLQACEHTGMHGEKAKCATSIESLLDVVVSSLGTKLVRALTPAPMEGVPSLRYIVASATPVPNSQSMLACHDMLYPYKVFFCHTPKQTRLYQVSLVSGESGIDGLLAVCHQNTSDWDTGHPFFHFMDVKPGETTACHFFGRGSIIWV. 350
312 8.000e-45UniRef50_J3MDH5 Uncharacterized protein n=11 Tax=Oryza TaxID=4527 RepID=J3MDH5_ORYBR  ali  34  532VFFFHDALRPGSIITPTIPTTDSLPALLPRRVADSIPFSTDRFADIVAM-FAPASLAMAREIRWALDTCQHPPLPGEKAGCATSLESLAELAAGLLGTRDVQAFSAADLPTDGADTPAQRGRYNVTAVREVVACHDLTYPYAVFYCHTTKPTAAYAVTLVAATEARMEVLAVCHLDTSRWNPANPFFVAHSVKPGEVSVCHFLTKLSIVWV. 761
313 2.000e-44UniRef50_UPI0008706D95 BURP domain protein RD22-like n=1 Tax=Pyrus x bretschneideri TaxID=225117 RepID=UPI0008706D95  ali  53  105.......................RAIFLSRKTAEWIPFSSHKMPEILNQFSLKSGSVEAMRINETIQECESQAIKGEEKQCATSLESMIDYATSKLG-----------------------RGGKRVDKNKVIVCHKLSYPYAVFYCHSFQRIRAYMVPLRGSDGTTAKVVAICHADTSRWNPK--ILQGLKVEPGTVPVCHFLSDAIL.... 264
314 3.000e-44UniRef50_UPI000B798E3F GATA zinc finger domain-containing protein 14-like n=2 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B798E3F  ali  33 1229LFFSESDLSLGKKMNLHFMKSTNPTTFVSRDMVEKLHFSLANLPAILKHFNLKQDSLEATMMNETLQYCEDEQ---GGDKCCYSLESMVDFATATIG--SQLKAISANIDKDINMEYKVTGIKKLPCGAQAVTCHKIPFPCAVFYCQKRENMNVYIATLVGSDSSTLNAPAVCHKNSNLDDHAHLSFQ---FEPKTCAICHFLLDDDVLWIA 1433
315 4.000e-44UniRef50_A0A2K3P365 BURP domain-containing protein (Fragment) n=1 Tax=Trifolium pratense TaxID=57577 RepID=A0A2K3P365_TRIPR  ali  32  233.FFALEDIYVGNVMTLSFPIREY-ANFLPKKVADSIPFSKSQVPSLLQLFKLTKDSPQGEDLNDIIDQCESPLQKGETKACPTSLESMVEFVHSVIGADTKYNVLTTQWPTTSGQNYTILEVSKDIYAPKWVACHPRPYPYALYYCHYLDGSKLFKVLLKGQYGDIMDALAICHLDTS.................................. 412
316 6.000e-44UniRef50_UPI0004989C33 BURP domain-containing protein BNM2C-like n=1 Tax=Malus domestica TaxID=3750 RepID=UPI0004989C33  ali  36  183.FFTFDDLHKGMIMPLNFPNQ-EHSPFLPKDVADSIPFSTPQLPQLLQLLSIPQGSRDANNMAYALEQCEMKPINGETKLCATSLESMTDFVTKIIGAGVRFLSTTHPITSTSITQNYILKEPKEVLASKMVFCHPLAYPYAVFFCHHFEKTKFFKVRLRGENGDKVEAMAVCPMDTSDWVPNHNIF......................... 370
317 8.000e-44UniRef50_UPI00053F5B28 BURP domain protein USPL1 n=2 Tax=Beta vulgaris subsp. vulgaris TaxID=3555 RepID=UPI00053F5B28  ali  32  219VFFVEESLRLGTKLKHDFQKTK-KRPYLPKKIAQSIPFSVDKVAEILNLFSIKSKSAEATSIKETLGICQRPNVKKENRTCAQSMEDIVDFVVKELGTNDRMMRNNIEVPHGIQDYVVTKVKKLVVPGNTAAACHRMVYPYVVYYCHHQQDIGHYDITLVSPSGNAIQTTAVCHYDTYAWQPDVEALRYLGIRPGDAPVCHFSAINDMFW.. 432
318 2.000e-43UniRef50_A0A2K2DQJ3 Uncharacterized protein n=4 Tax=Brachypodium distachyon TaxID=15368 RepID=A0A2K2DQJ3_BRADI  ali  33  406.FFMEESLIAGSTVTPYIPSSSSGALLLQRDVAASIPMSMRSLTDILTM-FAPASHAMANAIWSALDVCESHPIRGEKMTCATSLESMVEFAASVLTGGIKRDLQAPIEGVMSARKYKVSAARRTTELSKSVTCHGMTFPFAVFMCHAVNPTRVYTVTLEKEDPDRMEVLAVCHLDTSNFNPRKMP---AHIKPGDAPLCHFIVRDSILW.. 624
319 2.000e-43UniRef50_UPI0005D31807 BURP domain-containing protein 3-like n=1 Tax=Amborella trichopoda TaxID=13333 RepID=UPI0005D31807  ali  34  5...............LHFPKSRCASPFLSRDDADAIPFSSAELPCILQRFSFPLASSEAIHVGVTLKWCES---LEAGEKCLTSLEAMIDYATPSAQDHNITVFRTIIYKDSVLQAYTVTKVQRVPAQASSTLCHNMPYPYVVYYCHYIGEGRIYKMKLEGEDGSTVDAIAGCHPHTKNWEPLSYWFQALLIGKKANQACHFLPDTHIIWA. 202
320 3.000e-43UniRef50_UPI000A2C3BC8 BURP domain protein RD22 n=1 Tax=Arachis duranensis TaxID=130453 RepID=UPI000A2C3BC8  ali  62  139..........................................................................KGEEKYCATSLESMVDFSTSKLGKNVDLVSTEISKETKLQSYKVAAGVKKINHGNKAVVCHKQNYPYAVFYCHKTETIMAFKVPLEGADGSRVKAAAVCHTDTSGWNPKHLAFQVLKVKPGT-PVCHFLPEDHVVWVS 275
321 6.000e-43UniRef50_G7KNK1 Dehydration-responsive RD22-like protein n=6 Tax=50 kb inversion clade TaxID=2231393 RepID=G7KNK1_MEDTR  ali  31  1.............MTLQFPVQK-IPHFLSKKEADSMPLSLSQLTRVLHLLSIPQDSPQAKYMRKTLEQCEAIIVKGETRMCVNSLESMLEFVGTIIGSEAKYDILTTSNPSPTTQKYTILEVSPDINAPKWVACHPIPYPYAIYGCHHITGSKVFKVSLVGENGDKMEALGMCHLDTSGWNPNHKLFKTLGIKSKNSSACHFFPVNHILWI. 204
322 9.000e-43UniRef50_UPI000D6919BB BURP domain protein RD22-like n=1 Tax=Ricinus communis TaxID=3988 RepID=UPI000D6919BB  ali  48  1.......................................SNKSHKILNYFSIKFSSKGAQIIKQKIEECEAPRIKGDDKYCATSFEPLVDFVTVKFGIKIQTFSTESEEENKKQ--WYTILKRITLVSDNQIICHKQRYPYAVFYCHTINATKTYMVPLVSVDGSKAKATVVRHLDTSTWNPKHFAFQVLKLKPEGPPICHFFNTDAIIWV. 170
323 1.000e-42UniRef50_A0A1D5S260 Uncharacterized protein n=4 Tax=BOP clade TaxID=359160 RepID=A0A1D5S260_WHEAT  ali  36  96LFFRESDMRVGRTMTVALP-AFDPAPFLPRKAAERIPF--GNLADALYRFGITPGSQEAARVGETLSACREAPLAGSRKACATSLEGVVLSATRMLATSRPLVAAASALPNSGLPRRTYTVQAIKPGGGGYVACHSRAYPYAVYECHMMEGSEAYVVSIRGGSGPTVDMAAVCHFDTSNWIPAHPAFKILGTHPGGSPVCHFLPYADLMF.. 308
324 2.000e-42UniRef50_A0A2K2DQJ8 Uncharacterized protein n=1 Tax=Brachypodium distachyon TaxID=15368 RepID=A0A2K2DQJ8_BRADI  ali  33  257.FFMEESLIAGSTVTPYIPSSSSGALLLQRDVAASIPMSMRSLTDILTM-FAPASHAMANAIWSALDVCESHPIRGEKMTCATSLESMVEFAASVLTGGIKRDLQAPIEGVMSARKYKVSAARRTTELSKSVTCHGMTFPFAVFMCHAVNPTRVYTVTLEKEDPDRMEVLAVCHLDTSNFNPRKMP---AHIKPGDAPLCHFIVRDSILW.. 475
325 3.000e-42UniRef50_A0A1B6P9K1 Uncharacterized protein n=1 Tax=Sorghum bicolor TaxID=4558 RepID=A0A1B6P9K1_SORBI  ali  34  252FLFLEDALTPGSKVAPYIPASSRGAPLLPRDVADSIPMSTKSFTDILRMFS-PVSRAMAESIWYSLELCEHPPIKGEKRGCVTSIESMVDFAASMLGTSDLRAFSSPSEGRNASKVYTVLAVRAITSPGDTMTCHGIPFPYKVFLCHALVPTKVYSVTVESDDDDGVEALVVCHLNTAEFDPMKMP---PRVKPGDAPVCHFLNNDDVLWA. 470
326 4.000e-42UniRef50_A0A2S3HF94 Uncharacterized protein n=1 Tax=Panicum hallii TaxID=206008 RepID=A0A2S3HF94_9POAL  ali  36  95LFFHEAQLRPGSTMTASLPAEV-ESAILPHDVAGKVPF--GNLRDVLATFNIPAGSAEAARVRDTLRRCRAPPLPGERKACAASLEGTVRSAVGMLGGAAWAAASALPRAGLPRGPYEVQAVA-PLDGDRYVACHKMPFPYAVYHCHMTGATRAYKVSLRGGDDAAVMMLALCHRDTSQWNPAHPAFEVLRTHPGGAPVCHFMPYANLVFV. 307
327 5.000e-42UniRef50_B9SZR7 Polygalacturonase, putative n=1 Tax=Ricinus communis TaxID=3988 RepID=B9SZR7_RICCO  ali  30  105LFFLPKSLFLGNKMQLNFPIPGNKVQLLPRKVADKFPLTSETVLQFSTMFNYSNE--QLSLANMTIQACSGSPISGERKSCVSSLESMVDVCVENVGQGVQAMMNEIAEEHNEIREYDVAGYNKLLGSSRPLACHQRAFPFAIFYCHVAKESEVYNVSLKRHDNVGSQESAVCHKDTHAWDVNHVAFKILKVKPGTS-VCHFIDSSSVIFMA 318
328 5.000e-42UniRef50_C5YRF0 Uncharacterized protein n=6 Tax=Panicoideae TaxID=147369 RepID=C5YRF0_SORBI  ali  34  90IYFHAAKLHPGSTMTLSFP-AEAETPILPHDVADKVPF--ENLSDVLSTFHISPGSAEAAQVEDTLSKCLQPPIAGEMKACTTSLESTVKAAMEMLGDYVWAATSALPRGGRLPRRQYVVQAVTPLDGDGYVSCHKVPFPYAVYQCHVTTGYGGYKVSLRGEEGPTVSLLAFCHFDTSCWNPMHPAFQILNTHPGSTPVCHFMSYGNLAFV. 321
329 6.000e-42UniRef50_UPI0009BF857A BURP domain-containing protein 5-like n=1 Tax=Amborella trichopoda TaxID=13333 RepID=UPI0009BF857A  ali  42  98LFSSEKDLKPGNHFTFDFGTKDPMPTFLPRRVADTLPFSSSKWPEILAHFSVWPSLVEAKAMKRTLTECEERPINGEVKHCTTSLESMIDFSTACLEKAVQIXXXXXXXXXRQPKKYAVGSAVHQVVAPKSVACHAQCYAYAVFYCHEFTTTRLYKVPLLSEDGTKVEAVAVCHFDTSAWNPNHVASKCSRSSLG................. 307
330 9.000e-42UniRef50_A0A2G2YCX9 Uncharacterized protein n=1 Tax=Capsicum annuum TaxID=4072 RepID=A0A2G2YCX9_CAPAN  ali  45  1.......................................MEKFSEILNHFSIDRKSKDAQTIKKTIELCEPEVKHKEKKMCVTSLESMVDFGLSLLRTNNILAITSEVQGETQNSQRYTIEKVQQIADGDSMVCHKLNYVYALHYCHFAGSTRTFMVSMIGDDGTKVKAVSVCHKDASFWNPKSLPFIVLKVKPGTTPICHFLNDDQIVFV. 173
331 1.000e-41UniRef50_A0A1U8H782 BURP domain-containing protein 17-like n=3 Tax=Capsicum TaxID=4071 RepID=A0A1U8H782_CAPAN  ali  29  388.FFRVSILKPGNTVHLNLENPFPHRSFLPSQIASKIPINSNHLQHLFPETFSSPFTKD--TTQTTIQSCNAPNLKGEVKKCAKSLEEMIEFSKTILKKNHLTALTTKSTEGSGKKLKI--DKFHKINAQKSVSCHEIFLPFATYICHLLSSTNIYSVDLVDTDAHVNTALVVCHMDTSSWPADHAAFKMLNFSPGKGEACHWMSQSDLIWV. 596
332 2.000e-41UniRef50_UPI00098B1F64 protein RAFTIN 1A-like n=2 Tax=Aegilops tauschii subsp. tauschii TaxID=169297 RepID=UPI00098B1F64  ali  34  78IFFYEAQLRPGSTMTMSFP-AEAEPPILPHDLAEKVPFA--NLSAVLTTFNIPTGSAEASHVAKTLSLCQSLPHAGEVRVCTTSLESTVRSAMNMLDHGMWTATSVLPAGGGLPRQLYEVQAVTKLHGDYFVGCHKMPFPYRVYQCHMTAGDKGYVVSLRGLVGGSPTALAFCHFDTSKWSPAHPSFQVLGTHPGT-PVCHFMPYANPVF.. 294
333 3.000e-41UniRef50_F6H2Z5 Uncharacterized protein n=2 Tax=Mesangiospermae TaxID=1437183 RepID=F6H2Z5_VITVI  ali  57  1.............................................................MKKTIQDCEQPALEGDSRFCATSLESLIDLSISKLGKNIKLISNGVEMGSQE----YELGVGVKVVADKSVVCHKQKYPYAVFYCHAIHKTRVYTLPFVGEDGTKAEVVASCHIDMSAWNPKHATFQVLKVKPGTVPVCHFLPRDDLI... 145
334 3.000e-41UniRef50_A0A0J8BEA5 Uncharacterized protein n=1 Tax=Beta vulgaris subsp. vulgaris TaxID=3555 RepID=A0A0J8BEA5_BETVU  ali  38  99.FFLEKDLSMGSKLSVHFRDSVNTRFPSPRLAQALPPFKSSSLSNNLRFFNAEPESDAAMFMNLTLNTCEHPPINGKKQYCATSLEKLVSYVTSTLGGSHDVRTISASPSGSPHRPYKVVGVREVATEKNMVACHRLGFPYAVYYCHQPKATTAYTVSLVDMNGVKSDAYAVCHSQTSEWSPEYVGFKILGAKPGT-HVCHFLQFHDVVW.. 315
335 3.000e-41UniRef50_UPI00098E3312 BURP domain-containing protein 16-like n=1 Tax=Asparagus officinalis TaxID=4686 RepID=UPI00098E3312  ali  28  202VYFRVSDLRQGNVIRVDFRDYFPQQYFLPRTLASKMPFNSA--AAIKKLFHIMPADTASKNVDFTIKHCNIPPNPGEIRQCITSAEDLIDFVIKGLETDDVEARSTESTSGCGRD--VLIGGVKLVSEGNALSCHQVEFPYLVYHCHVVSKTRAYEVEIVESKEKINHATVTCHMDTSMWTPTHEAFTALKSEPGKTEVCHFISKWDILWTS 413
336 5.000e-41UniRef50_J3MDH6 Uncharacterized protein n=3 Tax=Oryza brachyantha TaxID=4533 RepID=J3MDH6_ORYBR  ali  30  235MVFGEELLTPGSTFTPYIMPASARGPFLRRDVAESVPMSTKNFTDILKL-FAPVSSAMAGGIWGTLAMCERPPVRGERRACARSVESLVELAMSVLGTRDLRAFSSSEVPEMPRRRYSVVSVKTVTSSQESMTCHGVKFAHAVFYCHAINPTRSYEVTLLQQDGDENRALAVCHLDTSEFDPKKMP---ANLRPGEGAACHFISRDSIIWA. 460
337 5.000e-41UniRef50_A0A0K9PFQ5 Uncharacterized protein n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9PFQ5_ZOSMR  ali  42  1............................................................MMKESIEDCEIPALPNEKKLCATSLESMVDFTTSILETTNVKALSTVNKNDGLKQRYSITSSVLKGTRSRSVACHPSTFPYALYFCHTVHNTRTYSVSLVGENGSKIEAIASCHQETSDWSPEHISFRILNVKPGEGSICHFLAQDSIAWIA 154
338 5.000e-41UniRef50_U5CWG1 Uncharacterized protein n=1 Tax=Amborella trichopoda TaxID=13333 RepID=U5CWG1_AMBTC  ali  42  13LFSSEKDLKPGNHFTFDFGTKDPMPTFLPRRVADTLPFSSSKWPEILAHFSVWPSLVEAKAMKRTLTECEERPINGEVKHCTTSLESMIDFSTACLEKAVQIXXXXXXXXXXQPKKYAVGSAVHQVVAPKSVACHAQCYAYAVFYCHEFTTTRLYKVPLLSEDGTKVEAVAVCHFDTSAWNPNHVASKCSRSSLG................. 222
339 8.000e-41UniRef50_A0A0K9RKD8 Uncharacterized protein n=1 Tax=Spinacia oleracea TaxID=3562 RepID=A0A0K9RKD8_SPIOL  ali  34  103IFHKYDDVKIGNKMPLYFTNQGPPSSRL-----------MKNQHPNLNMVRFNPNSKSCKKPKE---------GSGEERSCVESLEEMRNFVVGLMGENVKPIST----PAGKWQMYTVSGVARTIKYQVTGCHKQDYLPFAVYGCHYIPKSQVRVVPLVGEDGTKLEAVSICHMDTSKWNGNHLLFMLLKAKPG-PPICHFIATDDIMWVT 289
340 9.000e-41UniRef50_A0A022RAD6 Uncharacterized protein n=5 Tax=Lamiales TaxID=4143 RepID=A0A022RAD6_ERYGU  ali  28  133.FYRLSALKEGKLIHLHLKESLPDRAFLPQQMASKIPLNYDAISRIFPDSDISGKTKE--TIQTTLAYCNAEAIQGETESCPKSLEEMVGFAKSTLGGKKVVALTTKNTR-GSNSAVRIGKIKEYGGGKKIVACHEAFLPFAAYFCHSLSSTRLYAVDVVVDRETVNTMLGICHMDTSQWPKDHVAFQILKFGPGEGEACHWFTKLDLAWIA 345
341 1.000e-40UniRef50_UPI000B794CB3 BURP domain protein USPL1-like isoform X2 n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B794CB3  ali  35  59IFFHIEDLKLGKKIPLYFPIKNSSPHIISKQESNLIPFSSTQIPKIREFFSFAQESPQAKAIKHTLMHCETPPLE-------------------------------------------VLEDPKEIVANKMVGCHPVPYPYAVYYCHQVNDNRLFVISLEGEDRQRIEAVAICHMDTSQWDPHHVSFRVLGIEPGAAPVCHVFPQDNLVWVS 231
342 1.000e-40UniRef50_A0A2C9W8E1 Uncharacterized protein (Fragment) n=2 Tax=Manihot esculenta TaxID=3983 RepID=A0A2C9W8E1_MANES  ali  51  72VYFLYQDLLPGKNMRIIFLKSTNGSNFLPRKIAESIPFSSNKFPEILNYFSIKSTSKEAQIMKQTIEECETPSMRGEDKYCATSLESLVDFVAAKFGQNVQVFSNEVEEENK-KQEYTILQGI-KMMGENNIICHKERYAYAVLYCHRIKDTKVYK........................................................ 225
343 2.000e-40UniRef50_A0A0K9RZY1 Uncharacterized protein n=2 Tax=Chenopodiaceae TaxID=1804623 RepID=A0A0K9RZY1_SPIOL  ali  35  99IFILEKDLTPGANLKIHFTKLSQAAPPFPNGIQSMPPFSSNNLPQLLRFFSVSSTSKAALIMNQTLARCEHPPINGLVQFCATSLKKMVTYVTQTLRDTQNIRAVSMGGVRTDALMPYRILGVNQIIAQSLIACHRLSFPYGVYYCHQPRGATTFSVSLVGNDGAKLDAYAMCHHQTADWSDDYIAFKVLAVKPGST-VCHFFQPDNVIF.. 312
344 2.000e-40UniRef50_UPI00098E4722 uncharacterized protein LOC109844603 isoform X1 n=3 Tax=Asparagus officinalis TaxID=4686 RepID=UPI00098E4722  ali  27  475VYFKVSDLRQGNIMRVDFRDYFPQQYFLPRTLASKMPFNSA--AAIKKMFHIMPADIASKNVDFTVKHCNMPPFPGEIRQCIMSAEDLIDFVIKGLETDNIEARSTESTRGCSRD--VLIGGVKLVSEGNALSCHQVEFPYLVYHCHVVSKTRAYEVEIVESKEKINHATVTCHMDTSMWTPTHEAFRALKSEPGKTEVCHFISKWDILWTS 686
345 2.000e-40UniRef50_B9SB79 Embryonic abundant protein VF30.1, putative n=1 Tax=Ricinus communis TaxID=3988 RepID=B9SB79_RICCO  ali  47  53.....................................................PESLQAKIIKLAVEECGLSEVKGEDRSCPTSLESLLDFTIAHIGNKVELLFNEIDKPT-RMQDYTITGV--KMVGENQVVCHKQRYPYAVYYFHSVNATKVYVASLAGADGTRAKAVAVCHSDTSSWAAGHLALLMLNLKPGEGPICHFIRSDTIVWTS 208
346 3.000e-40UniRef50_A0A1D1ZG70 BURP domain-containing protein 5 (Fragment) n=1 Tax=Anthurium amnicola TaxID=1678845 RepID=A0A1D1ZG70_9ARAE  ali  44  74IFFLEKDLLPGSKLRLDFSRSAPTVAFLPRGEAEAIPFATRKIPAILNHFSVQPSSAIAKGMKETLGLCEMKDSAADSRYCTTSLESMVDYATLVMRTHDVQAVSSVVAEEGVPKQDYEIPPRMKIAGDELVACHPLSYPYSVFYCHILPATKAYVVPLVGKNG................................................ 239
347 5.000e-40UniRef50_I3RZD9 Uncharacterized protein n=5 Tax=fabids TaxID=91835 RepID=I3RZD9_MEDTR  ali  61  1.......................................................................................MVDFTTSKLGKNVEAVSTEVNKESNLHQYTIASGVKKLGEKNKAVVCHKENYPYAVFYCHKTDTTKAYSVPLEGADGSRVKAIAVCHTDTSEWNPKHLAFQVLKVQPGTVPVCHLLPEDHVVWI. 124
348 8.000e-40UniRef50_A0A0D2RW01 Uncharacterized protein n=3 Tax=Malvaceae TaxID=3629 RepID=A0A0D2RW01_GOSRA  ali  47  73VFFFESKLRPGTKMNLKLTSKASKTAFLPRPVADSIPFSTKKFAQVLKYFSVQPRSAESKILKKTIEDCETPTIEGEEKFCATSLESFVDFGVSKLGKDIQLLSAELEKETQNP-EFSIGDQGVKLMGKSEIVCHKMDYAYAV-------------VPLVGADGTRATILAICHEDSSAWSVTPP........................... 244
349 9.000e-40UniRef50_UPI000B78837D BURP domain-containing protein 5-like n=2 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B78837D  ali  30  96IFIREDDLKPGTVHELYLGPSDLGPSFMTKDEVEKLPFSSTNLDQVLSAFSINPSSKQAELMQSTLTRCEDPLKFGH-HTCAPTLEDLVDFVDSEFHPSNPSMDVTVTPPMQVSQRYLITQVEKVVEGNPTIACHKAAFPYGAFMCHRMEGARAYRVELQSLDNDVDTSLVGCHHDTDNWSPSYAAFGLLGLKPGQ-PICHFLLADNMIFI. 315
350 1.000e-39UniRef50_A0A061GZC5 BURP domain-containing protein, putative n=1 Tax=Theobroma cacao TaxID=3641 RepID=A0A061GZC5_THECC  ali  55  212IYFFQKDLRPGKMVNLPLIKTKDMTPFLPFQVAKSIPFSSDKLS------------------------CERVAINGEEKYCATSLESFVDLGVSKLGKNIQLLSTELGKETENPFF----------------------------------TIQVYKVPLVGIDGTKADAVAVCHKDISGWNPMHSAFQILKVKPGTVPICHFLMRDTLAWVS 366
351 1.000e-39UniRef50_A0A2K3NDP0 BURP domain-containing protein n=2 Tax=fabids TaxID=91835 RepID=A0A2K3NDP0_TRIPR  ali  40  3...............................................................DTLKECESKPIKGEVKFCATSLESMLDFTQNILGSTNDYATSHLTKSSVTFQNYTIQENIVKISATKMVACHTMPYPYAVFYCHSQESNKIFRVSLVGDNGDKVEAMVVCHMDTSHWGNGHVSFQVLGIMPGSSNVCHFFPADNFIWIS 155
352 1.000e-39UniRef50_I1H1E2 Uncharacterized protein n=4 Tax=Brachypodium distachyon TaxID=15368 RepID=I1H1E2_BRADI  ali  31  356LFFLEESLTPGTTINLYIPSTSTGAALLPRAVADSIAMTTTSYPTILDTFSPVTRS-MAEDIWTVLDVCEQSAMGGEDMKCATSVESMAEFAASVHGLRAFSSPDVPAKGAMDGPRYKVTAARRATESMETMTCHDLSFPFPVFLCHSVNPTKVFEVTLEREEADRMEVLAICHLDTSAFEPEKMP---GGIKPGEATVCHFIGKDTILWAT 584
353 1.000e-39UniRef50_A0A022R9L6 Uncharacterized protein n=2 Tax=Lamiales TaxID=4143 RepID=A0A022R9L6_ERYGU  ali  27  48.FFRMSVLKNGNLVHLHLQETLPDRAFLPEKMASRIPLNYTAISRIFPDSDVTGKTK--ATIQTTLGYCNAAAIRGETKSCPRSLEEMVGFARVTLGKKVVALTSKSTVGSNSIAKIGKIKEYGGGAGEKIVACHEAFLPFAAYYCHLLTSTRLYMVDFVDRETGVNMMLGICHMDTSHWPKEHVAFKILKFGPGEGEACHWFTQLDLAWIS 265
354 1.000e-39UniRef50_UPI00090137DB filaggrin-like n=1 Tax=Beta vulgaris subsp. vulgaris TaxID=3555 RepID=UPI00090137DB  ali  32 1843LFFAEGDLSLGKKMKLHFRKSTNPTTFLSRDMVEKLHFSQTNLPEILKHFNLKEDSPQATIMNETLQYCE---DDKAGDKCCYSLESMVDFATSIIGKQV--KAISANIDKDIKMEYKVQGIKKLPCGNEAVVCHKIPFPCAVFYCQKAENMDVFIATLLGSEGSNLNAPAVCQKSTNSANQADS---------KNCAICHFLLDDDVLWIA 2040
355 1.000e-39UniRef50_A0A0V0HWB9 Putative BURP domain-containing protein 16-like n=2 Tax=Solanum chacoense TaxID=4108 RepID=A0A0V0HWB9_SOLCH  ali  28  116.FFRVSILKPGNTIHLNLVNPFPHRSFLPSQIASKISINSNHLQHLFPQTFTSPFTKDTTET--TILNCNAPTLKGEVKTCAKSLEEMIEFSKTTLKQNHLISLTTDSIQGSGQKL--KIEKFHKINSQKSVSCHEIFLPFATYFCHLLSSTNIYAVALVDLNTNVNTAMVVCHMDTSSWPADHPVFKKLNFSPGKGEVCHWMSQTDLVWV. 324
356 2.000e-39UniRef50_A0A0J8D1V4 Uncharacterized protein n=1 Tax=Beta vulgaris subsp. vulgaris TaxID=3555 RepID=A0A0J8D1V4_BETVU  ali  32 1744LFFAEGDLSLGKKMKLHFRKSTNPTTFLSRDMVEKLHFSQTNLPEILKHFNLKEDSPQATIMNETLQYCE---DDKAGDKCCYSLESMVDFATSIIGKQV--KAISANIDKDIKMEYKVQGIKKLPCGNEAVVCHKIPFPCAVFYCQKAENMDVFIATLLGSEGSNLNAPAVCQKSTNSANQADS---------KNCAICHFLLDDDVLWIA 1941
357 2.000e-39UniRef50_M1CKK0 Uncharacterized protein n=6 Tax=Solanum TaxID=4107 RepID=M1CKK0_SOLTU  ali  28  202.FFRVSTLKPGNTVHLNLVNPFPHRSFLPSQIASKISINSNHLQHLFPQTFTSPFTKD--TTKTTILNCNAPTLKGEVKTCAKSLEEMIEFSKTTLKQNHLISLTTDSIQGSGQKLKI--EKFHKINSQKSVSCHEIFLPFATYFCHLLSSTNIYAVELVNTNAHVNTAMVVCHMDTSSWPADHPVFKKLNFSPGKGEVCHWMSQADLVWV. 410
358 3.000e-39UniRef50_A0A0S3RK91 Uncharacterized protein n=4 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0S3RK91_PHAAN  ali  32  1..............................................................MDSVSECERAPSQGETKRCVGSIEDMVDFATGVLGSNVVVRTTENVKGSKGNVMVGRVNGIHGGRVTESVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKSKINRGVAICHLDTSSWSPSHGAFLALGSGPGQIEVCHWIFENDMTW.. 150
359 5.000e-39UniRef50_K4BW85 Uncharacterized protein n=2 Tax=Solanoideae TaxID=424551 RepID=K4BW85_SOLLC  ali  28  282......................................SNANVPK-NTFKSYGLSGNMEKMIDDALLECERSPSTGETKKCVSSIEDMIDFSTSVLGQNVVLRTTENIKGSKGDILIGSVKRTNDGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKINHGVAICHVDTSAWGANHGAFTALGSGPGKIEVCHWIFENDMNWA. 455
360 6.000e-39UniRef50_A0A0B2PS01 Dehydration-responsive protein RD22 n=1 Tax=Glycine soja TaxID=3848 RepID=A0A0B2PS01_GLYSO  ali  45  106..FFEEGLRPGTKLDAHFKKRENVTPLLPRQIAQHIPLSSAKIKEIVEMLFVNPEPENVKILEETISMCEVPAITGEERYCATSLESMVDFVTSKLGKNARVISTKAEKESN-SQKFSVKDGVKLLAEDKVIVCHPMDYPYVVFMCHEISNTTAHFMPLEGEDGTRVKA........................................... 271
361 6.000e-39UniRef50_M0SHP8 Uncharacterized protein n=3 Tax=Musa acuminata subsp. malaccensis TaxID=214687 RepID=M0SHP8_MUSAM  ali  31  352.....................................FKSYRNSSPSNRWLVEPGKFFREHDLR-RGSCERAPSRGETKRCATSAEDVIDFAVSVLGSDVVVRSTATTAGSNADVLIGRVSGANGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILASKQKINHGVAICHLDTSAWSPTHGAFVALGSAPGKIEVCHWIFEGDMTWT. 526
362 7.000e-39UniRef50_A0A096TM45 BURP6 n=5 Tax=Zea mays TaxID=4577 RepID=A0A096TM45_MAIZE  ali  28  1MLFTRKSLLPGTALPEGTRFSGDPQRFALRADADAIPFSYSQLDAILRMFRIPRGSKKAEQVADTLRACEAESS--DAHACATSEQAAADFAASSLGVRASDLVSTAVHGGKDATRYVVAPDGVTRIGKTAVPCHPMPYPYMVHYCHRPTDVEALRVELTGGDDGATIAIAMCHANTMSWDDRY--FQMLNATRGE-EICHFMPWNYVLW.. 217
363 7.000e-39UniRef50_C0PMA7 Uncharacterized protein n=1 Tax=Zea mays TaxID=4577 RepID=C0PMA7_MAIZE  ali  29  120MLFTRKSLLPGTALPEGTKFFLDPERFELRADADAIPFSYSQLDTILRMFRIPRGSKKAEQVAATLRTCEAESP--EAHACATSEQAAADFAASSLGVRASKLVVTTVHGGKDATRYGITRIGKAAGAAAVVPCHPMPYPYMVHYCHQPADVEALRVELTGGDGGVTTAIAMCHANTMNWDDRY--FQMLNVTRGE-EICHFMPRNYVLW.. 336
364 1.000e-38UniRef50_A0A2P5DU96 BURP domain containing protein n=4 Tax=fabids TaxID=91835 RepID=A0A2P5DU96_PARAD  ali  44  1.............................................................MEETLRDCGVKPINGEIKLCATSLESMVEFVRSILGSGVNISTTHPAMTTALTQNYTVLEVPIEVLAPKMVSCHPVPYPYAVFFCHYFGSTKVFQVSPGGNSGDNVEAVAICHMDTSDWDPEHILFQPLGVKPSTSPVCHFLPANHLVWV. 155
365 2.000e-38UniRef50_I1H1I5 Uncharacterized protein n=3 Tax=Brachypodium distachyon TaxID=15368 RepID=I1H1I5_BRADI  ali  31  75.FFLEEALTPGSTVTPNIPPMSTSGALLRRDAAASIPMSTENFTDVMKML-APVSRTMANDIWSTLDICENLPVKGEKKTCVTSLESMVEYVASILTTGGDTRNLRSFSSSSGRNKYKVSASRRATELSESATCHGMRFPYPVFMCHALNPTRVYTVTLVGGGPERMEVLAVCHLDTSGFEPEEMP---AHVKPGDAPVCHFIARDGIIWA. 298
366 2.000e-38UniRef50_A0A2H3ZKQ6 BURP domain-containing protein 3-like n=1 Tax=Phoenix dactylifera TaxID=42345 RepID=A0A2H3ZKQ6_PHODC  ali  44  11.FFLENDVHAGAKFTLHFPGTGSRPSLLPRQAADSIPFTTTKLPEILARFSIEPGSHEAKAIETTLEECEEPAKYCKIKKCATSLESMLDFTTSALRRDIHTVSTRLGREDSPEQQYSVVGVRKVTGSSDWVVCHVQPYAYTVFYCHTKGKSK........................................................... 163
367 3.000e-38UniRef50_A0A068UQX5 Uncharacterized protein n=1 Tax=Coffea canephora TaxID=49390 RepID=A0A068UQX5_COFCA  ali  27  25.FFEISLLKQGSMMHLNLENQLPQHSFLPSQIASKFSVVENDLQKLFPQSLKNPRTKDA--IQSTLIYCNTPPLKEEIQSCVKSLEDMVEFAKAAIGTNHVVPLTTKNTEGSGKEF--IVGHVEKLKFKKIVSCHEFFLPFATYFCHLLSKTEAYAVDVLEPKTKINTVMVICHMDTSNWSPNHVAFKLLKSSPGKVVACHWVFQNDLLFVS 234
368 4.000e-38UniRef50_A0A1S3U413 dehydration-responsive protein RD22-like n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A1S3U413_VIGRR  ali  54  1.........................................................................MKGEEKHCATSLESMVDFVTSKLGKNVHVTSTEVEIESKS-QKFIVKDGVKILAEEEIVACHPMNYPYGVFYCHQISNSTAHFVPLEGEDGSRVKAVAVCHKDTSEWDPNHIAFQALKVKPGTIPVCHFFPEAHLLWYA 139
369 4.000e-38UniRef50_A0A2K2A7J7 Uncharacterized protein n=1 Tax=Populus trichocarpa TaxID=3694 RepID=A0A2K2A7J7_POPTR  ali  52  190LFFLEKDMHPGKIMNLQFTENTNTATFLPRQVADSIPFSSDKLPEIYSEFSVKPGSMEAAEMENTIKECESPGIKGEEKYCATSLESMIDFSTSKLGKNVQAISTEVDNQTK-MQKYTIKTGVKKVAGDKSEPYQSAISFLRIMLC.................................................................. 334
370 7.000e-38UniRef50_U5DAU4 Uncharacterized protein n=2 Tax=Amborella trichopoda TaxID=13333 RepID=U5DAU4_AMBTC  ali  36  1..................................................................MICEEATITGRRKLCATSIKSMQDFVSSVLGPKANLQKLTTTIHHPSLQAYTVQEIHVQLPLSSITACHTMPYPYAAFYCHDVPKTRVFKVTLEGEDGNKIDAAAGCHLDSSHWDTDHAAFKVLGTKPGSEPVCHFLTKDTMAWVS 150
371 7.000e-38UniRef50_A0A2P5W0H1 Uncharacterized protein n=3 Tax=Malvaceae TaxID=3629 RepID=A0A2P5W0H1_GOSBA  ali  27  54.LFTVDELHTGKILPIFFPNKDPSSTSLPKKIADSIPFSSSKLPQILQLYSIAPGSSLAKSMTDTLPKCEHAPGITNPRPCATSFQSMVDFVSGAPQDTKFITTTHPTMSTSSLKNYKVLESPNEIKSSRKGACHPMLYLYAVFFCQYDESERVFKVSMI-----ISMTAAVCHMDSA-----RAALLNLMDKQGKSPMCHFCSAGDLIW.. 273
372 9.000e-38UniRef50_UPI00098DE65B LOW QUALITY PROTEIN: BURP domain-containing protein 6-like n=1 Tax=Asparagus officinalis TaxID=4686 RepID=UPI00098DE65B  ali  46  64...LEEDMLSGTKVKMHFMRTTSGATFLSRQAATTIPFSSASLPAILTHFSVNPNSVTASHSRKPYTSAEKPAIAEENKYCATSLESMVEYATSTLGTRHVSALSTVMSKEGAPDQEYVLSRVKKMSGSNFVACHARKYPYAVFYCHTVQGITAYQVSMVGEDGTTVEAVAACHT..................................... 237
373 9.000e-38UniRef50_A0A1U8MN61 BURP domain protein RD22-like n=6 Tax=Gossypium TaxID=3633 RepID=A0A1U8MN61_GOSHI  ali  52  1.........................................................................MRGETKYCAASLETFVDSGVSILGKNIKLLSNEIGDETKNPSFKIGNGVRTV--GGNEVVCHKMTYPHAVYLCHSIVGTEVYKVPLVSDDGTKAKAMAVCHKDTSAWSPNHIAFKILKVKPGTVPICHFLGRDTLVWVS 137
374 1.000e-37UniRef50_A0A068UQK8 Uncharacterized protein n=1 Tax=Coffea canephora TaxID=49390 RepID=A0A068UQK8_COFCA  ali  26  123.FLRISLLKQGSMVHLPLENQLPQHSFLPSQIASKISIAENDLQKLFPQSLKNPQTKDA--IQSTIVYCNTPALKDEIQSCVKSLEDMVEFAKTATGNNHLVALTSKNTKGSGKDL--IVGQMKKLKFGKTVSCHELFLPFSTYFCHLLSKTEVYAVDVLEPKTKINTVTVICHMDTSDWSPNHVAFKVLKTSPGQSEACHWISQNDLIFIS 332
375 1.000e-37UniRef50_UPI0009AA3F87 uncharacterized LOC100279974 isoform X1 n=1 Tax=Zea mays TaxID=4577 RepID=UPI0009AA3F87  ali  31  289VFFFHDVLRPGSVITPIIPPTITLPPLLPLREADALPFSTGRFADILAMFAPTTSDAMGEEIRSTLDTCETRPLPGEKAACATSLESLARIPAVLLGTRNVRMPTDPAGTSAKRGRYNVTAVQKLSESLTAAACHDLTYPYVVFYCHTTNPAATYLVKLAAQDGGTMEALVVCHLDTSLWSPRHPFLVAHSLKPGDDAVCHFLSKLSIVWV. 508
376 2.000e-37UniRef50_K4CM37 Uncharacterized protein n=6 Tax=Pentapetalae TaxID=1437201 RepID=K4CM37_SOLLC  ali  46  1...................................................................MCEEPAGNGEVKHCATSLESMIDFTLSHLGTNKIIAISTEVEKETPEVQTYTIEKVEEKANGKGVVCHKVAYPYAVHFCHDVGSTRTFMVSMVGADGTKVNAVSVCHEDTASMNPKALPFQLLNVKPGDKPICHFTLDDQIA... 142
377 3.000e-37UniRef50_A0A0K9S3N0 Uncharacterized protein n=4 Tax=Spinacia oleracea TaxID=3562 RepID=A0A0K9S3N0_SPIOL  ali  36  83LHFLESDLSNNNNRVLLYPRFSNNGHFLPRTIIEQFPLKSTNLPSILSRFSITPNSPATGVIKHTVELCEYAAN--DDNVCVTSLESMVDFVQSTKHGVIRAYSTTIQDKNGNLQPFRIVKVKRLSNSNSTVSCHKAQFPFAVFLCHQRVATVAYMVTLEGVRDKRIEAATACHMDTSEWDPLFPALVALKVAPGT-PVCHFLNQKSVLWV. 305
378 7.000e-37UniRef50_A0A2N9GRY7 Uncharacterized protein n=2 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9GRY7_FAGSY  ali  28  140........................................................SMERMLVNALAECERAPSLGESKQCVGSVEDMIDFAVSVLGHNVVVRSTKNVNGSKQNVMIGSVKEINGGEVTNLVSCHQIMYPYLLYYCHSLPKVRVYQADIVESKAKINHGVAICHLNTADWSPKHEAFLALGFSPGQIEVCHWFYENEMAWTT 297
379 7.000e-37UniRef50_UPI000B784160 BURP domain protein RD22-like n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B784160  ali  45  97.......................................................................SSNEGGAFITGSNHESLVDIVVAKFGKNVQAFSNEAEKENKKQE--YTILKGIKMMGENHMVCHKERYAYAVFYCHRIKTTKVYKVPLMGVDGSKAEAAVVCHMDTSAWNPYHYAFQILNVKPGGPSICHFLNSDAIVWIS 235
380 9.000e-37UniRef50_M8BY14 Uncharacterized protein n=1 Tax=Aegilops tauschii TaxID=37682 RepID=M8BY14_AEGTA  ali  39  1.............................................................MEATLRPCESPTIAGESKFCATSLEALVERAMGVLGTRDIRPVTSTLPRAGAPQWYTVRVVRPVEGGPVFVACHDEAYPYTVYRCHTTGPSRAYMVEMEGARGGNAVTIAVCHTDTSLWNPEHVSFKLLGTKPGGTPVCHLMPYGHIIWA. 152
381 9.000e-37UniRef50_A0A2K1J8Q1 Uncharacterized protein n=3 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A0A2K1J8Q1_PHYPA  ali  30  93.FFVEPALVVGEKMNLNLRDSIPLRPFLNDEDARLIPLTVPNLPAIFDIFSVDRRSKQAAMIATSAYLCESPALPGEARACLTSLEAMSDFVAKQMGSNVQLLATKAPPTHKAPVTIVDFHTSSIEQAAHIVVCHNIMFPAQAYYCHAVRRTKVIEASLKAPSDYTIHAVGICHLDTSLWASSHPAFAALNV-PNGAEACHWTVEGDLVWV. 310
382 1.000e-36UniRef50_G7JZ00 Polygalacturonase non-catalytic protein n=3 Tax=Medicago truncatula TaxID=3880 RepID=G7JZ00_MEDTR  ali  24  26LFFREKMLNEGVVMQMDIRDKIHKRQFLPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKRMKE------------------TSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVELTLQRIKINQAVDVCHIDTSSWSRSHPAFLELGSAPGEIEVCHWIFQNDISWTA 222
383 1.000e-36UniRef50_A0A072TQU4 Embryonic abundant-like protein n=4 Tax=NPAAA clade TaxID=2231382 RepID=A0A072TQU4_MEDTR  ali  38  60..FFEHDLYPGNKISLGFNKSNDKSQPLKWDKNEIQPFGSLTWLKKTSEERNQPFGVAAWWLQKTSEECIRPSAIGEEKYCALSLKSMMNFAISKLGTNIKVISSS----FAQNQDQYKVDEVKKI-GDKAVMCHRLNFKDMVFYCHQVNATTVYMVLLVASDGTKAKALTICHHDTRGMNPD-VLYELLKVKPGTIPICHFVGNKAIAWV. 301
384 2.000e-36UniRef50_A0A2K3MK57 BURP domain-containing protein n=1 Tax=Trifolium pratense TaxID=57577 RepID=A0A2K3MK57_TRIPR  ali  37  1...........................................................MAMEDTLRQCESKPIKGEVIFCATSLESMLEFTQNVVGSNSEVQVLTTFHKTKTFQNYTIVEILMEIPKTKMVACHSLPYPYAVFYCHSTEKNRVFRVSLVGENGDIVEAMAVCHLDTSQWAPNHVSFQILGVTPGSSSVCHFFPAQDFIWI. 160
385 2.000e-36UniRef50_A0A1D6KM64 BURP domain protein RD22 n=3 Tax=Poaceae TaxID=4479 RepID=A0A1D6KM64_MAIZE  ali  31  98VFFFHDVLRPGSVITPIIPPTITLPPLLPLREADALPFSTGRFADILAMFAPTTSDAMGEEIRSTLDTCETRPLPGEKAACATSLESLARIPAVLLGTRNVRMPTDPAGTSAKRGRYNVTAVQKLSESLTAAACHDLTYPYVVFYCHTTNPAATYLVKLAAQDGGTMEALVVCHLDTSLWSPRHPFLVAHSLKPGDDAVCHFLSKLSIVWV. 317
386 2.000e-36UniRef50_A0A2P4KSG2 Burp domain-containing protein 3 n=1 Tax=Quercus suber TaxID=58331 RepID=A0A2P4KSG2_QUESU  ali  52  8.FFIETDLRPGKKMKLHFTNTANGATFLPHQVAKSIPLSSDKLPEILNRFSVKENSVEAKVIKSTIKMCETPGTAGEDGVCATSLESLVDFSVLKLGKNVQVLSTQVPKETKKQE--YRITGVHRINANKGVVCHKQNY......................................................................... 143
387 2.000e-36UniRef50_A0A0E0G4Z6 Uncharacterized protein n=5 Tax=Oryza TaxID=4527 RepID=A0A0E0G4Z6_ORYNI  ali  29  371MLFLMKKLHPGAVLPEGTKVAAAAPRFIYKDEADAVPFDLRAMDAILAMFGILPGSDKAAQVANTLRACGELTAAGGGGECATSREAVLDFAASALGTSAPRAVTTLVHGKEPRRYVVAAGGVARIGGDAVVACHPMPYPYEVYYCHRPADAVALRVDLHAVAGGGATAVAVCHVNTTTWDSAY--FELLKASRGDA-ICHYMPQGYVLWLA 597
388 3.000e-36UniRef50_K3XY30 Uncharacterized protein n=1 Tax=Setaria italica TaxID=4555 RepID=K3XY30_SETIT  ali  30  102LLYPETTFTPGSKINLYIDRAAAHSAWLRPDSADSIPISRKNFNDIVTM-SAPVSNSMAHGMWSTLSSCEHPREVGEQKACVASVESMHGFAASALRTNDLRALSTEEGISSPSHMYRVAAVRVVTAGVDTVTCHSMSFPFALFYCHAVNPTRIYEVTLQKEETAVVRALAVCHVNTSGFDPTLKYWVKLGVKPGEAPVCHFLTRGDVLWA. 333
389 4.000e-36UniRef50_M8BTD4 Uncharacterized protein n=2 Tax=Aegilops tauschii TaxID=37682 RepID=M8BTD4_AEGTA  ali  48  94LFFLEKDLYTGKKLTLHFMATSAGERFLPRSEADAIPFSSGQVPEILSRFSVKPNSPEAAGMARTLHVCEAPAAEGEKKWCATSLESMVDFATSSLGTRHVRAVSTVVGKDGTPRQEYTLTGVKRAGDDQLVVCHVEPYAYAVFACHLTQATRAYSVPTDTD.................................................. 262
390 6.000e-36UniRef50_G7L8H6 Embryonic abundant-like protein n=7 Tax=Trifolieae TaxID=163742 RepID=G7L8H6_MEDTR  ali  38  30LLFLENDLYPGKKMSGL------------QKLSNIQPFRTIGWLPI-EKATQQSGNVVEKESYSLDEICGGPPAIGEDKFCATSSESMKEFAISKLGAKIKSYS----GYFAKNQDQYVVEEVRKI-ADKGVMCHRMNFEKVVFYCHQVNASTTYMVPLLASDGSKVNALAACHHDTRGMNPN-LLDEVLKVKPGTIPVCHFVGNKAVAW.. 220
391 6.000e-36UniRef50_V4SCA0 Uncharacterized protein (Fragment) n=2 Tax=Citrus TaxID=2706 RepID=V4SCA0_9ROSI  ali  35  43IFFTLSDLKVENKMALYLPDHSNYAHFLPREEADSFPFSFKQLPYILELTFILRDSPQAKAMEDTLRMCKTDPIKDEIKTCATSLESMLDFAGSILGSETSFKTVTTKSTSNTFQNFTILEV-QEISAPKMVA------------CHYMSHTQAYNPN----------------------NPDHLSFQILGLKPGTIPVCHYFPTDHLVFV. 220
392 6.000e-36UniRef50_A0A096QAE9 BURP domain protein RD22 n=3 Tax=Andropogoneae TaxID=147429 RepID=A0A096QAE9_MAIZE  ali  29  300MLFTRKSLLPGTALPEGTKFFLDPERFELRADADAIPFSYSQLDTILRMFRIPRGSKKAEQVAATLRTCEAESP--EAHACATSEQAAADFAASSLGVRASKLVVTTVHGGKDATRYGITRIGKAAGAAAVVPCHPMPYPYMVHYCHQPADVEALRVELTGGDGGVTTAIAMCHANTMNWDDRY--FQMLNVTRGE-EICHFMPRNYVLW.. 516
393 8.000e-36UniRef50_UPI000904D13F BURP domain-containing protein 5-like n=1 Tax=Nicotiana attenuata TaxID=49451 RepID=UPI000904D13F  ali  41  1............................................................MIEKIVKLCEEPAGTRETRYCATSLESMVDFISSHLGTNNILAMSTEVEKETPEAQTYIIEEVKEKTNGKGIVCHKAAYPYAVHVCHDFGNSRTFKVSMVGADGTKVNAVSICHENTAAMNPKALPFQLLNIKPGGKPFCHFILDDQVAVV. 151
394 8.000e-36UniRef50_A0A0D9YQS4 Uncharacterized protein n=2 Tax=Oryzinae TaxID=1648021 RepID=A0A0D9YQS4_9ORYZ  ali  28  107MLFLMKKLHPGAVLPEGTKLALPAPRFIYKDKGDAVPFDLRAMDAILAMFGILPGSDKAAQVADTLRACGELTAGGGGGECATSREAVLDFAASALGTSAPRAVTTLVHGREPRRYVVAADGVARIGGDAVVACHPMPYLYEVYYCHRPADAVALRVDLHAVAGGGATAVAVCHVNTTTWDSAY--FELLKASRGDA-ICHYMPQGYVLWLA 332
395 9.000e-36UniRef50_UPI00053F7D6A BURP domain protein RD22 isoform X1 n=2 Tax=Beta vulgaris subsp. vulgaris TaxID=3555 RepID=UPI00053F7D6A  ali  36  89LHFLEKDLSNNSELHV-FPRNSGKANFVPRSIVEGFPLKSINLPIILAQFFIGPKSAAAKVIKHTVQLCEHAA--EDDNVCITSLESMIDFVQSKLGQNRIRAFSTTMEGSNLQPYHMVEVKKVSKNKNSVVTCHKAEFPFAVFLCHQRPATVPYMVTLEGADRTRIEAATVCHMDTSEWDARFPGLVALKATPGT-PVCHFLNQGSVLWV. 311
396 1.000e-35UniRef50_A0A2K3JWV0 BURP domain-containing protein n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2K3JWV0_TRIPR  ali  56  1.......................................................................................MVDFATSKLGSNNVEAISTEVEKESNELQEYVIAKGVKKLGDNNVVCHTENYPYAVFYCHKTDTTKVYYVPLEGVDGNRVKAIVVCHTDTSEWNPKHLAFQVLKVEPGTVPICHFLPQDHVVWFS 131
397 2.000e-35UniRef50_UPI000C1D2DF9 BURP domain-containing protein 16-like n=1 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1D2DF9  ali  25  125.YFRISTLTEGNKFHLDLEEKIPNRAFLPQEIASKISISRKSITKLFPKSFELSKNSMEM----TLSYCNAQALKGEIKNCPKSLEEMISFAKFALGKNKLLVLASERTRRSEFLIRKIKKFDRQ----KVVACHEVYLPFAAYFCHSTSSTQIYAVDLIEPETRVSTVIAICHMDTSAWPANHVAFKILKFSPGEGEACHWISNIDLAWIA 330
398 3.000e-35UniRef50_A0A0D2V9M3 Uncharacterized protein n=6 Tax=Malvaceae TaxID=3629 RepID=A0A0D2V9M3_GOSRA  ali  28  48.LFTMDELHVGQKLPIFFPIRNYPPFFLPPKYQNIIPF--IKPAAMFNLFKVPPSSPKGKAFLGTLYSCDSI-NGETTKICATSLDSMLGFVKKAFGPDVDFKFITTTHPTLTFQNYTVLEPPVEIVSVKKVPCHPFPYFYAIYFCHTDLNTRAFKLRLVGDSGDEVEAVIVCHLDSKNLSSDHLVFRMLGVEKGSSY-CHVFRQGDILWI. 265
399 4.000e-35UniRef50_A0A2P5R4T4 Uncharacterized protein n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5R4T4_GOSBA  ali  35  202...........................................DEYFDTWRSKPSSNNGNGEFDDRDHDFSARHGNEEEALKESKESFIDLSIATLGKDIQLLSNQLSKETNNPLF--TIARGMQDMGENELICHKERYPRAVFLCHSINKTTVYKVPLLGRDGTKANALAVCHKDTSAWSPKHKAFQILKVKPGTVPICHFLAKDTLAWVS 368
400 4.000e-35UniRef50_UPI000989DDD3 BURP domain-containing protein 4-like n=2 Tax=Aegilops tauschii subsp. tauschii TaxID=169297 RepID=UPI000989DDD3  ali  28  169MLFLKKNLHIGTTLPEGTMFARDGA---PKSIHSSTPLESKYLTTILSYFKLPHGSMKANQVADTLHSCGKPADKEEPHMCFSSREAMARFATRELGVSSARAAITRIHGHENPSSMYVVEQITQLNS-NVVPCHPMDFPYEVFYCHRPKQVQSLRVQLKDLKDGRVTAIAMCHMNTSDWDTQY--FELLDGERGE-PICHYMPTDYIMF.. 374
401 5.000e-35UniRef50_A0A096RQV1 BURP domain protein RD22 n=12 Tax=Poaceae TaxID=4479 RepID=A0A096RQV1_MAIZE  ali  33  91IFFHEAELRPGSAMALSFPAEVD-TPILPHAVAAAA--PFANLTAVFATFGVAGGSAEAEHVRDTLRWCEAPPRPERVAACATSLESTVRSATRMLGDGVWAAATSARLRAGLPRGRYVVGAVAPLHGDQLVACHRVPFPYAVYQCHMTKTDRAYVVSLRGRGGPVDDVLAFCHRDTSGWSPDHPAFRILRVRLGT-PVCHFVPYGNPVF.. 305
402 5.000e-35UniRef50_Q0E1Z0 BURP domain-containing protein 4 n=4 Tax=Oryzinae TaxID=1648021 RepID=BURP4_ORYSJ  ali  27  253MLFLMKKLHPGAVLPEGTKLALPAPRFIYKDKGDAVPFDLRAMDAILAMFGILPGSDKAAQVADTLRACSELTAAGGGGECATSREAVLDFAASALGTSAPRAVTTLVHGREPRRYVVAADGVARIGGDAVVACHPMPYLYEVYYCHRPADAVALRVDLHAVADGGATAVAVCHVNTTTWDSAY--FELLKASRGDA-ICHYMPQGYVLWLA 478
403 5.000e-35UniRef50_Q6I5B3 BURP domain-containing protein 1 n=21 Tax=Oryzinae TaxID=1648021 RepID=BURP1_ORYSJ  ali  39  64VFFLEKDLFPGSKMTLHFTRATAGAALLPRGRAESVPFASERLPEILSQLSIPAVSPTADAMWSTLAECEAARLAGHKHYCATSLESMVEFVASSLGTRDVHAVSTEVISTTPRQAYRVEAVRPVVPGGDMVACHGMPYAYAVFGLHGLKGAGGGRVP...................................................... 229
404 5.000e-35UniRef50_B9S812 Dehydration-responsive protein RD22, putative n=1 Tax=Ricinus communis TaxID=3988 RepID=B9S812_RICCO  ali  28  18.LFTPDDIYVGKVLPIYFP-VRDRSSYLPEMVDSSITYPLSDLPKIFQPLSVLDDSL--LKIQPDADKCEIQPDEAETKVCIRNMESISEFISRVFGSEGSFRIVETKQSTASLQEYTVVEDPREIQGPRKVFCHPMS---DAFYCHCSIETTVLKVSLGTENGDKMEAIGVCHMHTSGQNPDDILHHLLKIKPGTTPVCHFLPDGHFVWV. 230
405 6.000e-35UniRef50_A0A2T7DZR4 Uncharacterized protein n=2 Tax=Panicum hallii TaxID=206008 RepID=A0A2T7DZR4_9POAL  ali  28  106LLYPESAFTTGSNINLYIDRAAAHNAFLHRDVADSIPMSTENFTDIATMSSPS-----------TLSSCERREVVGEQKACATSVESMHKFAVSALGTSGLHAFSTPEEGIGSPSHIYKVAAVRAVTAHNTVTCHSMSFPFALFYCHAVNPTRTYEVTLQKDEDTVVRALAVCHVNTSGFDPTLNYWVKLGLKPGEASVCHFLTRGDVLWT. 328
406 7.000e-35UniRef50_UPI000B423DDA BURP domain-containing protein 4 n=1 Tax=Sorghum bicolor TaxID=4558 RepID=UPI000B423DDA  ali  28  127MLFTRKSLLPGTVLPDGTKFGGGDGRFVLRADADAIPFSYSQLDTILRMFRIPRGSNKAEQVAATLRTCENESPSPDPHTCATSEQAATDFAAASLGVSASELVVTVVHGRKDAARYVVAPDGVKAGAAAAVPCHPMAYPYMVHYCHRPADVEALRVELTGLGGDGATAIAMCHANTTSWDARY--FEMLNATRGE-EICHFMPRNYVLW.. 353
407 1.000e-34UniRef50_UPI000B79825E BURP domain-containing protein BNM2A-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B79825E  ali  29  15VFIHYNNLKVGLNIPIYFGGAFPSPRFLPKEKADLMPFSSLDLPFLLRVFGFAPRSPQARAMDNTLKLCGMK-MHHETKKCVSSLESMLDFIHETFDSFSNSNS--------------------DKNDQSLKSCIVRHYP--------EPENRVFEVSLRGDDGTSMDAIVTCHMNTSSFDPNHVAFHILGFKPGDFPVCHFLPSNDLVWV. 199
408 2.000e-34UniRef50_A0A1D5ULI8 Uncharacterized protein n=3 Tax=Triticum aestivum TaxID=4565 RepID=A0A1D5ULI8_WHEAT  ali  30  71MLFLERDLFAGALLPAYVRRTSSPGPVISSTTSPVPPFRYSSFEKILKFYNVTHGSKQAGRISETLQFCEEAGDKE-PHACATSVAAARDFAATVLGTKEPRAVTSILHGRTQPLRYVVPNGIASVGGDAVVPCHPLAYPVEVFYCHNPSNVQALRVQLVGQEDPSVTAIAVCHKDTSYWDEAY--FMMLNGSRGE-PICHFMPANYLLW.. 284
409 4.000e-34UniRef50_Q06765 ADR6 protein n=18 Tax=50 kb inversion clade TaxID=2231393 RepID=Q06765_SOYBN  ali  39  72.FFYKEDLHPGKTMKVQFSK----PPF-------QQPWGVGTWLKEIKDTTKEGYSFEELCIKK-------EAIEGEEKFCAKSLGTVIGFAISKLGKNIQVLSSSFV---NKQDQYTVEGVQNL--GDKAVMCHRLNFRTAVFYCHEVRETTAFMVPLVAGDGTKTQALAICHSNTSGMNHQ-MLHQLMGVDPGTNPVCHFLGSKAILWV. 257
410 4.000e-34UniRef50_UPI000D629121 BURP domain-containing protein 5-like n=1 Tax=Ziziphus jujuba TaxID=326968 RepID=UPI000D629121  ali  35  3.....................................................PGSPEAQLAERTLRTCAEEPIKGEQKTCATSIESFIEFASSMYGVDFRAMKTTHLGKPVSVYQNYTFLDIKEVHSPIMVACHIMDYPYIVYMCHSQ-TSRVYQIKIVGQEGDALNAIAVCHIDTSQWAPDHVSFKLLGVKPGTVSICHFFGPHNPVWV. 165
411 4.000e-34UniRef50_UPI00098E78D7 polygalacturonase non-catalytic subunit AroGP2-like n=1 Tax=Asparagus officinalis TaxID=4686 RepID=UPI00098E78D7  ali  29  78ICFREGDLKQGNAMPVDFRGLFPSQHFVPRSVASKMPFTSA--DDVKRMFHV--SSATSKGMEKTVKLCNRATSPDEQKKCISSAEDMIDYVIQTLGDNIEARSTESTRGCGSDILIGDLKVLNGGKFSDVVTCHQMQFPYLVHYCHSIAKTRVYEVEILDAKERVNHAIATCHM-----------ISMGNPEPGNIVVCHFISPWDMVWTA 279
412 5.000e-34UniRef50_A0A0D3D2C3 Uncharacterized protein (Fragment) n=2 Tax=Brassica oleracea var. oleracea TaxID=109376 RepID=A0A0D3D2C3_BRAOL  ali  32  38MFLNFNDLKLGAKLLVYFNKNRTLPPLLTRQEADLIPFTKSKLDFLLNHFSISKESPQGKAMKKTLVRCNYKEIEGEYQFCGTSLESMLDLAKKTIASNADIKVMTTNTTSYALHNYTFVETPKELVGIKMLGCHKMPYPYVVYYCHHKSGARVFEVSLVTDDGQRVVGPAVCHMNTSMWNADHVAFKV....................... 262
413 9.000e-34UniRef50_W1P4S4 Uncharacterized protein n=1 Tax=Amborella trichopoda TaxID=13333 RepID=W1P4S4_AMBTC  ali  34  82.FFHMKDLKVGNKLDLYDMGDTEPTSPLPRHETDSLPFAFASLTDILHHCSIPPDSPEAKKVAR-------------NFHIWPKAKPQVLATTAYNGDNRPPLL----------QSYVVKEIPVRVTPPSVPVCHPMTYPYALFFCHAVTKTTALMVKLEDEDESKIDFAAACHLDPSDWDTNHVSFKVLGITPGTEPVCHFTPKNIL.... 267
414 2.000e-33UniRef50_A0A0Q3H6B5 Uncharacterized protein n=2 Tax=Brachypodium distachyon TaxID=15368 RepID=A0A0Q3H6B5_BRADI  ali  26  1MLFLKKSLHVGTVLPEGTMFARAEA---PKSNHFSVPLESKYLATILSHFKIPDDSMKAKQVADTLRSCGEQGKKKEPHMCFSSREAMARFATRALGVSRTRAAITRIHGHETPNSMYVVEHITQV-SNNVVPCRPMDFPYEVFYCHRPKEVQSLTVQIKGLKDSMVTATVICHMNTSGWDKQY--FQLLGGERGE-PICHYMPHNYIMF.. 205
415 2.000e-33UniRef50_UPI000B7860AA BURP domain-containing protein BNM2A-like n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B7860AA  ali  27  91..FTPGDVYLGKVMPIYFPIQDPSPRFFTKN------FISYPFPDLPKIFKHYPQAKISVELEK----CEIQPAQAGTKVCARDMESLNNFIHRSFGSEGELKIVETKYPTALLQDYIVLEDPQEIEGQGMVVCHPVS---EALFCHYVEAIKLIKVSLRGDSGDKVEAITICHMDSSRWEHDHIVFRLLQVKPGSS-VCHFLPAGHLVWV. 291
416 2.000e-33UniRef50_A0A0K9QS10 Uncharacterized protein n=3 Tax=Chenopodiaceae TaxID=1804623 RepID=A0A0K9QS10_SPIOL  ali  30  5IFIREDDLKPGTIHELYLGPSDLGPSFMTKDEVEKLPFSSTNMEQVLSAFSINPSSKQAKLMQSTLTRCEDPTKFGH-HTCAPSLEDIIDFVDSEFHPSIPVLGVTVTPPMQISQRYLITQVEKVVEGNPTIACHKAAFPYGVFMCHRMEGARAYRVELQSLDNDVDTALVGCHHDTEN---SYAAFGLLGLKPGQ-PICHYV......... 213
417 3.000e-33UniRef50_A0A1U8F4R2 BURP domain protein USPL1-like n=5 Tax=Solanoideae TaxID=424551 RepID=A0A1U8F4R2_CAPAN  ali  36  57............................................................GAEDIHKQQEISDSKGETKYCATSAEAMLDFVQGFMGERTQIEALSTTHSTTPLQNYTILDVPQEVAAPKMVACHMMPCAYTVFYCHYSDKRKVFKVSLGNENGDRVEAIAVCHFDTSEWSPSHASFQVLGISPGTSPVCHFFPSNDLAWV. 217
418 5.000e-33UniRef50_A0A061DX97 BURP domain-containing-like protein n=3 Tax=Malvaceae TaxID=3629 RepID=A0A061DX97_THECC  ali  41  92..............................KVADSIPFSSSKLPEILQLFSIPPGSSLAKAMEDTLQKC-VAPGKGETKTCATSLESMVDFVS-------------------------------EIKSFRKVACHPMPYPYAVFFCQYDEDTRVFKVSMIGENTDKVDAAAVCHMDSAS-----AALLNLTDKQGKSPMCHFFSAGDLSWV. 239
419 6.000e-33UniRef50_A5C2S5 Uncharacterized protein n=1 Tax=Vitis vinifera TaxID=29760 RepID=A5C2S5_VITVI  ali  22  340.FFRESMLKEGNVMVMPIRDRMPERSFLPRVIASKLPFSSSRXQELKDIFHAXDNSAMEWTSARELRVAARPAVRGFGRGHDSSPRSWGRRGSEKTETTRGVRESSESRRDQAVRGFGRGHDRLRRLGPAWVKAEGDGGGSQRDQRRKIPKVRVYEVDIVERKEKMNKGVAICHIDTSAWSQSHGAFVALGSSPGLIEVCHWIFENDMTWTT 572
420 8.000e-33UniRef50_A0A165ZJ30 Uncharacterized protein n=1 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=A0A165ZJ30_DAUCA  ali  33  113VYHRYEDVRIGTKMPLLFTNLGPPSASLLK----------RPQPEALNNSQILCGSAVSRE----------------QAVCVTSLEEMLEFVYQHMGENVKPVSA----LPGKWQEYTITAMPKVIARKMTGCHKSDSRPFAVYECHNVPDTLIRVVPLLGRDGMKVQAVSVCHMNTSSWNAHYVAFYLLKAKPG-IPVCHFLATDDIIWLA 294
421 1.000e-32UniRef50_A0A0C9RW97 TSA: Wollemia nobilis Ref_Wollemi_Transcript_9416_1755 transcribed RNA sequence n=2 Tax=Araucariaceae TaxID=25664 RepID=A0A0C9RW9  ali  27  136.FFRLEEITVGQKLDFHENDVSQNVSFLPHKIAQKIPFNSHQLAFIVQAFSIPSTGSDIQKMATTLKVCEAPPSSIETKTCAISVESVAEFLSTVIGPSVVDGIASSTRILSNRVVTVMGANLVASSAIKHVACHSMVFPSKVYYCHYVKDTNMYVVNLKDEKGVSEKVVAECHMNTKPYPRESLALIELKIKPGEGEFCHWVPSDTLLF.. 354
422 2.000e-32UniRef50_B9SHB2 Polygalacturonase non-catalytic subunit AroGP2, putative n=1 Tax=Ricinus communis TaxID=3988 RepID=B9SHB2_RICCO  ali  30  382.....................................................................ERAPSRGETKRCVVSAEDLIDFATSVLGRNAVVRTTQSINGAKKDILIGRVKGINGGRVTKSVSCHQSLYPHLLYYCHSVPKVRVYEAEILDANSKANIGTAICHLDTSAWSSNHGAFLALGSSPGRIEVCHWIFENDMTWT. 525
423 3.000e-32UniRef50_A0A251REI7 Uncharacterized protein n=1 Tax=Prunus persica TaxID=3760 RepID=A0A251REI7_PRUPE  ali  46  1.......MRPGSTMKFQFPRNSNTATFLPRESAQSIPFSFNKLPEIFNHFSVKPTSVEAKTIKQTIEECEAPGIKGDEKYCATSLESMVDFSTSKLGTRNVEAVSTEVLETMSMHNYTTMPGLKKLAGDKVVVCHKENYPYAMLCF.................................................................. 142
424 3.000e-32UniRef50_UPI000B76FA34 BURP domain-containing protein BNM2A-like n=3 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B76FA34  ali  32  1.............MPIYFGGAFDAPRFLPKKKADMIPFSSQHLSFILNYFSFQPESPQAKAMEFSLKKCEEIPHAKGAKKCVTSLDSMIDFKSSTTNNGGQLFTSPLLKSAKVFQPYTIIEQLKRVPSPKMTACHMLTYPYAVYYCHNPPENRVYEISLLGEDGTRVNAVASCHMNSNAFDAN............................. 181
425 3.000e-32UniRef50_A0A2T7E3V7 Uncharacterized protein n=1 Tax=Panicum hallii var. hallii TaxID=1504633 RepID=A0A2T7E3V7_9POAL  ali  31  607VFFFHDVLRPGSVITPTIPVTTTLPSLLPRREADSLPFSTARLGDILAM-FAPASLTMADEIRTTLDSCEHPPLPGEKAGCATSLESLARLPAALLGTRDVRAFSGDMPVDPAGTT-------------------------ARRGRYNVTAVAAYQVTLAAEDGRAMEALAVCHLDTSQWTPRQPFLVAHNLKPGDVAVCHFLPKLSIIWV. 794
426 3.000e-32UniRef50_A0A287WB18 Uncharacterized protein n=1 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287WB18_HORVV  ali  33  42.................................................MFAPTSLTMTRDIRWTLDTCEHPRTPGEEAGCAASLESLAALATSLLGTSNVRAFSEAPGTPALRGKFNVTAARRLSESPEIVTCHDLTYPYAVYYCHTSNPTAAYAVTLESVEGGTMEALAVCHLDTTQWSPEHPFFALHSVKPGDVAVCHFLTKLSIVWV. 214
427 4.000e-32UniRef50_A9RG26 Uncharacterized protein n=2 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A9RG26_PHYPA  ali  26  132..FNRDDINKGNEIALPLHDSFPTVAFLPHSMAQKMPLSSARMTQVLDTLNIRHDSNMAKMMSQTVDQCEMQEQSKGAHKCVTSLEDMKNFVSSSLPLDKRQRSSSIRGTGEMRSKNMRWKVMDVKRYDSAVVCRNRVFPYAVFECHDISNTHIYSVEMQGNDGARSSAVVACHE-----NAEHMSKHTEPVK-----ACHWVT-DSLIWV. 337
428 4.000e-32UniRef50_A0A2C9V169 Uncharacterized protein n=3 Tax=Crotonoideae TaxID=235631 RepID=A0A2C9V169_MANES  ali  28  125.LFTLHSLHKGKIIPIYFPIDDYSSTF--------PPFMSKKIADSSTLKNPQK-----------VCEITSSDDQEHTRFCATSLKSMLDYIRSDEGFKVVETIHYPSLSTALLQDYVVVETVQEIEGSGKVFCHPMN---RSFYCHDDEHARVFKISLGGENGDQVEAIAVCHMNTSQLSPDLIAFRLLPVKPG-SPFCHFLPAGHLVWV. 316
429 5.000e-32UniRef50_UPI000B7844A7 BURP domain protein RD22-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B7844A7  ali  31  2..........GNKLPLLFTNQVPPSAILLK----------------------KPQQNMVNSLANSSASCGSTVPEEQHAW-VTSLEAMMDFAIRMLGTNLRPIST----PAGKWQLYTVTGAARTITDKVCGCHKKDSLPFAIYGCLYKMNTKVRVVPLVGDDGTILEAINVCHMNTASWDSNYLLFRLMKAKPGT-PVCHFLATDDIVWIT 175
430 9.000e-32UniRef50_A0A1D5XAG4 Uncharacterized protein n=2 Tax=Triticinae TaxID=1648030 RepID=A0A1D5XAG4_WHEAT  ali  28  315MLFLKKNLHIGTTLPKGTMFARDGA---PKSVHASTPLESKYLATILSYFMIPHGSTKAKQVADTLRSCGKPVDKEDPHMCFSSREAMSRFATRELGVSGARAAITRIHGNETPSSMYVVEQITQLN-NNVVPCHPMDFPYEVFYCHRPKEVQSLGVQIKGLKDGRVTAIAMCHMNTSNWDTQY--FELLDGKRGE-PICHYMPTNYIMF.. 520
431 1.000e-31UniRef50_A0A199UQT5 BURP domain-containing protein 3 (Fragment) n=2 Tax=Mesangiospermae TaxID=1437183 RepID=A0A199UQT5_ANACO  ali  47  46LFFLEKDLRPGKKMTLHFPEVASGPAFLPRKEADAIPLSVEKLPKVLGRFGIQPDSVEARWMRKTARECQEPAVGGEKKFCATSLESMVDFSTSSLETRDVRAVSTTVAKKG.................................................................................................... 157
432 2.000e-31UniRef50_Q45NP1 Embryonic abundant protein-like protein (Fragment) n=4 Tax=IRL clade TaxID=2233839 RepID=Q45NP1_MEDSA  ali  34  69.LFFEHDLYPGKKMILGNAQSNEKRPFTTQGVTDSIWLANK-------------------ERQSLDDFCNSPTAKGEHKHCVSSLESMIDHVISHFGTKKVKAISSNFVQNQDQ----YEVEEVKRVGDNAVMCHRLNFEKVVFNCHQVQATTAYMVSLAATDGTKVNALTVCHHDTRGMNPE-LLYEALKVDPGTVPVCHFIGNKAAAWV. 258
433 2.000e-31UniRef50_A0A287TH88 Uncharacterized protein n=1 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287TH88_HORVV  ali  28  147MLFLKKNLHVGTILPEGTMFARADA---PKSVNFSTPLESKYLTTILSHFMIPRGSTKAKQVADTLRSCGKPVDKEEPHMCFSSREAMSRFATKEIGVSSARAAITRIHGNETPNSMYVVEQITQLN-NNVVPCHPMDFPYEVFYCHRPKEVQSLRVQLKGLKDGMVTAIAMCHMNTSDWDTQY--FELLDGKHGE-PICHY.......... 344
434 2.000e-31UniRef50_G3LKI1 AT1G49320-like protein (Fragment) n=7 Tax=Capsella TaxID=183499 RepID=G3LKI1_9BRAS  ali  34  1.............LRVYFHKNDFQPPLLTREQADLIPFTKSKLDFLLDHFSISKDSPQGKAIKATLGHCDAKEIEGEHKFCGTSLESMVDLVKKTLGYNVDLKVMTTKLMSYGVHNYTFLETPKELVGIKMLGCHRMPYPYAVYYCHHKGGSRVFEINMVTDDGKKVVGPAICHMDTSMWDVDH............................ 182
435 2.000e-31UniRef50_A0A1R3G8M7 Uncharacterized protein n=1 Tax=Corchorus olitorius TaxID=93759 RepID=A0A1R3G8M7_9ROSI  ali  49  23.............................................................................................................GKGLNNPLVRIDRGMGDMGENNIVCHKMQYPYAVYLCHSIKKTIVYDVPLIGVDGTKVNAVAVCHLDTSAWSPKHVAFQFLKVKLGSVPICHFLGRDTIVWVS 125
436 2.000e-31UniRef50_UPI0007C1651F BURP domain-containing protein 3-like n=1 Tax=Prunus mume TaxID=102107 RepID=UPI0007C1651F  ali  46  82VFFLEKDVQPGTTMKYSLARNSTRATFLHRKTAESIPFSSTKLPDILNQLSVKPGSVEANIMTETIQACERPILGGEERYCTTSLESMVDFTTSKLGRNIQAISAEVRKGATMLQKYTIKPGVKKLAGKRMCV............................................................................... 215
437 2.000e-31UniRef50_A0A200PP07 BURP domain n=1 Tax=Macleaya cordata TaxID=56857 RepID=A0A200PP07_9MAGN  ali  52  2..............................................................................KYCATSLESMIEFSTSKMGKNVIVLPTEIIRHNKEESTQQIND-EKMIKQQDYTITSGVKKMVGVFYCHATH-TKAYVVPLIGNDDTKVEVVAVCHTDTSAWNPKHLAFQLLNVKPGTVPICHFLSKDNIVWVA 135
438 3.000e-31UniRef50_M7ZQ17 Uncharacterized protein n=4 Tax=Triticum TaxID=4564 RepID=M7ZQ17_TRIUA  ali  28  381MLFLKKNLHIGTTLPKGTMFARDGA---PKSVHASTPLESKYLATILSHFMIPHGSTKAKQVADTLRSCGKPVDKEDPHMCFSSREAMSRFATRELGVSGARAAITRIHGNETPSSMYIVEQITQLN-NNVVPCHPMDFPYEVFYCHRPKEVQSLGVQIKGLKDGRVTAIAMCHMNTFNWDTQY--FELLDGKRGE-PICHYMPTNYIMF.. 586
439 3.000e-31UniRef50_A0A2T7DZT1 Uncharacterized protein n=1 Tax=Panicum hallii var. hallii TaxID=1504633 RepID=A0A2T7DZT1_9POAL  ali  31  255FFFRRDVLRPGSVITPTIPPTTTLPPLLRRRVADSIPFSTEHFADILAM-FAPESHAIAGEMHWTLEACEHPGPGYRAAGCATSLESLAELPMALLRTRDPDMSTDVAGTPARRGRYNVTTVKRITESPEIVTCHDTTYPYAVFFCHTASPTAAYAVTLAAEDGNAMEALAVCHLDRS---------RAHGEEPSEAAACHFLTKLSVIWV. 465
440 6.000e-31UniRef50_I3SVL8 Uncharacterized protein n=2 Tax=fabids TaxID=91835 RepID=I3SVL8_LOTJA  ali  70  118....................................................................................................................................TGHKQNYPYAVFYCHKSGSTRAYSVPLEGDNGVRVKAVAVCRTDTSQWNPKHLAFQVLKVKPGTVPVCHFLPEDHVVWVS 197
441 6.000e-31UniRef50_A0A2G3CEZ7 Uncharacterized protein n=3 Tax=Solanoideae TaxID=424551 RepID=A0A2G3CEZ7_CAPCH  ali  38  1.............................................................MEDALRVCEFNSFKGERKYCATSAEAMLNFVQEILGERTQIKTHSPKDSNSALQNYTILDSPKEVVVPKMVACHIMSCAYTVFYCHPSVSTKMFKVPLGNENGDRVEAIVVCHLNTSDWSPSHFSFQVLGILPGASPVCHFLPSNDLVWV. 160
442 1.000e-30UniRef50_J3LBW3 Uncharacterized protein n=2 Tax=Oryza brachyantha TaxID=4533 RepID=J3LBW3_ORYBR  ali  30  71MLFLMRSLFPGAVLPEGLAATAPPPRFISKADADTVPFDYRDLDTILGMFGILPGSDKASQVADTLRTCRNLDSGEDPRTCATSHEA-------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVPCHPMPYPYEVFYCHRPSDVVALRVELVAMDGDDDDAVAVCHTNTTTWDGRYFHMLGASARRGE-PICHYMPKSYVLWLA 279
443 2.000e-30UniRef50_UPI00098B569A BURP domain-containing protein 4-like n=1 Tax=Aegilops tauschii subsp. tauschii TaxID=169297 RepID=UPI00098B569A  ali  28  59MLFLKKNLHVGTVLPEGTKFARAGA---PKPVDFSTLLESKNLPSILARFKIPHGSMKAKQVADTLESCGKLVEMEEPHMCFTSHEAMTRFSTKALGLSGARSAITRIHGHETPNSMYTIAQIAQL-SNNVVPCHPMDFPYEVFYCHRPKEVQALRVQLKGLKDGRVTATAMYHMNTSDWDEQY--FELLGGERGES-ICHYMPTNYIMF.. 264
444 2.000e-30UniRef50_A0A2G2ZFQ8 Uncharacterized protein n=2 Tax=Capsicum annuum TaxID=4072 RepID=A0A2G2ZFQ8_CAPAN  ali  31  119......................................SGSNVPLLFSYRKQGKDEQGAKAMEDVLRVCELQSMKGETKYCATSAEAMVNFVQGFMGEKIEALSTTTHFHSTTPLQNYTILDVQEVAAPKMVACHMMHCVYTVFYCHHIIDDKVFKVSLGNENGDRVETMAACHFDTSEWSTSHVSFQVLGILPGTSPFCHFFSSNDIVWV. 301
445 3.000e-30UniRef50_UPI000B8F43B9 BURP domain-containing protein 3-like n=1 Tax=Helianthus annuus TaxID=4232 RepID=UPI000B8F43B9  ali  58  136LFFFENGLHLGKEMNLYFTKNDQKATFLPREIADSIPFSSNKLPQIYNEFSVNPDSVEAKIMKQTLEECEKPSNEGEERYCATSLESMVDFSM....................................................................................................................... 228
446 5.000e-30UniRef50_W1PZF4 Uncharacterized protein n=4 Tax=Amborella trichopoda TaxID=13333 RepID=W1PZF4_AMBTC  ali  35  45.LFLEKDLKIGMNKILYFRKSSCASPFLSREDADAIPFSSAELPRILQHFSFPPASSEAVEVGVTLTWCE---LLEALEKCLTSLEAMIDYATPSVQDPNITFLRTCINKDSVLQAYTATKVQTVPTKASSTLCHNMPYPYAGYYCH................................................................. 189
447 6.000e-30UniRef50_Q677A6 Polygalacturonase (Fragment) n=2 Tax=Hyacinthus orientalis TaxID=82025 RepID=Q677A6_HYAOR  ali  28  22.............................................IRKLFRIPADAPMGKSVATAIELCKEAPVEGQTRRCVTSAEDMIDYVVSSLGAKSTAKSTSNSNGLGSDVLIGEVKAAGGGELGRVVSCHHTTFPYLMYRCHSVPKTVLYDVEILDPKGRINLAAAICHFDTSVWSPRHATFQALVYERG-MDACHWVFPMDMAWTA 191
448 1.000e-29UniRef50_A0A0A9GGQ9 Uncharacterized protein n=1 Tax=Arundo donax TaxID=35708 RepID=A0A0A9GGQ9_ARUDO  ali  57  1.....................................................................................................................MTGVKRADGTDDRLVACHAKPYAYAVFACHLTQQTRAYSVSMLGMDGTAVEAVAVCHADTSGWNPKHVAFQVLKVKPGTVPVCHFLAQDHVVWT. 94
449 2.000e-29UniRef50_D8R9B6 Uncharacterized protein n=1 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8R9B6_SELML  ali  25 1671.FFPATLLVEGTTLAMANPSPAPARPFLPYSVSQQLKINTQSLPELKKMFGIRDGSNMAINLQKAATTCSAP-----DHTCVSSIKSMHELIVSKLGTSSVRMLQTILPQGLASTFNATIARVDKISKTRNVSCHSTMFPFQLYSCHSLPNTQIFTVGFDTVDHTDVDYVAACHVDTSTWNADFPAFKELGMQPGKGAVCHWIGGLDIAWNS 1891
450 2.000e-29UniRef50_A0A2K1R9W3 Uncharacterized protein n=2 Tax=Populus TaxID=3689 RepID=A0A2K1R9W3_POPTR  ali  45  1.............MRIHFTNSGTKVSFLPRQVAESIPFSSDKVPEILNYFALQVNSKEAQVIRDEIGGCEEPNMEGEEKFCATSLESLIDFSVERLGRNVRVLSTDA----GKKQEYTVSAKATMIGDHKAAVCHKMRYPYAVHY................................................................... 128
451 2.000e-29UniRef50_N1QYX0 Uncharacterized protein n=7 Tax=Triticeae TaxID=147389 RepID=N1QYX0_AEGTA  ali  28  127MLFLKKNLHVGTVLPEGTKFARAGA---PKPVDFSTLLESKNLPSILARFKIPHGSMKAKQVADTLESCGKLVEMEEPHMCFTSHEAMTRFSTKALGLSGARSAITRIHGHETPNSMYTIAQIAQL-SNNVVPCHPMDFPYEVFYCHRPKEVQALRVQLKGLKDGRVTATAMYHMNTSDWDEQY--FELLGGERGES-ICHYMPTNYIMF.. 332
452 3.000e-29UniRef50_A0A072TPT6 Embryonic abundant-like protein n=1 Tax=Medicago truncatula TaxID=3880 RepID=A0A072TPT6_MEDTR  ali  44  229...................................................FETRTWGVKERKSYVDYCGHPSAIGEDKYCALSLKSMMNFAISKLGTNIKVITSS----FAQNQDQYRVDEVKKI-GDNAVLCHRMNFKNIIFSCHQVNATTVYMVPLVASDGTKAKAVTICHHDTRGMNPDHL-YKVLKVKPGTVPICHFIGNKAIAWV. 382
453 3.000e-29UniRef50_D7KUC0 Uncharacterized protein n=1 Tax=Arabidopsis lyrata subsp. lyrata TaxID=81972 RepID=D7KUC0_ARALL  ali  60  107.........................................................................................................................GVKKLSDDKSVVCHKQKYPFAVFYCHKAMMTSVYAVPLEGENGMRAKAVAVCHKNTSAWNPNHLAFKVLKVKPGTVPVCHFLPETHVVWFT 197
454 3.000e-29UniRef50_UPI0008A0DFF1 BURP domain-containing protein 3-like n=1 Tax=Musa acuminata subsp. malaccensis TaxID=214687 RepID=UPI0008A0DFF1  ali  36  112LFYLEKGFKSGSKSSVQFKKTTTGAAFHPRKEAESIPFSSAKLREILNYYGVNPGSAEALVMEKTVQECENLAARWGGAVLRHLARVHGGVQHVEPGDTRRHGGVDRRRQGGLDAAAVHDHRRKPRPGYRPVACHPVAYKYAVFYCHTTATSKAYRVGLVGAD................................................. 274
455 6.000e-29UniRef50_Q43675 Unknown seed protein USP n=19 Tax=NPAAA clade TaxID=2231382 RepID=USP_VICFA  ali  37  68.LFFEHDLHPGKNFNLGHTNS----------VGSIIPFT-------KSRQGVTDSIWLANKEKQSLEDCYSPTAIAEHKHCVSSLKSMIDQVISHFGSTKIKAISSNF---APYQDQYVVEDVKKV-GDNAVMCHRLNFEKVVFNCHQVRDTTAYVVSLVASDGTKTKALTVCHHDTRGMNPE-LLYEALEVTPGTVPVCHFIGNKAAAWV. 257
456 8.000e-29UniRef50_M0RX58 Uncharacterized protein n=1 Tax=Musa acuminata subsp. malaccensis TaxID=214687 RepID=M0RX58_MUSAM  ali  36  90LFYLEKGFKSGSKSSVQFKKTTTGAAFHPRKEAESIPFSSAKLREILNYYGVNPGSAEALVMEKTVQECENLAARWGGAVLRHLARVHGGVQHVEPGDTRRHGGVDRRRQGGLDAAAVHDHRRKPRPGYRPVACHPVAYKYAVFYCHTTATSKAYRVGLVGAD................................................. 252
457 8.000e-29UniRef50_A0A1D1XWD0 BURP domain-containing protein 5 n=1 Tax=Anthurium amnicola TaxID=1678845 RepID=A0A1D1XWD0_9ARAE  ali  45  1.......................................................................................MVDYATLVLRTHDVRAISSVKEGTAKKQMYVVASSPQVIAGNKIVSCHPLIYPYAVFHCHDVPATTVSVVPLVGEDGAKMDAIAVCHTDTRPWLPNHLAFQMTKVKPGTVPICHFVEQGGVVWA. 127
458 2.000e-28UniRef50_A0A2G2ZFN1 Uncharacterized protein n=1 Tax=Capsicum annuum TaxID=4072 RepID=A0A2G2ZFN1_CAPAN  ali  26  63................................AGSIPSDVGNLKKILNNNKLQGHIPEAAGCYSLLQSLHSFPSFKRDLEAIATLRSVLPCIDSMIHMKCGQAELIIVDR----QTGTISDAPQEVAAPNMVACHMMPCAYIVFYCHHTDKRKVFKVSLRNENGDRVESISVCHLDTSDWNPYHVSFQVLGVLPGKSPVCHFIPSNDLAWVA 246
459 2.000e-28UniRef50_G7JYZ7 BURP domain protein n=1 Tax=Medicago truncatula TaxID=3880 RepID=G7JYZ7_MEDTR  ali  23  6.................IRDKIHKRQFLSPTIIAKLPLTTKNMNLLKQFFRISDNGATEKRMKETLENCERAPARGEIIKCVRSMDEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYFCHYIPMVRVYNVELTLQKIKINQAVGVCHIDTSSWSRSHPAFLELGSAP.................. 184
460 3.000e-28UniRef50_A0A0D3F3S0 Uncharacterized protein n=2 Tax=Oryza TaxID=4527 RepID=A0A0D3F3S0_9ORYZ  ali  30  18MLFTMKSLFPGALLPEHDIGAAPPLRFASRADADAVPFDYNDLDAILGRFGIRRGSKKAAQVAETLLTCGEGDSGEEPRTCATSHEAVISFAASALGTSAPRAATTVVHGGGGGRRRREEPVDRIGSGGAVVPCHPMPYPYEVFYCHRPSDAVALRVELVGEDGDAATAVAVCHMNTTMWDAHY--FDMLNARRGEPSA............. 240
461 5.000e-28UniRef50_G7L8G8 Embryonic abundant-like protein n=3 Tax=Medicago truncatula TaxID=3880 RepID=G7L8G8_MEDTR  ali  38  348............................................KTSQHQHFVTHTSDENEAHILEDYCGRPSAIGEDKHCAPSLESMMDFAISKLGKNIKVMSSSF---SKNHDQYVVEEVNKI--GDNAVMCHRLNFKKVLFYCHQVNATTTYMVPLVASDGTKSKALTICHHDTRGMDPN-VLYDVLKVKPGTVPVCHFIGNKAVAWV. 508
462 5.000e-28UniRef50_A0A199UB71 Uncharacterized protein n=2 Tax=Manihot esculenta TaxID=3983 RepID=A0A199UB71_MANES  ali  31  74.LFTPDDVYFGKIMPIYFPQA-----------------------------KISVDHQQE--------KCEIAPAEVETKICARDMESMLDYVHRVFGSDSEFKAVETKHSMPLLQDYIVLEDPQEIKGPGIVICHPM---YEDFFCHYADATKVLKVSLGGNNGDKVEAIGICHMDTSGLSHDHIAFRLLPIKLG-SPLCHFLAAGHLVWV. 246
463 5.000e-28UniRef50_UPI00046DD0F9 BURP domain-containing protein 3-like n=1 Tax=Prunus mume TaxID=102107 RepID=UPI00046DD0F9  ali  45  30.FFLEKEMQPGTTMKYSLVRNINGACPLPRKIAQSIPFSSAKLPEVLNKFSMEPTPVEAAVIQETIQDCESGTLNGEDRYCATSLESMADFAMSKLGRNVQAFSTEVEKGAT.................................................................................................... 140
464 7.000e-28UniRef50_A0A0K9NXT3 Uncharacterized protein n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9NXT3_ZOSMR  ali  40  11............................................................................................................WRISPLIRYSITSSVLKGTRSRSVACHPSTFPYALYFCHTVHNTRTYSVSLVGENGSKIEAIASCHQETSDWSPEHISFRILNVKPGEGSICHFLAQDSIAWIA 114
465 7.000e-28UniRef50_A9SI40 Predicted protein n=3 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A9SI40_PHYPA  ali  23  184..FNHNDINKGNVLPENLHDSHPIVPFLPQSLSEKLPFSSGKMPELLDTLNIHRGSNMAMMMYRTVSQCEARDQSKESRKCVTSLEDMQNFVSSRLPQDKHITASSSISGAVRSHSKDSWKVLDTKLHETAVICRKSVFAYAVFECQSTSNMHIYSVEMQGHDGSRRSEVASCSKNFATTSVDATAH-----KRTEGQSCLWVT-DALIWA. 393
466 7.000e-28UniRef50_W4ZMF4 Uncharacterized protein n=5 Tax=Triticinae TaxID=1648030 RepID=W4ZMF4_WHEAT  ali  27  70ILFLRRNLFDGAVLPLGHARRAGTASTVTGTNLAPPPFDYGSLRNILTYYNIAPGSEQARQVASTLRFCGRSEARGKPHLCATTERAAMEFAAAALGAATAEPLRTVVHGREEPHRYVVAPGGVASIAGAVVPCHPLPYPADVLYCHRPSNVGAVRVELVGQDDPTATAIAVCHEDTSGWDAEY--FATLNGSRGE-PICHYMPEKYVVWV. 288
467 8.000e-28UniRef50_UPI000901D01A BURP domain-containing protein 16-like n=3 Tax=Ipomoea nil TaxID=35883 RepID=UPI000901D01A  ali  26  121..FRPSDLKKGHKVILPLTSQLSNRAFLPSQIGRNIPLSTSELQRIFPIVFSDPQTKARIDT--SLRHCDTTTVNRETRSCLKTLEDMIQFSRKSLGQKHMIALASENTKSLGNQVVTT-QISKPYNTDKIVVCHEEFFPFATYYCHVLLSTQVYAVDMVNPGGIPTPLFALCQMNTSS----HVAFEPHETSPGKEQLCQWITEMDIVWI. 326
468 8.000e-28UniRef50_A0A1D6AY62 Uncharacterized protein n=1 Tax=Triticum aestivum TaxID=4565 RepID=A0A1D6AY62_WHEAT  ali  25  289MLFLKKNLRVGTVLPQGTMFARGGS---PKSVNSSSPLESKYLSTILSHYKIPHSSIKAQQVADTLRSCGKPADKEEPHMCFSSREAMARFATKALGVSGARAAITRIHGHETPNTMYVVAQIAQ-ASNNAVPCHPMDFPYEVFYCHRPREVQSLTVQLKGLKDGTVTATAMCHMNTSDWDEQYF........................... 472
469 1.000e-27UniRef50_UPI0008FF8050 BURP domain protein RD22-like n=1 Tax=Vitis vinifera TaxID=29760 RepID=UPI0008FF8050  ali  51  7........................................STLPKILNRLLVKENSVEAELMKK-IEECEEAVMDGESRFCATSLESLIDFNTSKLGRNVNVLMNEVKTGSQEFE----FGVGTKKVADKSVVCHKMNYPYVVFYYHTLTKTRTYMIPLVGADGSKSKAMAACHSDTS.................................. 139
470 1.000e-27UniRef50_B9RIH5 Uncharacterized protein n=1 Tax=Ricinus communis TaxID=3988 RepID=B9RIH5_RICCO  ali  48  101...........KRMNLLFTKFPDKVSFLPRQVANSIPFSSNKLPGIIDRFSINTKSAKANLMRQTLEECESPKVNGEDKFCATSLESLVDFGVSRLGRNVIILSNEIDQDNKKQE--YSILTGIKMVGDKQNVCHKEVYAYAGF.................................................................... 231
471 1.000e-27UniRef50_U5D5J5 Uncharacterized protein n=1 Tax=Amborella trichopoda TaxID=13333 RepID=U5D5J5_AMBTC  ali  34  237..............NLPFYWQNPPPSLSPHHITDSILFAHNLLPQILCRFSILPNSPEAKDMEETLRLCEYPPNKGERKMCATSRESMDDFILSIFGTKANLQMLSTMIESPKLQAYTVEKISNEFKTPKVVVCHLMPYLYPVFFCHDVTKAKVFEVKLKLEAGNRVNA........................................... 397
472 2.000e-27UniRef50_A9RSL4 Predicted protein n=3 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A9RSL4_PHYPA  ali  25  132..........GSRIDGELRDPVARRAFLTAAAADDVPINTSNLPVLLEMFGVLPSTQLATDMGTTAFLCGSPALPGESRSCPISRIAVAQFVSEQLKVNVVEVLATVPLDHEPIYTIVDFAVGSEEQGKRIIICHNVNFASQVYYCHSVTKTKVVLATLLKANGSTIKASAVCQIDTMLWDSSHPAFAALWIPRG-SEVCHFLVDNDVLFA. 341
473 2.000e-27UniRef50_A0A0C9S701 TSA: Wollemia nobilis Ref_Wollemi_Transcript_10115_1577 transcribed RNA sequence n=4 Tax=Araucariaceae TaxID=25664 RepID=A0A0C9S7  ali  26  129......ELRAGGQMTLPFHPPVTWKSFLPRELAEIMPLSAGNVDQILRLLDIPRGCNLSRNMLSTVEACEARLGEGESRTCCTSVECMLDYVASNFGSDVELVSDTSVVGSGQRAKVIKAKKRKKVSGKAPMACHRLVFPYGVLYCHYFNGTDAFDLELEVTQNGRSTASAVCH----------YFSNKEKEGTGKQPVCHLIYGSTFLW.. 327
474 3.000e-27UniRef50_I1HB30 Uncharacterized protein n=4 Tax=Brachypodium distachyon TaxID=15368 RepID=I1HB30_BRADI  ali  24  171MLFLKRSLHVGVILPEG---TMFAGAHVPKSENSSTPLELKYLGTILSIFKIQHNSVKAKQIANTFRSCGGPGDKGETHKCFLSRSEMATFASEALGISHPRAAITIIHGEENPSSRYVVAAISQ-MGSDVVACHLMPFPYELFYCHRPRNVLSLRVQLKGADSTMVTAIVMCHMDTSNWDKEYFDLLGGEL---AEPICHYMPDNYVMF.. 376
475 3.000e-27UniRef50_D7SUF7 Uncharacterized protein n=2 Tax=rosids TaxID=71275 RepID=D7SUF7_VITVI  ali  60  6.....................................................................................................................YRLGVGVKVVADKSVVCHKQKYPYAVFYCHAIHNTRVYTLPFVGEDGTKSEVVVSCHIDTSAWNPKHAAFKVLKVKPGTVPVCDFLPHDDIIWI. 100
476 6.000e-27UniRef50_UPI000D1CABCB BURP domain-containing protein BNM2C-like n=6 Tax=Selaginella moellendorffii TaxID=88036 RepID=UPI000D1CABCB  ali  25  110.FFQLKTLVGAKNIPLRWDNSIPVSKFLHPLLEPVL--ASMNLSQLLSTMHFSSQSPFAATSKDSLEMCSSHGIKHEIKACHVSAKSILDQASSTLHKLDLKYVANTLEFDPNEPFQVVET--RVVAADGSLACHPMTFPFAIFMCHTIPNSLVLEVDLLRSSSKMVKVPAVCHMDTSDFAPSHISFKILNTRPGEGEVCHWLPTSHLVW.. 324
477 1.000e-26UniRef50_A0A2I0JTK6 Uncharacterized protein n=1 Tax=Punica granatum TaxID=22663 RepID=A0A2I0JTK6_PUNGR  ali  35  1.............MPLYFPRRLDPPRLLPREEAESIPFSSSQLSHLLDYFSFLERSPQAKAMAYTLKTCELQPIKGEVKYCTTSLEAILNGVQRILGPGTKSQTLTTTYLSMHNQNYTIQEAPKWVAATRMVAYHLMPYPYAVFYCHSQP.............................................................. 145
478 1.000e-26UniRef50_A0A1D1XR33 Polygalacturonase-1 non-catalytic subunit beta (Fragment) n=6 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1D1XR33_9ARAE  ali  33  484.FFRESMLAPGTVMPMPIRDRMPPRAFLPRSISSKLPFSTARLGDLNRVFNATPDSALGKAMADTVAECERAPSRGETKRCVTSAEDMVDFATSVLGGDAVARSTESAAGWG.................................................................................................... 595
479 2.000e-26UniRef50_A0A165A869 Uncharacterized protein n=1 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=A0A165A869_DAUCA  ali  60  1.............................................................MKNTITVCEAPGIKGEEKYCATAPEKMIDFTTSRFGNKVKALSTDV------------------------------------------NDVKAYKVSLVGYDGTKAKAAAICHTYTSSWNPKHLAFQALTVKPGSAPICHFLPEDHVVWV. 108