current user: public

If you have questions about the server, please let us know.

Query: PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H, from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# E-value Template Links and tools%idFirst DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISARPKMQNGIVPNGEASNSKSKLTSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFVQADGVKLLIPLISPASTQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLLast
1 1.000e-72UniRef50_B0R0V8 V-type proton ATPase subunit H n=64 Tax=Euteleostomi TaxID=117571 RepID=B0R0V8_DANRE  ali  27  14NIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIKKFEVAGSEDKQAILTNEGHQCAKTFLNLMAHISKEQTVQYILTLIDDTLQENHQRVNIFFDYAKKKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGRDLMEGSDLNYYFNWIKTQLS--SQKLHGTGAEPGTGTISPSESSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCITAVLSNKCG---FQLQYQMIFCVWLLAFSPQLCEQLRRYNVVPALSDILQESVKEKVTRIILAAFRNLLEKSEYALAMIQCKVLKQLENLDQQKYDDEDITDDIKFLLERL 338
2 6.000e-72UniRef50_F7HPP7 V-type proton ATPase subunit H n=23 Tax=Euteleostomi TaxID=117571 RepID=F7HPP7_CALJA  ali  25  17NIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEKRSPEEKQEMLQTEGSQCAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVSIFFDYRRSKNTAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLS--SQKLRGSGVAVETGMVSSNDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKL 342
3 1.000e-70UniRef50_Q9UI12 V-type proton ATPase subunit H n=385 Tax=Bilateria TaxID=33213 RepID=VATH_HUMAN  ali  25  17NIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEKRSPEEKQEMLQTEGSQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARSKNTAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLS--SQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKL 342
4 5.000e-70UniRef50_Q84ZC0 Probable V-type proton ATPase subunit H n=64 Tax=Mesangiospermae TaxID=1437183 RepID=VATH_ORYSJ  ali  100  2DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLRLLLKGNWFVQEKSCKILTQIISARPKMQNGIVPNGEASNSKSKLTSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFVQADGVKLLIPLISPASTQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGL 323
5 1.000e-69UniRef50_A0A226EPN7 V-type proton ATPase subunit H n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226EPN7_FOLCA  ali  25  120..LQQKANDVRAQRVNWQSYLQCQMISQEDYNFIVAFDGANGKAKDQLLEEQRMQCAKTFLNLMGHVSKDQTIYYILVLVDEMLIEDKGRAEIFKEYRKKKESVWAPFLNMLNRQDGFITNMTSRILAKMACWSRDLMDGSDLHFYLTWLKDQLRI--------------------PENEYIQSVARCLQMMLRIDEYRFAFINVDG---ISTLVSVLSGRHNFQIQYQLCFCLWVLTFNSALAEKMNKYTVIPILADILSDSVKEKVTRIVVAVFRNLIEKPEHCIAMVQSKVLKHLEILQQRKFDDEDIQGDITFLSDKL 424
6 1.000e-68UniRef50_A0A2J7RRL5 V-type proton ATPase subunit H n=16 Tax=Hexapoda TaxID=6960 RepID=A0A2J7RRL5_9NEOP  ali  24  29..LQQQATEIRTQRVNWQSYHQSQMISQEDYSFIVAFDNADAASREGLLRDNRNQCARTFLNLLGHVSKDQTIQYILIMIDDMLQEDHSRVEIFREHSSKKETVWGPFLNLLNRPDGFIMNMTSRIIAKIACWSQELMDRSDLQFYLTWLKDQL--------------------KQNNNEYMQSVARCLQMMLRIDEYRFAFVAVDG---ISTLLAVLQGRVNFQVQYQLIFCLWVLTFNPLLAEKMNKFSVIPILADILSDSVKEKVTRIILAVFRNLIEKPEHCIAMVQCKVLKQLSILEQRKFDDEDIVADIEFLNEKL 333
7 3.000e-67UniRef50_M0TYH6 Uncharacterized protein n=7 Tax=commelinids TaxID=4734 RepID=M0TYH6_MUSAM  ali  76  231...ELTTEEVLKMDIPWETYMTTKLITGTHLQLLRRYDKKSESQRAALLDDDGPAYVAVFINILRDISKEETVEYVLALIDEMLTANPKRARLFHDKSLSNEDTYQPFVSWLQEGNWFIQEKSCKILTLIVSARPKGQHGLVSNGESSHSKSKISAIDAVLEGLLDWLCLQLKAPTHPNRSVPLAVSCLATLLRERFVRVSFVQADGVKLLIPLISPASTQQSIQLLYETCLCIWLLSYYDAAIDYLATTRVMPRLVDVVKGSTKEKVVRVIVLTLRNLLPKAACGAQMIDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGL 554
8 6.000e-67UniRef50_B9S253 V-type proton ATPase subunit H n=4 Tax=rosids TaxID=71275 RepID=B9S253_RICCO  ali  68  2DQAELTTEQVLKRDIPWETYMMTKLISGTDLQLLRRYDNRSESQRAQLLDDDGPAYVRVFVNILRDIFKDETVEYVLALIDEML------AVCFIKTRKLKQPIIWSTSRLLWKGNWYIQEKSCKILALIISDRPKTQDGTIANGEASNSKRKGTTISDVLKGLVEWLCAQLKKPSHPSRGVPSAISCLATLLKEPVVRSSFVQADGVKLLIPLISPASTQQSMQLLYETCLCVWLLSYYEPAIEYLATSRTLPRLIDVVKSSTKEKVVRVIVLTFKNLLSRGTFGAQMVDLGLPQVVQSLKTRAWSDEDLLEALNQLEEGL 317
9 1.000e-66UniRef50_A0A251SSU7 V-type proton ATPase subunit H n=70 Tax=Streptophyta TaxID=35493 RepID=A0A251SSU7_HELAN  ali  67  4DQADLNSDQVLRRDIPWETYMTSKLITGTALQLLRRYDKKSEHDRAPLLENDGPSYVRVFISILRDIQKEDTVEYVLALIDEMLTEKPNRAKLFHDTTLADEDIYEPFLRLLWKGSWFTQEKSSKILT-LVVSARPNKNGLTANGKATDSKKKITTSDDVLKGLVEWLCIQLKKPSHPNRSIPVSINCLAALLKEPVVRSSFVQADGVKLLVPLISPASTQQSIQLLYETCLCVWLLSYYEPAIEYLATSRALPRLSEVVKGSTKEKVVRLIVLTFKNLLSKGSFGAQMVDIGLPQIVQSLKAQAWSDEDLLDALNQMEEGL 324
10 3.000e-66UniRef50_K3ZT60 V-type proton ATPase subunit H n=45 Tax=Eukaryota TaxID=2759 RepID=K3ZT60_SETIT  ali  87  2DRAELTTEQVLKRDIPWEHYMSTKLISGTCLQLLRRYDHKPESQRAPLLEEDGPAYVRVFLNILGSISKEETVEYVLALIDEMLATNPKRAALFYDQSLSGEDIYEPFISLLWKGNWFVQEKSCKILTDIISARPKLQNGMLPNGDSSNSKSKLTSTHDVLRGLVDWFCSQLRNPTHPSCSIPTTIHCLSSLLREPYVRTLFVQADGIKLLIPLISPASTQQSIQLLYESCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVVLSFRNLLAKGAFAAQMIDLGLPQIVQNLKAQAWSDEDLLDALNQLEVGL 329
11 2.000e-65UniRef50_Q9LX65 V-type proton ATPase subunit H n=82 Tax=Spermatophyta TaxID=58024 RepID=VATH_ARATH  ali  71  2DQAELSIEQVLKRDIPWETYMNTKLVSAKGLQLLRRYDKKPESARAQLLDEDGPAYVHLFVSILRDIFKEETVEYVLALIYEMLSANPTRARLFHDESLANEDTYEPFLRLLWKGNWFIQEKSCKILAWIISARPKAGNAVIGNG-----------IDDVLKGLVEWLCAQLKQPSHPTRGVPIAISCLSSLLKEPVVRSSFVQADGVKLLVPLISPASTQQSIQLLYETCLCIWLLSYYEPAIEYLATSRTMQRLTEVVKHSTKEKVVRVVILTFRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGL 312
12 4.000e-65UniRef50_B0W5Q3 V-type proton ATPase subunit H n=208 Tax=Bilateria TaxID=33213 RepID=B0W5Q3_CULQU  ali  23  24..LQQQAGDIRQNKPNWAPYVQSQMISQEDYNCVSALDK-DKKSQAQYLQENPGQCAKTFLNLLSHVSKDQTIQYILVMIDDLLQEDRTRVQIFHDYAIKKESVWAPFLNLLNRQDGFIVNMASRVVGKLACWGQELMPKSDLHFYLQWLKDQLTV--------------------ANNEYIQSVGRCLQMMLRVDEYRFAFVTVDGISTLISILS---SRVNFQVQYQLVFCLWVLTFNPLLAEKMNKFNVIPILADILSDSAKEKVTRIILAVFRNMIEKPEHCIAMVQCKVMKQLQILEQRRFDDEDISADLEFLIEKL 327
13 4.000e-65UniRef50_A0A0W0F1T0 Uncharacterized protein n=2 Tax=Dikarya TaxID=451864 RepID=A0A0W0F1T0_9AGAR  ali  27  10.YLDETSSKIRSKPVPWEGYQRADLVTSEELTLIKKVDRQPRAKIESLLLSDGQTYALLYLRLLKKLQRVDTMQSILVLIADALQDHDERIPLFTRTTESDPEPYTPLLRTLDMQDEFMQLKAAQILTVLLCSEPKPLQP------------------KLLQPFLNTLASMIQSNSNNKH--DVGVQCLEALLARPECRQAVWAIPG--IIHGFVDILKRNPGPQMSYQVSFCLWLLSFERDVAQDINKFDIIPILVRVAQGAVKEKVIRVIVATFRNLVTKAPNAPAMLVAQLLPFAKNLCTRKWTDEDIVEDVQFLRDEL 312
14 2.000e-64UniRef50_A0A0P5VZ69 V-type proton ATPase subunit H n=7 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5VZ69_9CRUS  ali  22  29..LQQRANEIRNNSINWQSYLQSQMIGDDDYRFITEFLSSDGGKGDSLLQDQRTQCAKTFLSLLEHISKDQTVQYILTIMDDMLQEDMNRVEIIREYAKKKENVWSPFLNLLNRPDSFIQNMTSRIIAKLACWSRDPMEGSDLTFYLTWLKDQLQ--------------------TPGNEYVQTTARCLQMMLRDEKYRLVFAGMEGVSVLANILS---GRINFQIQYQLSFCLWVMTFSPQLVEQMNKHKIIPILGDILNDSVKDKVTRIILAVFRNMIEKPENCVAMVQAKVLKQLSILQQHKFDDEDIMADIEFLTEKL 333
15 2.000e-63UniRef50_Q9V3J1 V-type proton ATPase subunit H n=257 Tax=Bilateria TaxID=33213 RepID=VATH_DROME  ali  25  21..LQQQAADIRTRTINWASYMQSQMISEEDYKAISALDKS----RASFLAQNSSQVVKTLLNLVSHLSKDSTIQYILVLLDDLLQEDRSRVDLFHDTAGKKQCIWGPFLNLLNRQDGFIVNMSSRILAKFACWGHETMPKSDLNFYLQFLKDQLA--------------------SNNNEYIQSVARCLQMMLRVDEYRFAFVGVDG---ISTLIRILSTRVNFQVQYQLIFCLWVLTFNPLLAAKMNKFSVIPILADILSDCAKEKVTRIILAVFRNLIEKPEHCIAMVQCKVLKQLSILEQRRFDDEDITADVEYLSEKL 321
16 2.000e-63UniRef50_UPI000C1CE91F V-type proton ATPase subunit H-like n=4 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1CE91F  ali  68  4DQSDLTTEQVLRRDIPWETYMNTKLITGTGLQLLRRYDKKPENYKAQLLDDDGPSYIRVLVSILRDIFKEETVEYVLALIDEMLTANSKRARLFHDTSLANEDTYEPFLRLLWKGNWFIQEKSCKILSLIVSGRPKAQDALIANGAS--KSKEFTTIDDVLKGLVEWLCAQLKKPSHPSRGIPTAINCLATLLKEPVVRSSFVQSDGVKLLVPLISPASTQQSIQLLYETCLCVWLLSYYEPAIEYLGTSRSLPRLIEVVKGSTKEKVVRVVVLTLRNLLQKGTYGALMIDLGLPQLVQSLKAQAWSDEDLLEALTQLEEGL 323
17 2.000e-63UniRef50_A0A1X6N7Z1 V-type proton ATPase subunit H n=1 Tax=Postia placenta MAD-698-R-SB12 TaxID=670580 RepID=A0A1X6N7Z1_9APHY  ali  26  10.YLDENSTKIRSKPVPWEGYQRAGLITADELTLIKKVERQPKAKTESLLLSDGAAYAHLYLRLLKKLQRVDTQQCILVLIADAIADHDERIPLFTRTQELDIDPYGPLLRMLESPDDFVQLKATHILTILLSSESTPIHS------------------QQLQPFITSLASFVTGNTPHKR--DIAVQCLEAVLSRPEFRKAAWQDT--QLISGLVDILKHNPGPQMSYQVGFCLWLLTFEQEVAEQINKYDIVPVLTSIAQSAVKEKVIRVIVSTFRNLVSKAPNLPSMLVVQLLPFAQNLCTRKWSDEDIMEDVQYLRDEL 312
18 4.000e-62UniRef50_A0A1I8HEM9 Uncharacterized protein n=4 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8HEM9_9PLAT  ali  24  41NQLQHRANEVRNTRINWQSYLQGQMIDPEDYDFMVKLESLSPEQRKALLEANSDQFARTFFSMLAKISKDQTVQYVLTLLDDLLQEEKTRVDVFKRYEQRKENVWSPFFSLLHRQDGFIVNQASRIVAKFACWGSRLMEQTDLVHYLNWLNEQLRI--------------------PSNEYLQTVARCLQMLLRVSQYRQVFCDIDGIGTLANVLS---GKVNYQIQYQLVFCLWCLSFDADIVARMKKYNLIPICADILCESEKEKVNRIVCAFFRHLLEKPESALAMVHCKVLKQVELLAQKKYDDIEHEDDLKYLVEVL 349
19 7.000e-62UniRef50_UPI00084A49F1 V-type proton ATPase subunit H-like isoform X1 n=2 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084A49F1  ali  25  25..LAQRANEVLKEKINWPSYLQSQMMSQEDFEVMNKLESRG-SARETLLLQQRPLVAKTFISLLSHVSKDSTIQYILVLLDELISEDPSRLDMFRENARKHENQWTAFLNLLTRPDPFTTHMIARILSKMCCWGTERMEGSDLTFYLTWLKDQLRTTDKKSKTTTPARSSSYRPPPDGNEYVQCVCRCLQMLLRIDPYRDAFFKLDGVVTIVQVL--GSGKHNFQIQYQLTFCLWVLTFNHEIAEKMNKYGVIPTLGDILSESVKEKVTRITLAVFRNLIEKPQNCIQMVQCKVLKQLEILAQHKFDDEDITADIEFLNDRL 362
20 7.000e-62UniRef50_A0A1Y1XSV7 V-type proton ATPase subunit H n=3 Tax=Basidiobolus meristosporus CBS 931.73 TaxID=1314790 RepID=A0A1Y1XSV7_9FUNG  ali  30  14.YLEELTASIRGKAIPWEGYHKASLITEDELRMLKLYESRTQQGSSQFLAQDGNLFAKLFITLLDKLVRVDTLQYLLVVVDDILEENREHAALFHQTSAENPKPYEPFVKCLSKDDEFLSLKASKILSSLICTDKSRHQGVDLS------------------QFINWIVTQLR--SQNSSAVDIAVQNLESLLTVSECRQAFYQTNGVSILISLLKNSNG--NPQAQYQLIFCFWLLSFEKNIAAEINKYDIIPIFMDVAKTTVKEKVIRAVISTFRNLIEKAPNMAAMLVHKLLNFVENLASRKWSDADVPEDLEFVKVQL 316
21 2.000e-61UniRef50_A0A1C7NN83 V-type proton ATPase subunit H n=16 Tax=Mucorales TaxID=4827 RepID=A0A1C7NN83_9FUNG  ali  26  17.YLEKKAAAIRQKPILWEGYERASLLTHEQVELIKAIDKKSSTVIHEAMNEKGQAYASLIMYLLQKLSRPDTVQYVCLLTDDIFTASEDHARYFHETSKEDASPFRPFLKILETDDDFMALQASKLLTVLACSAPSPSH-------------------VDLSPFFNWIGSKLTSSNND--IVNLVTQELESLLRVNAYRLAIWNTQNIKELTHRLLLNKTASTPQIQYQIIFCLWLLTFEPEIAAHINKYDIIPLLVDIAKSAVKEKVIRVSIATLRNLVEKAPNLAAMLVVKLLPFSENLSTRKWSDTDLLEDINFVKERL 321
22 6.000e-61UniRef50_A0A1Y2D7B8 V-type proton ATPase subunit H n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2D7B8_9BASI  ali  28  8.YLNDRSTKIRSKAIPWEGYQRAGLLSAEDVTLIQRVAGQ-RSQADKVLEEEGETYANLYIRLLSKLSRNDTLQFILVLVGDFIADREDRIPLF----LSQPDCYSPLLKLLDSQDDFVRSKSSVVAATLLSYDPKPADSVVSKLLF-------------------HLSSLIRNVNDP-EGQDVGVQCLEAALRVEKVRTAVWAAEGPKVVEGLVQLLRTNPGSQMQYQLGFCFWLLTFDTAIAEQLNKYNIIPLLSDLARQAVKEKVIRIVVAAFRNLVTKAPNLAAMLVAKLLPCVKTLQSRKWSDDEIKEDVDFLVDEL 311
23 7.000e-61UniRef50_A0A1X2GF17 V-type proton ATPase subunit H n=3 Tax=Mucoromycota TaxID=1913637 RepID=A0A1X2GF17_9FUNG  ali  29  17.YLDKKVTQIRQKPILWEGYERANLLTHNQVELIRAIDKKNPQDIQAAVQGNEEAYASLILYLLQSLSRTDTVQYVCVLADDILSVNENNAAGFHQTHSQDETPYGPFFRVLQLGDEFSTLEATKVLTMLASSSPSPE-------------------KVDLYELYGWLTQQLASSNL--NLVDIAVQELESLLRVRAYRMPVWRSP--QLVKCLVSRLDRSASPQMQYQVIFCLWLLTFEPTIAAEINKYDIIPTLVDLAKSAVKEKVIRVAMATLRNLVEKAPNLAAMLVVKLLPFTENLAARKWSDADILEDIEYLKERL 318
24 1.000e-60UniRef50_B0D3Z1 V-type proton ATPase subunit H n=56 Tax=Agaricomycetes TaxID=155619 RepID=B0D3Z1_LACBS  ali  28  10.FLEESSSKIRSKPVPWEGYQRAGLITSEELTLIKRVDRQPKAKIESVLLSEGSTYTLLYLNLLKKLQRVDTMQCLLVLVADALADHEERIQLFIRASESDPDPFVPLLRILDTQDEFVQLKAAQILTILLSAQATPLQSHQISSFLTTLSSSVQ--------------------GQSSNKRDVAVQCLESLLSRPEFRQAVWEIPG--VISGFVDILKQNPGPQMSYQVAFCLWLLSFEQNISEQINKYDVIPKLIDVAQGAVKEKVIRVIVATFRNLVVKAPNLPAMLVCQLLPFIKNLATRKWSDEDILEDVRFLKDEL 312
25 1.000e-60UniRef50_A0A0K3CQ95 Uncharacterized protein n=3 Tax=Rhodosporidium toruloides TaxID=5286 RepID=A0A0K3CQ95_RHOTO  ali  25  8.FLSDRSLKIRSKAIPWDGYQRAGLLDADDVMLVQRV-ASSRDKAESILDAEGETYAALYVRLLNKLSRNDTLQFILVLLGDFIADRDERISLFFNGTT--ETPYPSLLKLLDSQDDFVRLKSSAIVSTILPYDPQPSDQVVA-------------------KVLQHLSNLVRSPNDP-EGQDVAVQCLESVLRVAKAREMSWDTKAPKVIEGLVQLLRAHPSPQMQYQLAFCFWLLSFDQTIAEQINRYNVVPLLLDLAKQAIKEKIVRIVVSTFRNLITKAPNLAAMLTVKVLPWLQTLQGRKFGDEDIKEDFDFLVDEL 313
26 2.000e-60UniRef50_A0A1Y2H1M2 V-type proton ATPase subunit H n=2 Tax=Lobosporangium transversale TaxID=64571 RepID=A0A1Y2H1M2_9FUNG  ali  28  25.YLDELTAGLRARPIPWEGYQRATLITQKELEYIKAVDKKTGEDLSRVVDQEGKVYAELFISLLQKLVRVDTIQSILILVDDLLMDHEERASYFLGLAKGDPTPYAPLLKCLRSDDEFVPLKASKILTMLLCASPKPNEDAA-------------------QELFRWTTAQLQSNNHS--VVDLAVQVLESALRQRSLRLIYWNTPQAMD-ALVRIIKRDSPTPQMQYQVIYCFWILSFDTQIAEELNKYDIIPTLVEIAKSAIKEKVIRVIISTLRNLVEKAPNLAAMAAVKLLTFTENLSTRKWTDGEILEDVNYLKAEL 327
27 5.000e-60UniRef50_R4XB71 V-type proton ATPase subunit H n=2 Tax=Taphrinales TaxID=5008 RepID=R4XB71_TAPDE  ali  24  9.YLDELTANIRARPIPWEGYQRASLISEDEVKRIKAIDKQPALRKHEIISAESDEYAQLVMNLLSKIKRVDILQYTLVLAGDFISEVDAFAQSLISTTDGDDMPYSSFIKLLKNEDDAIPILAANVLTYLIATTETVPASV-------------------LKPFFEWYRSLASTQDQNTDLQNLSVQALSSILRSQENRNAFWEEQENMDI--LIKLLKTHGGIQLQYNAMLVIWLLSFDKPRAQELNKFDIIAILSKIAKASIKEKVTRIAVATLRNLAKLAPNINQMIQAELLPFLKVLTARKWQDPDIKEDLDDLTSTL 311
28 9.000e-60UniRef50_U5HJ57 V-type proton ATPase subunit H n=4 Tax=Microbotryum TaxID=34416 RepID=U5HJ57_USTV1  ali  25  6.YLSDRSLKIRSKAIPWEGYQRAGLLSQDDVALIQRVAG-GKAQAESVLQAESDTYADLYVRLLSKLSRNDTLQYILVLVADFLNDKDDRIPLF----LSQNDPYSPLLKHLDSQDDFVRSKSAAVISTVIGGDPNPPDAVVTKVLAA--------------------LSALIRNQADPEAQDVGVQCLGSALRIEKIRTAAWQADSSKAIKGLVQLLKTNPSAQMQYQLGFCFWLLTFDTPIAEKINRRNIIPLLADLARQALKEKVIRIVVAALRNLVTKAPNLPAMLVAKLLPFVKTLASRKWSDDEIKEDVEFLVEEL 310
29 1.000e-59UniRef50_A0A0E9N9S6 V-type proton ATPase subunit H n=1 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9N9S6_9ASCO  ali  22  12.HLESLSTNIRARPIPWDGYQRAGLVSEHEVKSIKAVSSQSTTKRQGVFSKEGKQYAELVMELLGKAKRADILQYVLVLAGDFIVEVKGWSMLFLLRGESGELPYGPIVKQLSSEDEAIRLLAARFLTSLLSLDPNPPREVVESYLTF--------------------STTHLLSSPSPALQDFCLASYTALLRHSPSRPTFWSNTSVMS-GTIDILKKNEGGLQVQYWGLVCLWLLSFEVDVARGLNKYDVVPLLADIARTAIKEKIVRMVFAVFRNLVKLAPSLPAMLVARLLPLTTSLSQKKWSDPEITDDLTFLKEQL 315
30 2.000e-59UniRef50_B4E054 V-type proton ATPase subunit H n=6 Tax=Boreoeutheria TaxID=1437010 RepID=B4E054_HUMAN  ali  26  17NIIAAKAAEVRANKVNWQSYLQGQMISAED-------------------------CAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARSKNTAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLS--SQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKL 316
31 5.000e-59UniRef50_A9S6G6 V-type proton ATPase subunit H n=18 Tax=Embryophyta TaxID=3193 RepID=A9S6G6_PHYPA  ali  60  6...ELTREEVLKRDIPWEMYMTAKLINSTGLQLLRRYDHRPESVQAALLEENGVAYVRVFVGILADISKQETIEYVLAMVDEMLTANPKRARLFLDFQDKDIDVYRPFIRLLSKKNWFIQEKSCKILTLIISARQYEAEIEDSLA----SQKKPDTFNEVLRSLVDWLISQLRSPAHPTRGVPMAVSSLATLLRIPRVRIMFIKAEGTKLLAPLITPLTNQQSIQLLYEVTLCIWLLSFVDSAVEAFSSAKVLPRLVEVVKSSTKEKVVRVAVMTFRNLSSKGNSASEMVDLGLPKIVQSLQLYAWSDEDLLQALEVLDAAL 322
32 8.000e-59UniRef50_A0A1X2H483 V-type proton ATPase subunit H n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2H483_SYNRA  ali  26  12.YLDKKASQARQRSILWEGYERANLLSHDQVELVKAIDKASPEQIQQAVKGKGDAYAALILHLLEKLSRPDTVQYVCILADSILSGDESNAKYFHNLTATNGDPYEPFIKALRSGEELTDLEASKILTILSCMSPTPAQTDV-------------------TALCKWLSMHLASPNP--QIMDLAVQETESLLGVREYRNTFWNTQNA-VNHLVQELDKGSATPQIQYQIIFCLWLLTFEKDIASKINQYDIIPKLVSIAKGAIKEKVIRVTIATLRNLVEKAPNLAAMLVVKLLPFTENLSTRKWSDTDIVEDIDFIKEKL 314
33 2.000e-58UniRef50_UPI000D7FAE63 ARM repeat-containing protein n=1 Tax=Tilletiopsis washingtonensis TaxID=58919 RepID=UPI000D7FAE63  ali  28  30.WLSELSARIRARPIPWEGYQRADLVSQPELRMIRAVDAKPRAAVDGVIDAEGPAYARLYLTLLGKLSRTDTLQQVLVLVADMLDGRDDRAALFLHVPESGDAPWAPLVKLLDLSDDFAQVKAATVLTALLVSPATSAATTPPS---SVTLRLLSFLAALLNNGAPRNASSGVGGFADGNGTDIAIQLLQALLRNHRLRAVVWKEESIKALASILRQSQAPQSPQMVYHAVFSIWLLSFDKEIAEDLNKFGVITLLADVARTAVKEKVVRIVLATFRNLLAKAPNAPAMLGARCLPLVEALSTRKWTDEEISEDVAAVQEVL 387
34 2.000e-58UniRef50_U9ULH3 V-type proton ATPase subunit H n=7 Tax=Mucoromycota TaxID=1913637 RepID=U9ULH3_RHIID  ali  28  21.YLDELTSGIRSRPIPWDGYKTADLITKDELDLLKKVDKQSPEQLRIVLQREEEKYTELYANLLEKLNRVDTVQYILVLVNDMLSDNEQRVTFFHKLSEKDELPYRIFLNLFKVEDEFVPLMSSKILTLLIVSAPKALPF-------------------DLDEFFRWIT--LKLKSNNTNVYDLAVQILASTLRIPSYRTKLWESQAVDTLVNLLKV--RNPTPQMQYQIIFCFWLLTFEREVSLEFNKYDLIPTLINIAKAAIKEKIIRVIIGTFRNLVEKAPNLPAMLVARLLNFCENLSSRKWTDKEIVEDIDFLKERL 323
35 3.000e-58UniRef50_A0A2A9NHA7 V-type proton ATPase subunit H n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NHA7_9AGAR  ali  26  10.HLDELTAKIRLKPVPWEGYHRADLVTSEELALIKKVDKQPRHRIESILLTDGRMYALLYMRLLKNLQRIDTMQSILVHISDALTDHDERIPLFQQTSDADSDPYSPLLRALETQDEFVQLKAAQILTVLLGTEKK------------------SVVTEKSETFLNTLSILIQSDSP--VRRDVAVQCLEALLARHECRRMVWRIPA--IIHGFVDILKSNPGPQMSYQVGFCFWLLSFDQHIAQQINTYDVIPLLVKVAQVAVKEKVIRVIIAIFRNLVTKAPNLPAMLVSQLLPFVKSLCTRKLSDDDVLEDAQFLKNEL 312
36 3.000e-58UniRef50_A0A1W0WSK0 V-type proton ATPase subunit H n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WSK0_HYPDU  ali  20  132...AIKAAEVRRSSINWSVYLQSQIITQDHYDCIFILESYGKQKRDHLLNHHGAQCARLLLEMTWSISKPSPVQYILTMIDDFLQEDRNRGNAFHQYAKDGSKGWALFFPFLNRDDPFIVQQAARIIAKLACWSSELMQGAELQIYLVFLKDQIR--------------------SGANDFRQSTARCLQMIVRVAEYRVAFTNLDG---ISSILTALKQVNNFQIQYQLIFCLWCLTFDPDIAAKFQNYNAIQVLASVLAESQKDKVTRIIIATLRNLLENPEHALTMIHSRILNTLKFLSTKKFEDNDILEDIQYLTDEL 436
37 9.000e-58UniRef50_A0A2B4RLB1 V-type proton ATPase subunit H n=3 Tax=Eumetazoa TaxID=6072 RepID=A0A2B4RLB1_STYPI  ali  25  32..LSVESEDVRKQKVNWQSYVQSQMINQEDYTMIADYDCMGAEERGRILEQKGDQFAKSCLSMLTRLSRDQTIRYILVLIDDVLTEERSRVSIFHEFGKRANNVWTLFLKLLNRQDQFIVHQTGIIIAKLASWGKVLLPDSDLNYFLSWMKNGLA--------------------SSGNGYHHSVAQCLQLMLRHQVYRQAFFKADGIQSVVSALVAP--NIGFQLQYQLIFVLWLLSFDPRIAERMIKSAVIRVIADILRESGKEKVTRIIIATLRNLLEKPEAALSMIQCKLLPVLSVLNGKTWVDEDITDDVEFVYEKL 336
38 2.000e-57UniRef50_B3S152 V-type proton ATPase subunit H n=3 Tax=Metazoa TaxID=33208 RepID=B3S152_TRIAD  ali  25  2....MQAAEIRGVFINWQSYLQCQMITESDYNFIVEFDKLKPKERDAFIQNSKLECPKTFINLISRISKDQTVQYILTLIDDMFEEDKSRVKLFHEYTEKSAQLWSSFLNLLNRQDIFTVHMSSRIMAKLASFSSARLQGSDLNFYLTWLNNQLTVLG--------------------NDYLQSVVNVLQTILRVDDYRLSFVKTHG---IKGLVDLLNTKVSFQLQYQITHCLWLLAFNPLIATKMNEHNVIPVLADILRDSSKEKVTRIVLATLRNLLEKPSNALAMIHSKVISMLIVLENKNWADSDIKDDIDFIHEKL 306
39 3.000e-57UniRef50_B7QKK9 Vacuolar H+-ATPase V1 sector, subunit H, putative (Fragment) (Fragment) n=9 Tax=Arthropoda TaxID=6656 RepID=B7QKK9_IXOSC  ali  24  48.....................RSHMMSQEEYTVIVALDKATPESRSALLKQQRLQSAKTLLNLLVNVSKDQTVQYILIMIDEMLQEDKTRVEIFKEYSRKKDNVWTLFLNLLNRQDGFIMNMTSRIIAKIACWGREPMEGSDLQYYLTWLKDQLRM--------------------PNNEYIQSVARCLQMMLRIDEYRLVFVAVDG---ISTLVTVLAGRVNFQIQYQLTFCLWVMTFNVNLAQRMHKYNVIPILADILSESGKEKVTRIILATFRNLIEKPENAIAMVQCKVSKQLEILQGKKFEDPDIVEDIEFLEERL 333
40 5.000e-57UniRef50_A0A0L0HMN1 V-type proton ATPase subunit H n=4 Tax=Chytridiomycota TaxID=4761 RepID=A0A0L0HMN1_SPIPN  ali  31  25.YLEDQTVAIRSRTIPWEGYQRASLITEEELSQIRQFEKSPTAA----LNEAGDSYIDLFLNLLQKLSRADTIQNSLVLIDDVLAESEGRVNIFYRLAEQKGDPYRPFFKLLKKDDEYIQLKSAKIITYLLIHS-------------------DAATKVDATELFVWIAEQLQNANA--NIVDIAVQLLQSLLSVPEYRLPFYQTPNVQSLVGILKK--GSSNAQMQYQVIYTLWLLTLIREIAADLRKFDVVPVFIEIAKAAIKEKVTRVVVATLRNMLSKAPNMAAMIGNKLLNVCETLAGRKWSDTDITEDLEYLKEEL 325
41 5.000e-57UniRef50_A0A091CNF8 V-type proton ATPase subunit H n=2 Tax=Rodentia TaxID=9989 RepID=A0A091CNF8_FUKDA  ali  25  511NIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEKRTPEEKQEMLQAEGSQCAKTFINLMTHISKEQTVQYILTMVDDMLQ-------------------------------------AARIIAKLAAWGKELMEGSDLNYYFNWIKTQLS--SQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFRNFLEKSEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKL 798
42 6.000e-57UniRef50_A0A194PW52 V-type proton ATPase subunit H n=9 Tax=Obtectomera TaxID=104431 RepID=A0A194PW52_PAPXU  ali  23  30..LQIRASEIRQTQINWQSYLQSQMITQRDHDYIVNLDQRGQK---NLPDQNPETCADVFLNLITHISKDNTIQYILVLIDDILSEDKSRVKIFRES--RHGSVWQPFLNLLNRQDEFVQHMTARIIAKLACWHSSLMEKSDLHFYLSWLKHKERDHEAAHEKYSSLYSSFDEAKTHNNDYIQSVARCLQMMLRVDEYRFAFLSVDG---ISTLLSILASRVNFQVQYQLVFCLWVLTFNPLLAEKMNKFNAIPILADILSDSVKEKVTRIVLAVFRNLIEKPEHCIAMVQCKVLKQLSILEQKRSDDEDIMNDVDFLNERL 392
43 7.000e-57UniRef50_K5XHD3 V-type proton ATPase subunit H n=19 Tax=Agaricomycotina TaxID=5302 RepID=K5XHD3_AGABU  ali  27  7.YLDDHSTKIRNKNVPWDAYQRADLITVEELGLIKKVDRQPRSRVESVLLSEGSTYVHLYLGLLKKVTRTDTQQCLLVWITDALADHEERIPLFFQTSSIDSDPYQPLLRSLDVQDEFIQLKAAQILTMLLSNEKSDA------------------LNQHLQTFLQTLAQLVSSTTQHKR--DVGVQCLECLLARPTVRQAVWAHSA--IIPRLLDILKQNPGPQMSYQVAFCFWLLTFEQNVAEQLDKYDVIPVLVEVAKTA-KEKVIRVIVAAFRNLVTKAPNLPAMLVGQLLPFARHLSQRKFSDEDILEDVQFLKEEL 308
44 2.000e-56UniRef50_U6PBC8 ATPase and Pseudouridine synthase I domain containing protein n=3 Tax=Rhabditida TaxID=6236 RepID=U6PBC8_HAECO  ali  23  20..LQLEAAEVRASKPNWGSYLRSSMIPQEDYNFISAYENKSKEERDAVLSANNGQAVRTYVNLITNVAKDQNVRYVLTLLDDMLQEDKSRVEIFHAARKQKRTVWSWFLGILQRQDNFIVNQMSSIIAKLACFGSTLMEGSELNYYFSFLKDQLKSA-------------------STNEYMNTTARCLQMMLRNDQYRHAFVEAEG---IQSIVAALNGKANFQLQYQLVFALWCLTFSPDIARRTPALGVIQALGDILSESSKEKVIRIIMATFSNILRKKEAALQMVQCKTLKTLELMDAKKYDDTELEEDIEFLSEQL 328
45 2.000e-56UniRef50_T1G4E5 V-type proton ATPase subunit H n=5 Tax=Protostomia TaxID=33317 RepID=T1G4E5_HELRO  ali  21  6..LQAKAMEIRNTRVNWQSYAQGRMITPDEFDIIIKLD--SAASRGETFKNMPTQCIATLLSMMSKIAKDQTVQYLVTLIDDILQEDKSRVELFRQYTKNKESIWKPFFDMLHRPDSYTVNQASRIISKIACWGKIPMPSQDLNFYLHWLIKDQLRAQG-------------------NEYLQSVVRCLQMLLRLPVYRQHFVELKGVETINDLL---HSKTGYQIQYQLIFCLWILTFDVSIANKISRYGVIPVMSDILSDAAKEKVIRIILATFRNLLEKPSNSLAMIRCKVMKQLSLLETKKYEDIDIMEDIQFISGTL 310
46 2.000e-56UniRef50_H2Y8C4 V-type proton ATPase subunit H n=1 Tax=Ciona savignyi TaxID=51511 RepID=H2Y8C4_CIOSA  ali  26  24NTLKSQAEEVRKHRVNWQSYLQGQMIQQQDYDVIQEFDAKSANARQELLNRRGEECARTFISLMTRISKEQTVRYILTSVDDLLSEDPQRVVLFKDNKKRTSS-WIGFMNMLNRNDRFIVHQASRIIAKLACWGKDRMNSQDLGYYLNWIKTQLA--------------------NEMTDYLQSILSSLQMMLKVQTYRAVFFEMDG---LSSLMAVLQTKCGFQIQYQTIVCIWLFTFTPALVAKMVGFNPVPLLVDILGEAAKEKVTRIVLATFRNLIEKPEFSLAMIHCKMMKNLEILEGKQFADDDITSDIEYLSNHL 329
47 2.000e-56UniRef50_A0A1X2H5L0 V-type proton ATPase subunit H n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2H5L0_SYNRA  ali  25  48.YLDAMTEKIRQESIPWECYSSVGLITADEVAMIRHIENKPAEDIDTAMNEHGIHYAGMFLDLLQKMARVDALQKVLVLIQDMLNGHVERISLFHQASRDRPDPFGPFQKALRINDEFIGLQASKFLALLICSTPKS--------------------DLDMEEFFRWMTFQLQSRN--SELIELNVQILDAVFHVPAYRKVFWNTLHAVD-TLVNIMKTGSNNPQFVYETVFAIWLLTFDEEVAIHLNKYDVIPTLIEIAKCAVKEKIIRVVVATFKNFIEKAPNLSAMLVSKLLPFVEHLSNRKWADQETVMDLEFIRENL 349
48 3.000e-56UniRef50_M7WZ34 V-type proton ATPase subunit H n=5 Tax=Rhodotorula TaxID=5533 RepID=M7WZ34_RHOT1  ali  25  8.FLSDRSLKIRSKAIPWDGYQRAGLLDVDDVKLVQRV-ASSRDKAEFILDAEGETYAALYVRLLNKLSRNDTLQFILVLVGDFIADRDERISLFFDGTA--ETPYPSLLKLLDSQDDFVRLKSSAIVSTILPYDPQPSDQVVA-------------------KVLQHLANLVRSPNDP-EGQDVAVQCLESVLRVAKAREMSWDANASKVIEGLVQLLRAHPSPQMQYQLAFCFWLLSFDQTVAEQINRYNVVPLLLDLAKQAIKEKIIRIVVSTFRNLITKAPNLAAMLTVKVLPWLQTLQGRKFGDEDIKEDVDFLVDEL 313
49 4.000e-56UniRef50_A0A224Z3E3 V-type H+-transporting ATPase subunit H n=1 Tax=Rhipicephalus zambeziensis TaxID=60191 RepID=A0A224Z3E3_9ACAR  ali  22  30..LHQRANEIRQQRVNWQSYLQSQMITQEDYNFIVALDQSTPESRANLLKQQRLQSAKTFFNMLGHISRDQTIQYILILIDEMLQEDKSRVEIFKEYCKKKESVWTQFLNLLNRPDGFIVNMTSRIIAKIACWSRELMEGSDLQHYLTWLKDQLRM--------------------PNNDYIQSVARCLQMMLRINEYKLAFVAIDGISTIVTVLA---GRVNFQIQYQLTFCLWVLTFNVDLAKKMSKYNIIPILADILSESGKEKVARIILATFRNLIEKPDNAIAMVQCKVSRQLEILQGKKI................ 319
50 5.000e-56UniRef50_A7S0D1 V-type proton ATPase subunit H n=7 Tax=Eumetazoa TaxID=6072 RepID=A7S0D1_NEMVE  ali  24  13..LVADAVEVRKQTVNWQSYVHGKMISQEDYSMIADYDCMDPVERAKIISDRGDQLAKTCLSLLVKLTRDHTIRYILVLIDDMLNEERSRVAVFHDFGKKNNNLWGSFLNLINRQDQFIVHQAGVIVAKLACWGNVRLPESDLNF------------------FLSWLKNQLTSPTC--EYLHSIALSLQLMLRVESYKEAFFKLEGINSIVATL--LRNKIGFQLQYQLIFTLWLLSFDPRIAERMVGNNVIPVLADILRDSDKEKVTRIITATLRNLLDKPESAVSMIQSKLLPVLSILNGKTWADEDIKADIEYVYEKL 317
51 1.000e-55UniRef50_A0A238FHE2 BQ2448_3011 protein n=1 Tax=Microbotryum intermedium TaxID=269621 RepID=A0A238FHE2_9BASI  ali  24  584.YLSDRSLKIRSKAIPWEGYQRAGLLSQDDVALIQRVAGGKAQAESTLPIQEADTYADLYVRLLSKLSRNDTLQYILVLVADFLNDKDDRIPLF----LSQSDPYSPLLKHLDSQDDFVRSKSAAVISTVISGDPNPPDAVV-------------------TKVLAALSALIRNP-ADSEAQDVGVQCLGSALRIEKVRTAAWQADAKEGAETSKTILRTNPSAQMQYQLGFCFWLLTFDTPIAEQINRYNIIPLLADLARQALKEKVIRIVVAAFRNLVTKAPNLPAMLVAKLLPFVKTLASRKWSDDEIKEDVEFLVEEL 924
52 2.000e-55UniRef50_A0A2K6EVG4 V-type proton ATPase subunit H n=17 Tax=Euteleostomi TaxID=117571 RepID=A0A2K6EVG4_PROCO  ali  22  17NIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEKRSPEEKQEMLQTEGSQ-----------------------------ENHQRVSIFFDYAKRSKNTAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQLS--SQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFHNFLEKSEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKL 312
53 8.000e-55UniRef50_UPI000BE141E6 LOW QUALITY PROTEIN: V-type proton ATPase subunit H-like n=2 Tax=Varroa TaxID=62624 RepID=UPI000BE141E6  ali  24  70..LHQKALDIKQQNVNWASYKQMHMITQDDYQFLTSYEQATNAEARTKLEQARQQCAKTLCSLVANISKDQTVQYLLILIDDMLEESPDRVDLFRDYTRKHESVYAPFLDLLGRQDGFIANMAARIIAKIACNGRLRMEDPDLSKYLIWLRNQLKL--------------------PNNEYVQSAARCLQMMLRIDDYRKPFDAVNGINTIVEVLRV--GQLNFQMQYQCTFCLWVLAFNGPLCARMSQMNIVPVLADLLTQSQKEKVTRIVLATLRNFLEKPENSINMIQCKVLKNLVNLQQNPREDPDVAEDITYLVEKL 378
54 2.000e-54UniRef50_F5HAZ8 V-type proton ATPase subunit H n=25 Tax=Tremellomycetes TaxID=155616 RepID=F5HAZ8_CRYNB  ali  27  16.YLDDQCNKINAKPVPWEGYQRAKLLSADELSLLKSLSKLPSAQRPTVLATQGPQYAKLYIDLLRKLQRVDTVQAVLVSISDMLADNSTIPYFHNLASPEHPDPYGPIVKCLSMDEEFPVLGSLRILSLLIATDPKPFPNDLVPTLLS--------------------SLQKLLNGSRLPLWEVAAQVLGAVLGTKQFRKFVWNEE--NCLSGLIKSLKTNPNPQAQYWAITCLWQLSFEKEVAENLDKYDVVAILTDIAKAAVKEKVTRVVVATFRNLLAIAPNLPSMFVTKLLPFIVSLQSRKWSDEEIVEDLDYLKDEL 318
55 3.000e-54UniRef50_A0A0C9LXQ9 ATPase, V1 complex, subunit H n=2 Tax=Mucorineae TaxID=1344963 RepID=A0A0C9LXQ9_9FUNG  ali  26  43.YLDDMLDKIRATEIPWEDYKNSGLITEDEVAMIKHVEDKNVDDLGPIMSEHGLYYAALYLELMQKLARVDALQKVLILIHDMLDGNEERIALFHAAGKDTEFPFEPFHKALRIGDEFIGIQSSKILTLLICSTP--------------------QRDVDIHEFFRWMTFQLQ--SQHQHVVELNVQILDALFHIPAYRQAFWRTSHAILVSILKNASSRNLGPQKIYELTFAIWLLTFDTEIAKNLDKKCIVPTLVELAKSAVKEKIIRVIIATFRNLIEKAENMSAMLVAKLLPLCEHLATRKWTDQEIADDIEFTRAEL 347
56 4.000e-54UniRef50_A0A158QZP8 V-type proton ATPase subunit H n=1 Tax=Nippostrongylus brasiliensis TaxID=27835 RepID=A0A158QZP8_NIPBR  ali  22  21..LQLEAAEVRSSKPNWGSYLRSSMIPQEDYNFISAYENKNKEERDAVLSANNGQAARTIVNLITNVAKDQNVRYVLTLLDDMLQEDRSRVEIFHAARKQKRTVWSWFLGILQRQDNFIVNQMSSIIAKLACFGSTLMEGSELNYYFSFLKDQLKSA-------------------STNEYMNTTARCLQMMLRIDPYRHAFMEAEG---IQSIVAALNGKANFQLQYQLVFALWCLTFSPDIARRTPALGVIQALGDILSESSKEKVIRIIMATFSNILRKKEAALQMVQCKTLKTLELMDAKKYDDSELEEDIEFLSEQL 329
57 4.000e-54UniRef50_A0A1U7LSB5 V-type proton ATPase subunit H n=1 Tax=Neolecta irregularis DAH-3 TaxID=1198029 RepID=A0A1U7LSB5_9ASCO  ali  22  10.YLEELAANLRARPIPWEGYQRAGLISEVDLKKIKAVDGNNRGRRLQVVQEDGIGYAELTLGLMQKTKRIDIQQYVLVLAGDLISEVDGWVNVLLSLQENNSDPYSPLLKLL-----FQDVWLAYLCRHLKSDDESV-TLLAAKVLAFVLSADPNPPIDVMRSFLEYAANL--NASRDTVHQDLAVQAYSGVLKSDEVRLLFWEIEKCPTN-LIVALKKNNGGVQLQYNILLVIWLLSFQPSLAREVNKYDVVLLLSDILKSAIKEKITRVALAIFRNLIKNAPNLLAMLVARVLDLTNNLAKRKWSDTEIIEDLQFINEEL 325
58 7.000e-54UniRef50_A0A151VH41 V-type proton ATPase subunit H n=3 Tax=Agaricomycetes TaxID=155619 RepID=A0A151VH41_HYPMA  ali  23  10.YLDEHSSKIRAKPVPWEGYQRADLITAEELTLIKKVDKQPRARVESILLSDGPTYALLYLRLLKKLQRVDTMQCILVLIADALADHDERIPVFLRTVESDPDPFYPLLRYAQII-LSTTVSLRIGSRTLDTQDEFVQLKAAQILTVILRLRSTPLPSQHLKPFLDTLAALVQGPSQNKR--DVAVQCLESLLARRECRQAIWAVPG--IIAGFLEILKHKPGPQMSYQVAFCFWLLSFEQNVAEELNKYDVIPLLIDIAQGAVKEKVIRVIVATFRNLVTKAPNLPAMLVAQLLPFAKNLCTRKWQDEDILEDVQFLRDEL 353
59 2.000e-53UniRef50_A0A167FH48 V-type proton ATPase subunit H n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167FH48_9ASCO  ali  22  24.YLEEIQSNIRVRPIPWEGYVRANLITTEEASLIKTIEKLPKDKSVAIIAKDSDIYAAKLIGILSRITRDDVVKYILSLVGDFASDSPEFRESLL--GLKDPQTFDVLTKLLDKPDEQTHLLSIKALITLIGQSSDDKSAV---------------------KLALAYISKKLASSPNANLQDIAVQAYSSLLQVKKFRPLFWESRNEIVPSLIKILNASQGNLQLQYYTLLVFWLVTFEKQPAADVVTFDLVPTLLNITKNSVKEKIVRLAVATLVNTINNASSVPALLSHSCLELVKTLAERKWTDEELIEDLDFLKTTL 324
60 2.000e-53UniRef50_Q9V3J1-2 Isoform B of V-type proton ATPase subunit H n=54 Tax=Arthropoda TaxID=6656 RepID=Q9V3J1-2  ali  23  21..LQQQAADIRTRTINWASYMQSQMISEEDYKAISALDKS----RASFLAQNSSQVVKTLLNLVSHLSKDSTIQYILVLLDDLLQEDRSRVDLFHDTAGKKQCIWGPFLNLLNRQDGFIVNMSAKRTQTILVHTHGKDKDHHGHQYSPTXXXXXXXXXXXXXXXXXXXXXGVGSDHQNNEYIQSVARCLQMMLRVDEYRFAFVGVDG---ISTLIRILSTRVNFQVQYQLIFCLWVLTFNPLLAAKMNKFSVIPILADILSDCAKEKVTRIILAVFRNLIEKPEHCIAMVQCKVLKQLSILEQRRFDDEDITADVEYLSEKL 395
61 6.000e-53UniRef50_A0A1C7N3S4 V-type proton ATPase subunit H n=13 Tax=Mucorales TaxID=4827 RepID=A0A1C7N3S4_9FUNG  ali  24  43.YLDDKLKALKETMVPWSEYEKIGLITADEVAMIEHVENKTAEELVPIMAEHGLYYAALYLDLMHKLARVDTLQKVLVLIHDMLDEHEERIELFHQAGSKVTDPFGPFHKALRIGDEFIGIQSSKILTLLICST--------------------SQRDIDIYEFFRWITFQLQSPHQH--IIDLNIQILDALFHIPEYREAFWKTTHAILVNTLRKTQEKNAGPQKIYEIMFALWLLTFNKTIAENLDKCRIIPTLVSLAKFAVKEKVVRVVIATFKNLIEKAPNIPAMLVAKLLPLCEHLGTRKWNDQEITEDIVFVQEEL 347
62 6.000e-53UniRef50_A0A0R3R4C5 Uncharacterized protein n=1 Tax=Brugia timori TaxID=42155 RepID=A0A0R3R4C5_9BILA  ali  22  25..LQLEAADVRSNKPNWNSYLRSQMITQEDYDFITSYESKAKQSRDELLESNKMQCAQTMINFITTVAKDHNVRYILTLLDDMIMEDKSRVEIFHSYRRNKRTLWSWFLGILQRQDAFIVNQMSSILAKFACFGMTLMEGSDLNFYISFLKDQL--------------------KTPRNEYINTTARCLQMMLRIDEYRHTFLAMDG---IASILSVLSGKTNFQLQYQLIFSLWCLTFNPAIAEKFPHTGAIQILGDILSESTKEKVIRIILGTFRNILEKREAALQMVQCKTLKTLELMDSKKFDDDELNDDVEFLDQKL 349
63 7.000e-53UniRef50_A0A2W1B5Z1 Uncharacterized protein (Fragment) n=2 Tax=Helicoverpa armigera TaxID=29058 RepID=A0A2W1B5Z1_HELAM  ali  23  8..LQIRASEIRQTQINWQSYLQSQMITQRDHDFIVNLDQRGQKE---LPDRNPETCAEVFMNLLTHISKDHTIQYLLVLIDDILSEDKSRVKIFREARSLGN-PWQPFLNLLNRQDEFVQHMTARIIAKLACWHPHLMEKSDLHFYLSWLXXXXXXXXXXXXXXLKPLEDLPPGLHKNNDYIQSVARCLQMMLRVDEYRFAFLSVDG---ISTLLSILASRVNFQVQYQLVFCLWVLTFNPLLAEKMNKFNAIPILADILSDSVKEKVTRIVLAVFRNLIEKPEHCIAMVQCKVLKQLSILEQKRSDDEDIMND........ 370
64 8.000e-53UniRef50_A0A0L0SRN1 V-type proton ATPase subunit H n=3 Tax=Blastocladiales TaxID=4805 RepID=A0A0L0SRN1_ALLMA  ali  27  43.FFDDLTRQVQAKPVPWDGYVRASMISAADVAMIQAYEQESRQGKKDLLATQADAYAALLLRLLGALVREETVQYLLALVDQILDENEAFAAALFQQSKSDPSPLAPFLKLLQKDEVYAALAVSKIISFLLCTSPHPVEPNVATDIFDHLVKLLSHKNA--------------------NIVDFAVQIVQSLLSKVDLRVPFFDFQGGKLVSSLINVLMTQTSPQTQYQVLFCLWNLSFEPDVAKEIQKFNIIPTLVDVAKGANKEKVIRMVLAFFRNLIHHAPNTVPMIGSKLLPFLDVLRQRKLQDTDLVDDVDALQQHL 347
65 4.000e-52UniRef50_A0A1Y2BAU4 V-type proton ATPase subunit H n=2 Tax=Tremellales TaxID=5234 RepID=A0A1Y2BAU4_9TREE  ali  25  16.YLDDQCGKINSKPVPWEGYQRAKLLSADELGLLKSLAKLPPGQRFTLLSTQASQYAALYINLLRKLQRVDTVQAVLVSIIDMLSD-PSTIPAFHALRSSSEDPYGPLVKCLGMEEEFAVLGALRILALLIATDPKPFPESLMSSLLTSLSSLLNGT--------------------RLPLWEVAAQTLSAVLGTKQFRLAVWEEE--QCISGLVKSLKINPNPQAQYWAISCLWQLSFEQAAAKGLDKFDIIAILINVAKAAVKEKVIRVVVATFHNLLYIAPNIPSMFVSKLHPFVVSLQSRKWSDDEVVEDLDYLAGEL 330
66 4.000e-52UniRef50_A0A0D2X0D2 V-type proton ATPase subunit H n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2X0D2_CAPO3  ali  28  10.WLEDAARQVRGRQIAWDGHQRAGFITEEELDMIRRYDNKGAATQNELLATQGQKYGALFLHLLGKITADQTVQYLILLVDDLLSESRDRAKLFHACNTASDGPYAPFLSLLRSRDAYTRYASNKILSVLLSTGRPLDTRSVSFYA-------------------AWLSNELT--SADESSLSVVLSALQAILSVEQIRNAFYSETKGVEL-LIDVIDRRRPNFQIQYQVVFCFWLLTFTPSIADTITIHPVVNTLSLILKGTTKEKVVRIILATLRNLLEKKHNAAQMIGAKVLEAVTLLQTKQYADEDMVEDIKFVLDEL 314
67 1.000e-51UniRef50_T2M3M3 V-type proton ATPase subunit H n=2 Tax=Hydra vulgaris TaxID=6087 RepID=T2M3M3_HYDVU  ali  22  27..LETKLIEIRAYRVNWESYLQGDLIQKSDYQFINHYYQQNSQEREKLFQQDPDQCVLAIWSILTNVAKEHILQYTLVMIDDILSNSKGNAKIFYEAAKKNSIIWSSLINLLMRDDQIIMHMASRLIAKFARLSRHYITDSDLTYYINWLKVQLAV--------------------PGNEHLQSVAECIQWILQVDEYRLPFVEANGINSIVSVL---LSSLGFQLQYQLIFSLWMLSFHVKIAGIIADGNVITVLADIMRNSEKEKVTRIIIATFRNLLEKAEAAVSLIHCKLLPLFDILAKKNWGDEDIREDIEFITEKL 328
68 2.000e-51UniRef50_A0A2K6EVF4 V-type proton ATPase subunit H n=8 Tax=Bilateria TaxID=33213 RepID=A0A2K6EVF4_PROCO  ali  22  17NIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEKRSPEEKQEMLQTEGSQ-----------------------------ENHQRVSIFFDYAKRSKNTAWPYFLPMLNRQDPFTVHMAARIIAKLAAWGKELMEGSDLNYYFNWIKTQL--------------------SSQSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEKVTRIILAAFHNFLEKSEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKL 294
69 1.000e-50UniRef50_A0A2C9M5X7 Uncharacterized protein n=4 Tax=Protostomia TaxID=33317 RepID=A0A2C9M5X7_BIOGL  ali  25  14..LQEHAEVVRKNNVNWKSYLQGQMISSEVYEFISKFDIAKPEEKTLMLQNNPTQFVTVFRMLMEGISRDQTLQYVLTMLDDVLQADKSRVEIFKDARRNKENVWQPFFHLLDRDDKFIVYQASRIIAKIACWSKDQME------------------RKHLQSYLVWLKEQIKLPN--NEYLLSAGRCLQMMLRINNYRIVFVEVDG---ISAIVQVLASNPSFQVHYQLVFCLWCLSHNPSLAEKMNRGNIIPTLADVLSDAVKEKVTRIVLATFR............................................. 266
70 2.000e-50UniRef50_Q6C6K9 V-type proton ATPase subunit H n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6C6K9_YARLI  ali  21  9.YLDEIQTAIRSRPIPWDGYVRANLLTPDEAALIKTIEKQSPEARKETVKKDLTHYATSFVSLLRKIPREDVAKYILSFVASLVQELPEFAQAMLELSKLDSDPFGPLLKLLESEDEQIQLLAVKSIVVLLADS-----------------KTVDLTTEKYAAQYLQFVGLLIGSSASVQVQDVGTVSLAVLLSNRSYRPLFWKFNSELVPKLLDIIKADKGGLHLQYYTLLVIWLESFDNKAAHQLVSSELIPTLLQAARTSVKEKITRLCVAIIVNVLKAAPTVASLLLNQGQAVFKNFSDRKWTDEELIEDIEVVYTQL 317
71 4.000e-50UniRef50_A0A1S8VJK4 Uncharacterized protein n=2 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8VJK4_9FUNG  ali  26  146.YLLGLTNDIRSRTIPWEGYQRAGLITESELAQIRQFEKSPSTA----LSQAGGDYVNLFVALLGKLVRADTLQSILTLLGDALRESPESADLFF---KDGKQPFVVLFRLLKKDDEFVQLKAMSLSTQLALKYAKTHAPIDASDPLNWIAFSL--------------------TSSNPNIVDLASQFLQELLSVVEYRQSFYDLPGGME-SLVGAMQKTPITAQLQYQLVYSIWMTSFSENVAKDIRKHKIFHLLADMARAAIKEKVVRVVVSTIRNLMTKAPNITAMLGNKILGLCETLATRKFSDTEINDDLQFVVEEL 441
72 5.000e-50UniRef50_A0A1D1VTB4 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1VTB4_RAMVA  ali  23  110...SVKAAKMRTMYVNWGTYLQSHIITQDQFDCITILLTYGRQKREELWNKHGIQCARLLVEMTSNISKTPTVQYLLTVIDDLLQEDRLRIEAFHAYARKGRRGWDLFLPFLNRDDAFLVHQAARIIAKMACWSAH-----------------VSMKHPEITMYLSFLKAQLQSP--ANEYKEATLRCLQMMLRIEDYRRAFVTLMGVNTLVEVMD---NNTSFQVQYQLAFCLWCLSFGRELIADLYESKTAEVLCKTLANTLKEKVVRIAVATLRNMLEIPNIATTMIHCRLMKTLQHLKSRQFADEDVNEDIDFLWEVL 415
73 9.000e-50UniRef50_A0A1I8CFP5 V-type proton ATPase subunit H n=2 Tax=Chromadorea TaxID=119089 RepID=A0A1I8CFP5_9BILA  ali  21  22..LQMEANEVRTRDPNWNSYLRSDMITQEVFDFVINYEKATSKESSQFIIENKDILANTFVSLISSVSKVPLVKYSLVMLNDLLHQDKTRSDLF-ATPKADKSIFAYFLPVLNSPDSFVKNQMAAVIAKLACYGSLRLASDELSIYYSVLKDEL--------------------KNKENPYINTVTRCFQMMFRIDKYRVEFVRANG---IYDLASCMNGKINFQLQYQLIFCFWCLTFNEKLAKEVHKAGVIQLLVDVLSETTKEKVMRIILATFRNIIEKIEAALNMVQCKTMKTLELLENKKLEDVDIAEDIEFLQQKL 326
74 8.000e-49UniRef50_E1ZLB5 V-type proton ATPase subunit H n=3 Tax=Chlorellaceae TaxID=35461 RepID=E1ZLB5_CHLVA  ali  42  9..FQADSLAVLRRDIPWDIYQTARLITDRDLQLLRRFDKKDAAFQAKLLEESGPSYVEAFLAVLKNVTKDETVQYVLAMVEEMLAEDPARAKLFHVLSSTGPDAYQILLRLLHRNDWFTQEKACLLLTEVLASRPDPASADGASSSAGALPAAVEEVQKAAATFIDWLCAQLRRPSDPSRAVPTAVHAFSRLLREPPLRAMLHRAGGVQLLAPLVAMPAHGSNIQLLYEATLCCWELSFYRPAADVLCSTNVVGALVDIVRQAQKEKLVRVALMALKNLISVGPTSLAVVEKGLPKALSNRALQHWDDQDIPDLLDWMGEHL 346
75 9.000e-49UniRef50_A0A2P6NL61 V-type proton ATPase subunit H n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NL61_9MYCE  ali  29  34DQLRQTEEKVMGQTIPWEGYQRANLITDKEQELIKNYDKKSPEARVGIFQKEGDVYAELFLNLLVKINKAETLKYLLTLIEQIFRDYPPAIQHFLRLSTETNSPYEPALRILSRSDWYTNAKASFILASLM-------------------GKSNHVDADSIKTFCNWLRDNLKKNDEKE--VNNAVAASMKFLNNEKYRSIFAAEDTLASLSSLLKT--KTKNMQLLYQVIFCLWLLSFNPKVALQISETKLVPNLVEIFRLSLREKVTRVAVATLKNLLDVGNNNEQMITYGIVKPLENATAKNWADEDIKADLAVINQRL 338
76 4.000e-48UniRef50_W6U6T8 V-type proton ATPase subunit H n=1 Tax=Echinococcus granulosus TaxID=6210 RepID=W6U6T8_ECHGR  ali  23 1318..LEGKVSDVRLARVNWQSYLQGQMISQRQFDFISHLDNATTEARARVVNEFKGEVAQLSVSILNRISKEQTLQYLLSMMDDMLKEDTSRVELFRRYFDSKENIWNHFFNFLQRTDLVCVYQVSKIITKFACWSTQQIDEKSLIYFFGWLLENLQK--------------------PGNEYLQTIARNLQMLLRVRDYRSTFVTKQGVDVLIKVLSN--RETNCELHYKLIFCLWCLSFNANLVQVMVKNPLLPAVCDVFCDAEREKVLRICMAFLRSVLEKRECSLRMVQCKALKRLELLSQKDFSDPELTEDLKFLQETL 1626
77 2.000e-47UniRef50_A0A078J4P6 V-type proton ATPase subunit H n=8 Tax=Pentapetalae TaxID=1437201 RepID=A0A078J4P6_BRANA  ali  67  37DQAELSTEQVLQRDIPWETYMTTKLISATDLQLLRRYDKKTESARAQLLEPQPQTYVQLFVTILRDIFKEETVEYVLALIYEMLSANPARARLFHDQSLAHEDTYEPFLRLLSKGN------CRKILAWIISYRPK--ASVIANGEASGSKKHITTIDDLLSGLVEWLCAQLRQPSHPTRGAPVAISCLSTLLKEPVVRSLFVQADGVKLLVPLISPASTQQSIQLLYETCLCIWLMSYYEPTIEYLATSRTMLRLTEVVKSSTKEK---------------------MVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEDL 330
78 3.000e-47UniRef50_M7NQX3 V-type proton ATPase subunit H n=3 Tax=Pneumocystis TaxID=4753 RepID=M7NQX3_PNEMU  ali  22  18.FLEDLLSSIRSRPMPWEGHQRAGLITQEDTKKIKALDWQPKKGRSTVLLKEGKEYAELFLRLFQHLQKIDLLQYLLTLCTDLLDDIPEFSNILLLYKNKENLPFSPLLRLLKHDDQVISLLSGKIITTLISSAP-------------------LIPINILSRFFEWISSLCQ--SSDLNIQDLATQALIEVVKTSFNRLQFWKESSYMQN-LICILKNNHDNLQLQYHTLLVIWLITFEPEISKEINRHSIILILVNLLKNVIKEKIIRVIFAIFRNLLAHSENLSTMLAIKLLPLTETISDKKWLDKEAIEDIDYVKTSL 319
79 4.000e-47UniRef50_A0A1Y2B6I1 ARM repeat-containing protein n=1 Tax=Rhizoclosmatium globosum TaxID=329046 RepID=A0A1Y2B6I1_9FUNG  ali  22  26.YLDDQSAAVREKAIPWEGYQKAALITEEELAQIRLFEKTPADQLKEAGQKNGTTRSRTSLSSLKTGFWVWLLPHFIGKKNSDHAGNPDHTAIV--APLDPNVLFGTFVKLLQKDDEYIQLKSAKIFATLALFRKEPSLPAV-----------------DVHDLFHWLT--VKLTDTNLNVVDIAIQILQTLLAVPAYRLAFYQTTGA-VNNLIDAVKNNSSNPQMQYQGIYCMWTMTFVQEIAADIQRSYVIPLFIDVAKSAIKEKVVRVIFSTIKNMLTLAPNIIPMLGNKLLQLTETLSARKWSDTEIAEDLTFIKEEL 339
80 1.000e-46UniRef50_A0A2P6VQS3 V-type proton ATPase subunit H n=2 Tax=Chlorellaceae TaxID=35461 RepID=A0A2P6VQS3_9CHLO  ali  44  9..FQADSVAVLRRDIPWDIYQTARLITDRDLQLLRRFDKKEASYQAKLLEESGPSYIEAFLTVLKNVTKDETVQYVLALLEEMLAADSGRAQLFHVLSTTGPDAYQILLRLLHRNDWFTQEKACLLLTAVLESRPNKADLRVAAAAAAPSNAGAEEVHKAAAAFVDWLCAQLRRPSDPSRSVPTAVHALSQLLREPPLRVMLHRAGGVQLLAPLVTMPPQQMNIQLLYEAALCCWELSFYRPAADVLCSTNVVGALVDVVRLAQKEKLVRVALMALKNLISVGPMSLAVVEKGLPKAVSNRALQHWDDSDIPDLLSWMEDHL 356
81 1.000e-46UniRef50_A8HQ97 V-type proton ATPase subunit H n=8 Tax=Chlorophyta TaxID=3041 RepID=A8HQ97_CHLRE  ali  35  19.......SDILAREIPWETYATARLVTDKDLQLIRRYDKRSSELKNSMLDESGPAYVEAFMTVLKNVTKPETVQYVLAVLIQMLQENPSRARLFHQQSDQHPDPYTVLERLLQRQDWWSQDKACKLLTIVIESRPRKATGAEGDPAETHISLFLDW-------LVSQLNSRANLAKNPPAVINTCISCLAALLKERATRQLLLRAGGLQVLPAVIRARETPSGSQLLYETCLCVWQMTYLRQAAEVMGQVGIIKQLVEVCRVAQKEKVFRMALAALRNLLGYQDLASDMVEAGLNKVVVTRQMQSWGDEDVVEMLTYVDEKL 334
82 1.000e-45UniRef50_UPI000D77FCA5 ARM repeat-containing protein n=1 Tax=Ceraceosorus guamensis TaxID=1522189 RepID=UPI000D77FCA5  ali  24  48DWLLSLSSRIRSRPIPWEGYQRADLVSSEELRMIRSIDATSSTSKEETMEKQGNAYAQLYLRLLAKLGRTDTIQQVLVLVTDMLKDHDERIELFKHVPAPQEAPWAPLIKLLDVTDDFVQLKAAHISKSSATKPPQQAIERLLDFLSLLINTGGASGAAALHPSRALAAPSATTGYAEGNGADVAIQLLQALLRDGALRQQVWSHQTPGIISGLTSILRATISAQTTYQVIFSLWLLTFAKDIASSLNFTGTISLLVDVARGANKEKVVRITLATLRNLLSKAENAKAMLGAKGLDLIAALKARQWGDEEIKEDLDAIGEVL 445
83 2.000e-45UniRef50_Q20666 Probable V-type proton ATPase subunit H 1 n=9 Tax=Caenorhabditis TaxID=6237 RepID=VATH1_CAEEL  ali  24  13.HFQKEADKVRAMKTNWGLFTRTRMIAQSDYDFIVTYQQANEAERSTVLSVFKEKAVYAFVHLMSQISKDDYVRYTLTLIDDMLREDVTRTIIFEDAVLLKRSPFSFFMGLLHRQDQYIVHITFSILTKMAVFGNIKLSGDELDYCMGSLKEA-------------------MNRGTNNDYIVTAVRCMQTLFRFDPYRVSFVNINGYDSLTHAL-YSTRKCGFQIQYQIIFCMWLLTFNGHAAEVALSGNLIQTISGILGNCQKEKVIRIVVSTLRNLIMKKQAALQMIQNRIPTKLDHLENRKFTDVDLVEDMVYLQTEL 322
84 4.000e-45UniRef50_A0A137PEJ4 V-type proton ATPase subunit H n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0  ali  26  12.FFDELTLNIRERPMSWEGYQKASLITESELDLLRTFETTPNKSDNQESEPVSETYLLLLLDLLNKLVRVDTLQYILVLIDDILDANPENIKIIQNLKNSRQGPIEPFLKCLHKDDDFLALKAEKILTALISTSEEVYSPA-------------------LQPFLDSLVLQLSSKTP--NVADITVQILQSLLKNVSYRFQFYSHQGISGLINLLKS--DQLNPQIQYQILFCIWILTFQTKIANEIQKFNILPILSNIAKSTVKEKIVRVIVGTFKNLLERSPNIQYLLNFKIHQLSDTLSQRKWTDEEIVEDLEYLKENL 316
85 4.000e-45UniRef50_A0A1E4TCN3 V-type proton ATPase subunit H n=1 Tax=Tortispora caseinolytica NRRL Y-17796 TaxID=767744 RepID=A0A1E4TCN3_9ASCO  ali  21  8.YLNEICSNIRARPVPWDGYIRTDVVSQADAELIKQIEKLSDEQKKAAVAASPLPYVKTTAALLTKTSRPDILQYALVLLSDLLDLSSDFSEAIYSSKSDKMELYAVLLPLLDHSDEHVWLTCSLATTAVLKDDPNPPKDVVEKFFSFNIS---------------------QSKSTDANLKDLSVQIYGSIIQSQSIREQLWAASKS-TIPPLISFLSAQSSIQLTYHTLMVFWILTFYPKASAELDEFDIIPILLRTLKSAIKEKIARVCVAILVNMITLAPNQVVILSHHGLTLLRSLMNRKWSDPELQDDLETLIAHL 309
86 9.000e-45UniRef50_Q8MML6 V-type proton ATPase subunit H n=6 Tax=Dictyostelids TaxID=33083 RepID=VATH_DICDI  ali  29  20.....RTKVVLAREIPWNGFASSNSITSEQYNLISKYDKHTDAEKKEKFAANSASYVNFFVNFINSTSNIEIIQYLLTLINEIIEIDPRAAGAFSKITKDDDKPYSVFFRLLNREDAYTNLHASIALAQIMCAGKPTQNDVES--------------------FFNWILKLLRKNNSSE--VEVGLIALQSLLLKDDFRIFFNNIDGSALLLNILQALSTSSNIQLLYETIYAIWLLTYNKDIAAAYSGTGLVANLVQLVKTVAKEKIVRLSLSTLRNLLNNGKSNEEMIDNGFVRMLNILNIKKWGDDDIPADIEVLINGL 317
87 1.000e-44UniRef50_A0A0F7SGI7 V-type proton ATPase subunit H n=1 Tax=Phaffia rhodozyma TaxID=264483 RepID=A0A0F7SGI7_PHARH  ali  21  11.WLSEHSSKIRAKAVPWDGYQRANLVSPSELALLKKIDRQPLAKQQQVFEKEQEVYAGLFEGLLGKLVRVDTVQAVLVGMGDLIGESQDRLNLFYNLQQSSELPFAPLIKAISLSDEFIQLKATQLLTVLISSSPKLVSDSLLSVLANLLQAPSPHSKEIALQSLALLLSVTSIRSSIWALEDTSIPVLSSLSKI---------LRSISGASPAGQGVVRDANPQVMYWVGFCFWELTFDRQVCEGIDKKNLVPHLLSLAQSSPKQKVLRITLATFRNLITLAPNVPAMLAARVAPFVESLKGRKLEDTELEDDLNVLGDVL 331
88 3.000e-44UniRef50_A0A0D9NXT1 Putative aminomethyltransferase n=1 Tax=Metarhizium anisopliae BRIP 53293 TaxID=1291518 RepID=A0A0D9NXT1_METAN  ali  20  8.YLASLQSNIRQRPIPWDGAVRAGTLTEEQYAKIRAVDKAKKEQRKEVVEGDFDGYRLLFVGGPGKPSHANVIQYILVLLGDLIDAVPSLAKALF----KNTDPYRHFLPLLHSNEDPIPLLTSHALTTLMSLSRDESKAVVFTYLSGLAKSTDAGLQDIAVQEYSALLFGRSSRHKFWNQRSETVEPLVKILQTAASAANLWSGNVNVRNNGFEGSLGGGVGLQLLYHVLLVIWQLSFEADEIGDNDEYDVILLYTHLLRLSQKEKTTRLILSTLYNLLEKTSLLPTAVLARLPALLENLGSRHMTDPDLLEDLQSLKELL 351
89 4.000e-44UniRef50_A0A2P5WS96 Uncharacterized protein n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5WS96_GOSBA  ali  67  2..........................................ERAELTTEQDGPAYVQVFVSILRDIFKEETVEYVLALIDEMLTVKLTIHNL-------------STFRLLLKGNWFIKEKSCKILALTVSARPKTQNGVVANGVASNSKTKLTTIDAVLRGLVEWLCTQLKKPSHPSRGIPTAINCLAALLKEPVVRSSFVQADGVKLLIPLICPASTQQSIQLLYETCLCVWLLSYYEPAIEYLATSRALPRLVDVVRSSTKEKVVRVVVLTFRNLLSKGTCGAQMVDLGLPQIIQSLKAQTWSDEDLLEALNQLEDGL 268
90 7.000e-44UniRef50_A0A2H3FAC0 Glycine cleavage system t protein n=2 Tax=Diplocarpon rosae TaxID=946125 RepID=A0A2H3FAC0_9HELO  ali  23  8.YLSSLQNNIRSRPIPWDGAVRAGTITDDQLSKIRSVDKVRKEHRKEVVEGDLEGFRTLFLGIESAAKRGDVVQYILVLLSDLL----DGISALAKALSEHPKPYNAFLPLLQSTDSAIPLLTSTVLTAMIVGAPSFSQKEVS-------------AIPKLSTYLSTLT-----KSADGGLQDIAVLQYSTLLRGKITRQLFWEQRGETPLVDILTAAAGVSNLQLLYHVLLVLWQLSFEGAEIGEDDEFDIISLFTQLLRLSPKEKTTRLLISSLYNLLNRSSLLPAAVLARLPALLQNINGRHFSDPDLLDDLKNLSEML 348
91 1.000e-43UniRef50_A0A2S5B8B4 V-type proton ATPase subunit H n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5B8B4_9BASI  ali  21  8.FLSDRSLKIRSKAIPWDGYQRAGLLNADDVKLVQRIANSQREKADSILDEEGEAYAQLYVRLLGKLSRTDTIQFILVLLGDFIAG-ESLLLAFKGVS-------------LESSDDFVRLKSAAIISTILPYDSSPPSSVV-------------------EQVSRALSSMIRSPNEP-EAQDVGVQCFESVLRVSKARQYAWQQTAPKIVEALVHLLRGNPSPQMQYQLAFCFWLLTFEQKIAEQINRYNLIPLLLDLAKQAIKEKILRVVVSTFRNLVVRAPNLAPMLVAKVLPWIQTLQGRMFSDDEIKDDVEFLAGEL 322
92 3.000e-43UniRef50_A0A2T0FPR9 V-type proton ATPase subunit H n=1 Tax=Wickerhamiella sorbophila TaxID=45607 RepID=A0A2T0FPR9_9ASCO  ali  20  8.YLDEIRSTIRARKVPWEGYVRAELLNAEQASLFKTLEKYPVAEWVKPVSENLQQYVSTTMALLSPPSRDDVVRYIALFVGDVITTIPE----FTTELLADSRCWPALTALLTKPDEQITILTTRVLAVLANSQIAPVDVIAELVAFLGDKFL---------------------TSPNTNLQDIAVQELALLAQTKFYRPVIWEKRSVILPQIIQLAQSPQFGLQVQYYSLLLIWLISYDRTIAKGISEYNSAQTLLETAKISVKEKIVRVSVATLANYVRFSPAIPAIISQRGLQIVNLLSERKWADDELRQDVETLKQQL 306
93 9.000e-43UniRef50_A0A2T9Z2I0 V-type proton ATPase subunit H n=2 Tax=Harpellales TaxID=61421 RepID=A0A2T9Z2I0_9FUNG  ali  15  39.YFDELTNNIRKKPMPWEGFYNAGLITEEEMQTFRALQQAKRNYR--TYPPESANCTKLILVLIQKLHRIEVIQHMLVVLDDILESQEEAVQCFEYSTDQDISVFSLLEKCFESQDEYIGLKACKVIIKLLSTKNPTFEYNFMRIFTFLESLIESENPSVVDVVIQVIQSLMQIRGSRQFLFNEAPSCLKNMKPTMSATLNNCFLEIVNRMCQILNNFMRVTVTQTQYEIGFCLWLLTFDPKIAEVINRYDIIPTLVKIARSTLKEKVIRMMVGILKNMLAFDQNFPNILVSGTQTCLIALNGRKIQDPDLVSDINDFSKAL 371
94 1.000e-42UniRef50_UPI00099F541C LOW QUALITY PROTEIN: V-type proton ATPase subunit H-like n=2 Tax=Euteleostomi TaxID=117571 RepID=UPI00099F541C  ali  21  14NIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIKKFEVAPSEEKQTILTNEGHQCARTFLNLMAHISKEQTVQYILTLIDDTLQENHQRVNIFFDYAKKKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGRDLMEGSDLNYYFNWIKTQLS--SQKLHGTGPDSTGHGTIPSDSSQYVQCVAGCLQLMLRVNEYRFAWVEADGFPSVCRLLCLPLSSFDEYSSEKSGRLEWSEKFWRENAVRLNEKNLLKILTRLLEVSDDPQVIAVAAHDVGEXXTLPRGKRVIEQLGGKQLVMN...................... 321
95 2.000e-42UniRef50_A0A1S9RY85 Uncharacterized protein n=1 Tax=Penicillium brasilianum TaxID=104259 RepID=A0A1S9RY85_9EURO  ali  20  8.YLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDKVRKEQRIQTIEADLAGYTSLLAGLESASRRTDIVQYILVLASDLIQDVPALADSLV-SHPEPYKPFLPFLNTSTNAEDPIPLLTSTFLTALVSHS------------LVTSSKPAQRDEEALPQLYLYLSTL--TKNHDSGLQDIGVQGFSELLRKQHSREIFWNHRTLDPLVETLRAAAGTKDLQLLYRVLLVVWQLTFESSLVELQESYEIIQLYTQLLRLSPKEKTTRLLLATLYNLCVSATLLPVAVFVRLPALLTNLAGRHLTDPDLLEDLNGLSTLL 347
96 3.000e-42UniRef50_UPI000719D5E0 LOW QUALITY PROTEIN: V-type proton ATPase subunit H-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719D5E0  ali  23  29..LQQKAIDVRNNRVNWQSYKQSQMISIEDYNFITMFDNTTAEKRAAILKTHSHQCAKTFLSLMGHIAKDQTVQYILTMVDDMLQVRSKIKYCLFPLYRPTG-----------------QNATSRIIAKIACWNREPMEGADLQFYLNWLKEQLRQSG--------------------NEFLQTVARCLQMMLRVDEYRFAFVSLDG---ISTLISVLAGKVNYQIQYQLIFCLXAFXFNRRLRKGXTTDNIVPILSDILSELDQGEVTRS-----RNLLEKPENAIAMVSCKVLKQLSLLDNHKSDDPDLSDDIAFLNEKL 311
97 1.000e-41UniRef50_A0A0D8Y5E6 V-type proton ATPase subunit H n=5 Tax=Ecdysozoa TaxID=1206794 RepID=A0A0D8Y5E6_DICVI  ali  21  20..LQLEAAEVRATKPSWGSYLRSQMIPQEDYNFISAYEAAKTKEERDVVNDANGQAVKTIVNLITNVAKDQNVRYVLTLLDDMLQEDKNRVEIFHN-------------------------------------AAKRQKRTVWSWFLGILQRQDNFIV-----------------NQANEYMNTTARCLQMMLRIDPYRHAFMEADG---IQSIVAALGGKTNFQLQYQLVFALWCLTFNPDIARRAPALGVIQALGDILSESSKEKVIRIIMATFSNILKKKEAALQMVQCKTLKTLELMDAKKYDDTELEEDIEFLSEQL 292
98 2.000e-41UniRef50_A0A0B7NKN3 Uncharacterized protein n=1 Tax=Parasitella parasitica TaxID=35722 RepID=A0A0B7NKN3_9FUNG  ali  27  17.YLEKKAANIRQKPILWEGYERASLLTHEQVELIKAIDKKPAQAIQDAMDQKGQTYASLILYLLQNLSRPDTIQYVCLMTDDILSANDDNARYFHATSQEDASPFAPFIRILQSDDEFMALEASKVLTILACSAPSSC-SVDLSALFNWMTQKLTGSI--------------------NDVVNLVIQELESLLRVDRYRLSVWNT------------------PNAIKEKLQC---------------------------KSTIKEKVIRVSVATLRNLVEKAPNLAAMLVAKLLPFTENLSARKWSDADILEDIDYIKERL 274
99 6.000e-41UniRef50_A0A0G4LCK1 Uncharacterized protein (Fragment) n=2 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4LCK1_9PEZI  ali  19  66.YLASLQNNIRQRPIPWDGAVRAGTITEDHLARIRAADKKKPEARKEVVEADLDGYRLLFVGEQGKPSAIEVIHYVLVLLSDLLQSVPSLSKALLKSGDPYKS-FLPLLANSNNTEDPIPLLTATALTKLIASSRDESAALLFTYLSGLTKSSDAGLQDIAVQEYSSLLYSRSSRQQFWDQRSETVQPLIDLLRNGSSSASLWSGNAPARDLGFAGSLGGGVGLQLLYHVLLVMWQLSFEAEDIELSDEYDIVLLYTHLLRLSPKEKTTRLIVSTLHNLLESKTLLPTAVLARLPALLTNVSGRHMTDPDLLEDLASLKELL 410
100 7.000e-41UniRef50_D4DLC9 Uncharacterized protein n=1 Tax=Trichophyton verrucosum (strain HKI 0517) TaxID=663202 RepID=D4DLC9_TRIVH  ali  19  8.YLTSLQNNIRARPIPWEGAVRAGNITEEQLKRVKAVDKVRKDSRQKTIEKDVAAYTSLLAGLESATRRTDIIQYILVLAGDLISDVPALTSALVESSESYRH-FLPLLTNSTNSEDPIPLLTSSLLANLVSAS------------LRATSKTSPKDEVALPKLYAYLSTL--TKSADTGLQDIGVQGYSALLRTKRSREIFWKNDTVEPLIGILRAAAGPTGIQLLYHVLLVLWQLSFEADLIGAQSEHEIIALYTNLLRLSPKEKTTRLSTLRNLLSSSKANLLPNAVVVRLPAMLSNLNSRHLSDPDLLEDLSALTEML 347
101 2.000e-40UniRef50_A0A100IHZ5 Unnamed protein product n=5 Tax=Aspergillaceae TaxID=1131492 RepID=A0A100IHZ5_ASPNG  ali  21  11.YLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDKVRKEQRRQTVEGDLAGYVGLLSGLDSASRRTDIVQYILVLAADLINDVPSLSTALV-AHPDPYKPFLPLLRHSTNPEDPIPLLTSTFLTNLVSVS------------LGTSSKPSARDDEALPQLYTYLSTLTQ--NQDSGLQDIGVQELSALLRTSRSREIFWKQQTVEPLIEILRAATGAKDLQLLYRVLLVLWQLSFEGELIDLQADYEFVQLYTHLLRLSPKEKTTRLLLATLNNLSNRTTLLPVAVFVRLPALLTNLAGRHLTDPDLLEDLTFLSEML 351
102 2.000e-40UniRef50_G7DTU4 V-type proton ATPase subunit H n=1 Tax=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) TaxID=764103 RepID=G7DTU4_  ali  22  9..LDLLTERIKAKGIPWEAYARAGFVSNEDVSLISKVSGTRGKAEVT-LSEDTESYAGLFVRLLRDQTRADTLGYVLACITDMLTDHEERTPVLLR-----QDPTPALAKHLDSQDEYVRLKSAALLSTLAAGNEDVTNAIVALSDTLRSASSDRTTLDAEVQSICLQCAGAIFRNPHIRQLALTREISQS-NGDGAGTDTVADGKLIADLVALLRDKTGTLPPQIQYQLGLAFWLLSYERRFCEAHAHYGLVTLLADILKNASKEKVARVVLATFRNLATKAPTLSAMLLAKVLPHLQQLTQSKWSDEEIKEDNEWLIEQL 334
103 4.000e-40UniRef50_A0A0N0RSQ8 V-type proton ATPase subunit H n=3 Tax=Malassezia TaxID=55193 RepID=A0A0N0RSQ8_9BASI  ali  22  26.WLKEMTEHLRGKQTAWEGYQRAQLISADQVPLLRDAEQAGKKGEMAPIKEKGSTYAGLYMQLLDKLNRTDTIQAVLLLTDDLVQAAPEHLAWFVQAE-----PYAALTKLMKMDDAFVSIKAAQFLTLCLCAHAESSDSTPPHAAL------ESLLAYIHRALSSLNSTEAPSDGAKGNVAPIALCLAGELLRTPRFRSAIWAKDGASGTNSSGRASGNTGVPQLHYLALFGLWVLTFDEAAAKDIDTYFGVAVLVHVAQLALKHKIVRLIVSIWRNMLSKEANATRLLGAKVLPLCDTLQERRYPDTELQDDLEYVKSVL 365
104 9.000e-40UniRef50_A0A0P6EZC9 V-type proton ATPase subunit H n=13 Tax=Pancrustacea TaxID=197562 RepID=A0A0P6EZC9_9CRUS  ali  23  76......................................................................................DMNRVEIIREYSKKKENVWSPFLNLLNRPDSFIQNMTSRIIAKLACWSRDPMEGSDLTFYLTWLKDQLQ--------------------TPGNEYVQTTARCLQMMLRDEKYRLVFAGMEGVSVLANILS---GRINFQIQYQLSFCLWVMTFSPQLVEQMNKHKIIPILGDILNDSVKDKVTRIILAVFRNMIEKPENCVAMVQAKVLKQLSILQQHKFDDEDIMADIEFLTEKL 296
105 9.000e-40UniRef50_F4RAW4 V-type proton ATPase subunit H n=4 Tax=Pucciniales TaxID=5258 RepID=F4RAW4_MELLP  ali  20  8.WLEEQDYRIRLKEISWEGYQRASLLSVDDLTLLQAVSGTQKIKRESVWEGNPETYMGLYLRLLSSLTRTDCLQVILVHIGDFLNEHEERSDLLRKLNPSDSTTYLSISKHKDSSDIYIRIKSITILGSLIGADPSPPSQASRAILPGIDQLVQSNDLNEQEIGIQCLDHVLRQPSIRQTLWQSENPSESSKDKNPTPSNSRSAQSGLLSSLTKLVKVGSKLNAQMQYQVGFCFWLLSFDDEIARNLNKYNVLPSLIELTRVAVKEKVIRVLVATFRNLVTKASNIGPMLVTGSLPLIQNLASRKWS............... 318
106 2.000e-39UniRef50_F2QY85 V-type proton ATPase subunit H n=3 Tax=Komagataella TaxID=460517 RepID=F2QY85_KOMPC  ali  22  12.HLDEDKQIARNRSVPWTIYVKSRDITEDEVSKFKVLEKKGIEDKIAIIGNNKDSYATTIVNLLNRTTKDDIIRLLSVLTNDLLIELDGFQELLALNKIDSSLPYAAFSKYLNSPDQVVSLLSSYNLTLLFVLQDKTK-------LADNLKDTTPFINELYQYLFEKLLS-----NDDINLQFIGAQLLKELLSVKIYRDLFWNGPNKWLKDLLNLFENKTSDLQLKYYALLSVWLLTFNKDIVNELPNQHIVPLLLNIAKESVKEKLVRVAVSSLLNLVSVDNNVKVVLLHKGLITVKKLNERKWTDEELKVDLENLLTV. 325
107 2.000e-39UniRef50_E3KJE6 V-type proton ATPase subunit H n=5 Tax=Puccinia TaxID=5296 RepID=E3KJE6_PUCGT  ali  22  8.WLQDQDCRTRIREIPWEGYHRASLISADDLALLQATASQPKIKQEQIWEHDTEKYVSLYLNLLSQLSRVDCLQATLVYLSDMIEDHEERIALLLDHAV---NPYAALTPHLESPDYYIRIKALSLLSVLLEFHPTPPQDVLSTIGPMIARLTGSGDSNEQELGIELFEHVLRQPLARQAVWASAEESGASSNG---------ETTQSNVISSLVQMMKSASTAQIQYQLAFCFWLLTFDVAIASQFNKFSVIPLLTELARSAVKEKVIRILVATFRNLAEKAPNLATMLVAGLLPLIQNFSSRKWS............... 307
108 3.000e-39UniRef50_A0A1E3I3E4 Uncharacterized protein n=1 Tax=Cryptococcus amylolentus CBS 6039 TaxID=1295533 RepID=A0A1E3I3E4_9TREE  ali  25  15.YLDDQCTKINNKAVPWEGYQRAKLLSQDELSLLKSLSKLPPAQRPTVFATQGPQYAKLYIDLLRKLQRVDTVQAVLVSINDMLSDTTNISYFHSLATAENPDPYGPIVKCLGMEEEFPVLGSLRILALLIATDPKPFPESLVPTLLSSLQTLLN--------------------GSRIPLWEVAAQVLGAVLGTKQFRNAVWEEEGA--ISGLIKSLKSNPNPQAQYWAIFSLWQLSFEKKAAEGLDKYDVVALLTDVAKAAVKEKVQRVVVATFKVCLRSGINFI................................... 280
109 6.000e-39UniRef50_A0A183W0Q1 Uncharacterized protein n=1 Tax=Trichobilharzia regenti TaxID=157069 RepID=A0A183W0Q1_TRIRE  ali  19  6...............NISTHSRGQIINEEQYSFINRLDNAPTAEARNHVIRADEQMV-FFTFILNKISKEQTLRYILTLIDDILQEDKLRVEIFRDYFAKKESLWSHFFGFFQRGDPFCMHQASRIIAKFACWSSQLMEENDLIYYLNWLREQLTI--------------------SNNEYDQTVARNLQMMLRIKEYRIQFAKVGGVETIVDVLQ--EKTTSRQLQYQLIFCLWCMSFDSYHVTEICKSALLATVAGIFLEADREKITRISLALFRNNTEQRECGLRLVQYKVLRELELLGQKDFSDPELTDDIAFLNEKL 298
110 8.000e-39UniRef50_A0A1R0H8F9 V-type proton ATPase subunit H n=1 Tax=Smittium mucronatum TaxID=133383 RepID=A0A1R0H8F9_9FUNG  ali  17  45.YFDAVTKNVNRRPMPWEGFFNAGLITEEEMQTFRSLQQSKRNFKDYPVES--TKCTQLILGLLVKLHRIEVIQYLLVLLNELIDTQETSIQCLAYSSDRYSSVYSLLEKNFESHDDYIGLMACKIIIKLLNVQNSPDFTFDFRNMFAYFESKL--------------------DSEDPSVVDVVIQLVQSLLAINGSRQYLFTNSPGCLILLSTQQVIKVSVAQTQYDIGYILWLLTFDQDISSSINKYDIIPSIIKIARSTLKEKVIRIMIFTLKNLFSKAVNLPSMIVSGAQSCLTALNGRKIQDPDLAEEINDLLQKL 357
111 9.000e-39UniRef50_A0A1D1Y3T0 Putative V-type proton ATPase subunit H (Fragment) n=2 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1D1Y3T0_9ARAE  ali  68  45...ELDTQQVLTRDIPWETYMTAKLITRRCLQLLRRYDKRSESNRAALLDDEGPEYIRVFVNILRNISKEETVEYVLALFDEMLTANPKRARLFHDRALASEDTYKPFLRLLWNSNWFIQEKSCKILSLIVSMRPKTENNVLSNGEASHSKNNFTTVDDVLKGLVEWLCAQLKNPTHPTRGVPTAINSLATLLREPFVRTLFVQGDGVKLLIPLIVPASTQQSIQVIE.............................................................................................. 269
112 1.000e-38UniRef50_A0A0M0J4Q3 V-type proton ATPase subunit H n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0J4Q3_9EUKA  ali  23  9.......EDVLRSEVPWPSFASAGMISREQLELIYSLDKQPVRTQVALFHDKPLALAALFNDILTCINKDDVVLYTLVMLDVITDADASIALYFPKLIIETKDPMKPLLKLLSQSPPFIVQKAATVLGKLAGAPAPPGAPEPLVATLN---LHLSSFAEWVVSVLKEVSPSEASESAKTNASMSGLQALVATMRGRKAALAAEVLPPLSMLVTTSTLSSSSTTVQLLYQTLFSLWSLSYSAEAALEMSKVGLIAKLVEITKASPKEKVIRVALSTLRNLLGVANASNDMVFFGLMPVLEAMHARKFADEDIPEEVDYLSQVL 325
113 1.000e-38UniRef50_A0A2S6C6S1 Uncharacterized protein n=1 Tax=Cercospora berteroae TaxID=357750 RepID=A0A2S6C6S1_9PEZI  ali  20  8.YIVSLQNNIRARPISWEGAVRAKTITDEDLKKIKAIDKVRKEQRKQTIENDVQTYTALLLGFESAAKRTDILQYMLVLTGDIVDDIP----ALTESLIKHPHPYKPLLPLLNNPEDPIPLLTSSVLASLLSHA------------LAAQSKSNPEIDEALPKLYSYIAELAKTS--DSNLQDIAVQEYSALLRTSKSRQQFWKQRKETPLMEVLHNATGGKDLQLLYHILMVLWQLSFEGKLVGKDEEHDIVPLYTQLLRISPKEKTTRLLLGTLNNLSNKTTLMPAALPARLPAVLTNLKGRHLTDEDLLEDLESLKN.. 351
114 2.000e-38UniRef50_A0A158QDI3 V-type proton ATPase subunit H n=10 Tax=Platyhelminthes TaxID=6157 RepID=A0A158QDI3_HYMDI  ali  21  24..LESKVAEIREARVNWQSYLQGQMISQRQFDFISHLDNAANADVRS-------RVPQLFVSLLNRISKEQTLQYLLSLMDEMFTEETSRVELFRKYFDSKENIWNYFFNFLQRSDQICVYQISKIITKLACWSSQKMDEKSLSF------------------FYDWLLEHIQESN--NEFIRTIARNLQMLLRVRNYRGTFVEKQGVPVLLKVLA--DKSSNMEIHYQLTFCLWCLSFNKDLVPFMVKEPLVNTVCDIFTNTDREKDLRICMALMRSILTKRAISLRMVQHKALKRLELLNQKELHDPEMSEDLKVLRDDL 324
115 2.000e-38UniRef50_A0A058ZA21 V-type proton ATPase subunit H n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058ZA21_9EUKA  ali  19  12.SLDIQAEQYRTKAIDWDVF------PDVDTTIIKKYDQLNPAQRAKFLEEYSTPLLTALLGFTTKVQYYEAILYTLLLIEDIVERMPNTAGYFIKLQQENANPFGALLHNFEQPNDQIMQKASRLIATLVTSQVPMSSEDYSRFLNILLSLLNPDASGHRDG---------SSMIAPDLRLEIVLQSITLLLLNDAFRVDFYEYKGADSL---VKFFDLSLSAQTQYYIIFCLWLLCFNQSIAQKIKELGIVPILTNLIKSTVKEGHIRVILATFRNLIEKAPNIGPMMDNKLLTVCNSLSTRTFTDEDVVADLQFITEEL 318
116 2.000e-38UniRef50_A0A0L9T5H1 Uncharacterized protein n=1 Tax=Phaseolus angularis TaxID=3914 RepID=A0A0L9T5H1_PHAAN  ali  67  1....................MSTKLISSTSLQLLRRYDHRSESHRAQLLDDDGPSYVRVFVRVLRDIFKEDTVEYVLALIDEMLAANPKRARLFHD-------------STLADEDTY----------------------------------------EPFLRLVKWLCEQLKKPFHPTRGVPTAINCLATLLKEPVVRSSFVQADGVKLLVPLISPASTQQSIQLLYETCLCIWLLSYYEPAIEYLATSRTLPRLIDVVKSSTKEKVVRVIVLTLKNLMSKGTLGAQMVDLQLPQVVQSLKAQAWSDECL........... 238
117 3.000e-38UniRef50_A0A0U1LP91 V-type H+-transporting ATPase 54 kD subunit n=1 Tax=Talaromyces islandicus TaxID=28573 RepID=A0A0U1LP91_TALIS  ali  20  8.YLSSLQNNIRARPIPWEGAVRAGNITDDHLRKIKAVDKVRREQRQQTVEADVNGYTALLAGLELAFKRTDIVQYILVLSADLIGDVPALASALIEHP-QPYKPFLPLLRHSNNPEDPIPLLTSSFLTSLVSTALVSSSQASA------------PEEEALPQLYSYLSVL--TKNQDSGLQDIGVQGFSTLLCNKKARELFWKQRTVNTLMEILRTAAAGKDLQLLYHVLLVIWQLSFEGSLVELHSEHDIIELYTQLLRLSPKEKTTRLATLNNLLTANRTTLLPVAVIVRLPALLSNLSGRHLTDPDLLEDLKSLSDML 353
118 5.000e-38UniRef50_A0A1E4T0E8 Uncharacterized protein n=1 Tax=[Candida] arabinofermentans NRRL YB-2248 TaxID=983967 RepID=A0A1E4T0E8_9ASCO  ali  18  261DFINDIVVRSRSRTIGWESHHRSGALASDEAECLKEIASLETKEKVNLMIKQADLYSTKMIALLARAPNDEIVRFILVSLIETYPGSKFSKNILNISHVDSSLPYDPLVKLLKSDDENIRFVSAYILTSLLVDSDETYTNKESTLSPLYE-----------------FLSVKLLSSPKLELNFLAVQMLKELLTIKPYRLFFWESHTKLFPPLLKIFSERRGELQMKYYATMSIWLLTFNPQALCDIEKYYLIGTLYTVAKDAVKEKIVRLSISSLLNLVRQETVIKQFLLVKGLEITKQLIERKWADDELKADLDALLEIL 573
119 6.000e-38UniRef50_T1KC43 V-type proton ATPase subunit H n=1 Tax=Tetranychus urticae TaxID=32264 RepID=T1KC43_TETUR  ali  21  33..IQQKAAEVRNVRVNWHFYRSGDFISQQEFDWIVKYESLETAERDEFFKKDAMLCAEVFLSLLEKLSKNQATQYILILIDDMLNEDKSRVEIFKEYCKKKRTIWSHMEHQLQKSDGLIQNMASRIITKIACWSKELMGETDLQFYICWLLEQLKL--------------------PNNEYLGSIARCLQMMLRIEEYRKLFISTE--------------------------------------ENMSKNNAIPALADILNESVKEKVTRIILATFRNLIEKPENAITMVQGKVLKQLDILASNKYEDPDLLEDIEFLYEKL 310
120 6.000e-38UniRef50_A0A2G5B2Y9 V-type proton ATPase subunit H n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5B2Y9_COERN  ali  22  16..FDEFTDKVRVKPIPWEGYSRAGLITAEELKQLKDFQQQQQANVATGGNSDLSGYVPLLVNLTEKLSSIDALQYLLVVLDELVETDSSSAAVMANTL---DTTTHAMFRCMEKKDDYLGLKACKILVGVVVAVKGRAADKFPFAKMFAYIERCLKSELTLDVALQVMQSALRVRRARGVLYNEAASCLAQIVDVLKRXXXXXXXXXXXXXXXXXXXXXGTSSPQTQYEAIFCLWLLTFERTIAAMLNKYDVIPVMVEIARSTVKEKVIRVIVGTWTNMLQQASNVPNMLVAKVPACLATLSGRNFKDVDLKEGVSQLAEDL 352
121 9.000e-38UniRef50_A0A2U3DQN6 Uncharacterized protein n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DQN6_9HYPO  ali  19  8.YLASLQSNIRQRLIPWDGAVRARTVTEDQYAKVRAVDKKKPEQRREVVEADPDGYRLLFVGDEGKPSVVETVQYMLVLLADLTDSSPAAVPSLAKSLFKTTDPYRHFLPLLNSNEDTIPLLTAHALTRLMSLARDESRAVLLTYLSGLAKSTDAGLQDIAVQEYSALLFGHVSRDQFWKQRSETVGPLIKILQAADSAASLWSGNTSTRNAGFEGSLGGGVGLQLLYHVLLVGWQMSFEAQEIELNDEYDIVLLYTHLLRLSPKEKTTRLILSTLYNLLNQKSLLPTAVLARLPALLENLTSRHLTDPDLLEDLESLKELL 361
122 1.000e-37UniRef50_D5GAY7 V-type proton ATPase subunit H n=3 Tax=Tuber TaxID=36048 RepID=D5GAY7_TUBMM  ali  19  8.YLSELFLNIRGRSIAWDAHVRAGLITDSDVRKIKAIDKASKEKQVSVVEKDVDGYAALVLSPATDGKRVDVVAYMLVLLGDLLEGVP----AFTDSLLSLPQPFAHLLSLLSHTDESTPLLSASVLTTLLT------------AYLKSSVKPSSDARDALPKLYRFFAGLTESP--DGHLQDIAIQSYVSLLRSTFARTTFWDMEEETVAPVVKILVQGGVGLQLLYHVLLVIWELTFEELVAEEINKYDVIPPIAEILRLSLKEKITRLALANLANLATESPNLPPLLLSNILPYLQQLSSRPASDPDITADLSSLIEAL 344
123 2.000e-37UniRef50_A0A0F4YX77 Proton-exporting ATPase n=2 Tax=Trichocomaceae TaxID=28568 RepID=A0A0F4YX77_TALEM  ali  22  8.YLSSLQNNIRARPIPWEGAVRAGNITDDQLRKIKAVDKVRKEQRRQTIDADLNGYTTLLAGLESASKRTDIVQYILVLAADLLNNDMDTGMIFSYSPSAHPDPYKPFLPLLRHSEDPISLLTSSFLTNLVSTA------------LVSSSKSSARDEEALPQLYSYLSSLV--KNQDSGLQDIGVQGFSTLLRTKAAREIFWSQRGTSSIRNFDAGLGGGVGLQLLYHVLLVIWQLSFEPVGNDLQSDHDIIELYTQLLRLSPKEKTTRLLLATLNNLANRTTLLPVAVFVRLPALLSNLSGRHLTDPDLLEDLKSLSDML 364
124 3.000e-37UniRef50_A0A1E3QSD2 V-type proton ATPase subunit H n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QSD2_9ASCO  ali  19  16EYLEDIKSNIRNRPIAWDGFARTKELTEDEAAKIKTLSQAATQQKAAAIDQAPAVYATTLLSVLDKIKRDDVLKSLLVLTNDLLLGVPIFSELLKLSLDADTLPYEPFTKFLGSADESIKVLGVYNLVILLAQRAYTKHAYVAQTV--------------------DVLSKTIAASTNLDSVATAVQLLRHLFTLPEYREVYWKSHATLFPPLLTFLQSGKGDLQVRYHTLLAVWLLTFSERISVEMPLHGVLKVLTGIAKNSIKEKITRLAIAILHNFVAPKSAAYAEAKTKVVKLMKTFSERRWSDEELVADLAALTETL 330
125 3.000e-37UniRef50_A0A225AEP4 Uncharacterized protein n=1 Tax=Talaromyces atroroseus TaxID=1441469 RepID=A0A225AEP4_9EURO  ali  20  8.YLSSLQNNIRARPIPWDGAVRAGNITDEHLRKIKAVDKVRKQDRKQTVEADVNGYTALLAGLESASKRHDIVQYILVLAADLINDAPALASALV-SHPKPFAAFLPLLRHSNNPEDPIPLLTSSFLTNLVSTALTSSSQTSVS------------EEEALPQLYSYLATLTR--NQDSGLQDIGVQGFSALLRNKSSREIFWQQRTVDALVEILRTAAGGKDLQLLYHVLLVIWQLSFEGSLVELQSEHDIIELYTQLLRLSPKEKTTRLATLNNLLVTNRTTLLPVAVFVRLPALLSNLSGRHLTDPDLLEDLGSLSELL 353
126 3.000e-37UniRef50_D2V575 V-type proton ATPase subunit H n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2V575_NAEGR  ali  22  8DTLASQAEEFSADDVNWESYQEAGILTPLERQRIEAISAQKRDVKQIIDIVKQTEYIYLFIKLLNGVHKNEALINILYLIDLLFENCPELCQQFHDDNSNQNNPFTPFLSLFIKNDIFIMEKAFNCLSRLAPEDQEMYRQLQQLERNNRTRSTQYRYQSQLESFIEGISNQLKSSGDDVRKSRMCVKALMRLLKRNDCRAVLNKVKGIAPLVNLLRV--HRNNVQILYEVSACLWMLTFHENAVSFFQNESLVPKLHDVLKCAQKEKVIRVILFIFKNLMKYPKFVTAMVNVSVPKTLLNLQKRSFEDKDITEELKSLSENL 352
127 4.000e-37UniRef50_L1IGJ8 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IGJ8_GUITH  ali  23  14NESALETAEIRQSKPNWTSFRDARLISDNDAQLLVRFQREALHNQGAFIAEESVALTQAFAAVLKSVNNKEAVRYVLTTLDEVMKENREIAKRFSHLSGTAVDPIVILPDLLSRDDDIIVARASHVLVHLLSAPMPASEDVVRRLMDFVRVEVQRENRHKGFCYLAILS------------------ILQGLLREHSRRLAFFEARGMQMLLDIIKQPKNHSNTQLIYQCIHCVWLLSYSPGVKDKLVDMELIAMLVHILKGTQKEKVIRMILAVMVNLIESGDMKNLLSICGGQRLLENMRQ................... 298
128 5.000e-37UniRef50_A0A2P7YYX7 Uncharacterized protein n=2 Tax=Clavispora/Candida clade TaxID=1540022 RepID=A0A2P7YYX7_9ASCO  ali  21  35.SLSDSRKLVREKIIPWEGLARAGIINNDQADLIKILETQNADSKRETVLSSVDLYSKTILNLLNKLSRDDVLKSVLVLMSDLLTDPEAKVFLETLLGLSKVDPFHPFVKHLDNNDLLIKTLSFYNLVILLGKAAKDDIKVD---------------KEVLIKLFDLACSKTYIGNADQNLQSIGVQLLQDLIVHKNYRAIFQEHNSINTLIELLAKKPNTTNFQLLYYVFLTVWILSFSSTINKTIVHNFLVGNLLTVSKESIKLKVVRVAISALKNFLEQYSVVKLVLFHDGLNIVKTIQTRKFSDDELSSDLAYLNDTL 366
129 6.000e-37UniRef50_L7IHN3 Uncharacterized protein n=1 Tax=Magnaporthe oryzae (strain Y34) TaxID=1143189 RepID=L7IHN3_MAGOY  ali  19  8.YLASLQNNIRQRPIPWDGAVRTGVLTEEQLAKTRAVEKPNRDARKQTVEADLDGYRALFVGEPGRPSVLEIVQYLLVLLSDLLDCVPTLSKALF----KDSDPYRQLLPLLAQPEDPIPLLTSHVLVNLIAGSRDESDPVILSYLSTLTKSSDAGLQDIGVQEYSTVLFGSKSRSQFWAQRSETVAPLINILRASSNGDANGIRSGSMRGGPVEGSIGGGVGLQLLYHVLLVMWQLSFEAEDVSFLREYNIIQLYTQLLKLSPKEKTTRLIVSTLYNLLNRSSLLPVASFARLPSLLSNITSRQLTDPDLQEDLQSLKD.. 352
130 1.000e-36UniRef50_A0A2C5X5L4 V-type proton ATPase subunit H n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A2C5X5L4_9PEZI  ali  18  8.YLATLQNNIRQRPIAWDGAVRASSITDAQLGKIRALSSQKPEDRRKTIENDMNGFAELFLGAPGKPSSLEIIQHLLVLFGDILELVPNFAFSLFKAGNPCPTLLGLLAHSNNSEDT-IPLLASTVLTTIIASTRDQSAPVLLTYLSGLAKNQDSGLQAVAVQQYSSLLYGQAPRQEFWAHRSETVEPLINILRNGNSSVSMWSGVSSGRSAGVDGFINGGVGLQLLYHVLLVLWQLSFEAEEIDLDDEYDIIVLYTQLLKVSPKEKTTRLLIATLNNLLEKNPLLPTAVLARLPSQVETMISRHMTDPDLVEDLTSLKEML 353
131 1.000e-36UniRef50_A0A1B8CL42 V-type proton ATPase subunit H n=11 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A1B8CL42_9PEZI  ali  21  8.YLSSLRNNIRARPIPWDGAVRAGTITEEQLTRIRAVDKVRKEQRKRTVEEELDAYRTLFLGLEAAARRADVVQYVLVLLGDLLEGSPALVDGLVE-HENTYAPFLPLLAQATSPEEAIPLLTSTALTTLLARESTTNPPILYKYLSTLAKSSDSGLQDIAVVGYSSLLRSRRSRELFWEHRDVTVQPLISILRTAESAASLWSTSATSR-TGAEGFINGGIDLQLLYHVLLVMWQLSFEGAAIGDEDEYDVIPLFTQLLRLSPKEKTTRLLVSTLYNLISGNPLLPAAALVRLPALLQNVNGRHLTDPDLIEDLTALSELL 356
132 2.000e-36UniRef50_Q0TZL8 V-type proton ATPase subunit H n=394 Tax=Eukaryota TaxID=2759 RepID=Q0TZL8_PHANO  ali  21  8.FLASIQNNIRGRPISWEGAVRAKTITDADLKQIKSIDKVRKEQRKQTIESDVDSFVTLLLGFEAAAKRQDIIHYMLVLLADMIDDIPALTTALV----QHPAPYKPFLPLLKNSDDPVPLLTSNVLTGLLSHA------------VIQSSKNTPQVDEALPQLFSYLSTLA--KSSDAALQDIAVRFYSAVLRSSKARKTFWKQRGSNSIRSNDGGLAGGVGLQLLYHVLLVIWQLSFEGELVGDQDDHDIVVLYAQLLRVSPKEKTTRLSTLVNLLTTNRQSLLPTAVLARLPALLNSLKSRHLTDEDALEDLQSLNDLL 347
133 2.000e-36UniRef50_A0A1F5LU60 Uncharacterized protein n=1 Tax=Penicillium arizonense TaxID=1835702 RepID=A0A1F5LU60_9EURO  ali  19  8.YLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDKVRKDQRRQTIEQDLAGYTGLLAGLDSAARRTDIVQYILVLASDLIQDVPSLADSLI-SHPEPYKPFLPFLQHSTNAEDPIPLLTSTFLIALVSHS------------LVATSKPALRDNEALPQLYTYLSTL--TKNQDSGLQDIGVQGFSDLLRTSQAREIFWNQREDPLIDTLRSAAGGKENLQLLYRVLLVVWQLAFEGPLVELQENYEIIQLYTQLLRLSPKEKTTRLLLATLLNLSNRTTLLPVAVFVRLPALLTNLAGRHLTDPDLLEDLTALSSML 346
134 3.000e-36UniRef50_A0A2P4GZ95 V-type proton atpase subunit h n=2 Tax=Quercus suber TaxID=58331 RepID=A0A2P4GZ95_QUESU  ali  21  8.YILSLQNNIRGRSIAWEGAVRMKTITDDDLTRIKKIDKVRKEQRKQIVESDVKTYTTLFLGFESAAKRTDLLPYMLVLAGDLIDDIP----AFTESLIRHPHPFKPLLKQSNNPEDPIPLLGSSVLASLLSRSLNAQP------------KSTSEIDEALPMLYSYIASL--SNATDSNLQDIAVQEYSALLISSRSRVQFWKQRKETPLFNVLQSATGNVGLQLLYHVLMVLWQLSFEGQTVGKDEEYDMIPLYTQLLKVSPKEKTTRVILGTLINLLNKSTLMPAALPAKLPAVLSNLKSRHLTDNDLLEDLESLKN.. 353
135 4.000e-36UniRef50_I2CP76 V-type proton ATPase subunit H n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=I2CP76_NANGC  ali  26  26...DREQVLASFTNIQWDTYGRT-MLDAGEVKILKDCDDKPLDFLLA-DPGDASKLVDTLLKLLNSVSDLVIQQYALTQLQDILSDNPQRAPLFSHDGGKTFDAL-PFLRAFDGSDLYCKQSAATVMALL-----------------------FKVMDGDLDGFVSRICS--ELSNSRNPSIKVIVSPLALLLRTEKSRLVFGAHGGVGFLTKLLKLQGSRGNAQLLYELIFCLWTLTFHEELKQDFIANGTVPVLAEQVSTAPREKVIRVSLAALHNLCYGDVLNAEMISCGLPKTLDNLLDRKWTDVELKTDLEHLHEAL 319
136 4.000e-36UniRef50_B6K877 V-type proton ATPase subunit H n=1 Tax=Schizosaccharomyces japonicus (strain yFS275 / FY16936) TaxID=402676 RepID=B6K877_SCHJY  ali  21  23...DEVASNARTRAIPWRAYERSHVIDEKLCEKVLKLDGLNLDARVQVVLENGDAYTQVFLKMLQIEGHDDIFAFACINISDILLVSRDWANIFVPLF-------------------FEMLGSKSWIESLASDEKLLFVKLFALACVYQPCTAAKEFTFVLEYLGSLL-----SDSADTQLKLFAAQCVVAILYLKPHRRAFWTEKS-CSMRLVEMLRTVSGDPQLLYYGLLNLWLLSFEPEIAKEMNKFSCISLLAEIARADQKEKIYRIVLAIFVNLLKYAENASTVLLERVDSLVKTLQHRKWSDEDLVASLTYLDETL 319
137 5.000e-36UniRef50_A0A0C7BHH3 Uncharacterized protein n=2 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7BHH3_9FUNG  ali  23  39.YLDDTMNKIRQEPIPWEEYTNVGLISENEMAMIKHVENKSVEELEPIMTEHGRYYALLYLELMQKLARVDTLQKVLVLIHDMLNEHEERIYLFHEAKKDNPEPFGPFHKVLSINDEFIGIQSSKLLTMLICSTSHRN--------------------INIHEFFRWITFQLQSRQQH--IVDLNIQILDALFHVPEYRRAFWETSHAIDTLVSILKANKHSDPQKIYELTFAIWLLTFDEQVAKNLDKYVI...................................................................... 268
138 7.000e-36UniRef50_A0A212EQ77 Uncharacterized protein n=2 Tax=Obtectomera TaxID=104431 RepID=A0A212EQ77_DANPL  ali  20  26..LQIRASEIRQSQINWQSYLQSQMITQRDHDFIVNLDQRGQKDLAHISKDNTIQYVLVLVKIFRNARHGNVWQPFLSLLDEFVQHMSSRIIAKLACWHPQLMEKSDLHHYLSWKDELKMNLCVIVYVMMKIESMAERSAVTLRGLFSKDDSKDSEKYKSLYSSFDVLKSHEDLPDKNNDYIQSVARCLQMMLRVDEYRFAFLSVDG---ISTLLSILASRVNFQVQYQLVFCLWVLTFNPLLAEKMNKFNAIPILADILSDSVKEKVTRIVLAVFRNLIEKPEHCIAMVQCKVLKQLSILEQKRSDDEDIMNDVDFLNERL 418
139 2.000e-35UniRef50_U6KCZ3 Vacuolar ATP synthase subunit h, putative n=1 Tax=Eimeria mitis TaxID=44415 RepID=U6KCZ3_9EIME  ali  21  465...NVKQELVMQQQPQWSLLERAGLIKKGMASALSGLHALDIEQRADAIADNPP-VVAALVAVLRLEADIQPAQYALTILYEVVRENSNRYEVMCKA-LDNTDLYGDFMQLLQRHDTYTGDRAAFMLSGFMARSR-----------------TYRFSEEEIQFFVFNLIAGRFPVSEAGRLD-----ALVNILKIDRWRPLVWETPNLPDL--LLRNLSLMQPPSVVYKAVFCVWLLSFHLSFPEKLTEAGILKATCEVLKESRVEKIVRVGLHVIENFLSCEDAVEIIIEENVAQILTLLEFEKWRDPDLYEEIR...... 753
140 3.000e-35UniRef50_E4XN56 V-type proton ATPase subunit H n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4XN56_OIKDI  ali  21  8DLLQDEIKNTRILIVNWKSYRQSQMISEEDFEFINAFDSEKNENKQQILDRYGKNAAKALTNLIGQIARDQTVRYLLTMVDDILTMNKENIMIFHHAVTLGQQAWTPFVTLLSRPDKFICNQAARISAKLATFGKLRFSSAESDGYLSWIRGQLTP--------------------HNAEWLTATTSALMIMLRAQCYRKPIVEHGIVDQLMEVLAT--RNQGFQLQYQVVCCFWLISF--TCADELFKKQIMVPVCDVLRQTEKQKVSRICLAVFRNLIENCNSCSSLIGCKAQKSIQVLTEKQ................. 296
141 3.000e-35UniRef50_D7FXN6 Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXN6_ECTSI  ali  24  34........RVKFSDVDWATIVRAGNVSQTEVEQLRANDESAVEFLMHDEAAAKKYVSTLVKIMKTTTSDARAQYFAVSRCEDIVADDGKVRSQLFLTSPKQPLDQAPFLRVIDSGDAAAQQVASIVLALLIV-----------------------NLDADSEPLTAWICKQLSMGRGRGQSVRGAVQALCVLLRNDTARISFGRHGGVAYLTKIIRQGGDSSMAQLMYELCFCLWSVSLCDEVKQDFMSCGAIPILAQQVAAATSEKVIRVSLAALKHLTEGESFNAEMIACGLPKTLRNMKTRQWADPDIKEDVDTL.... 323
142 4.000e-35UniRef50_C1E1Z3 H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) T  ali  34  6....DDLREVLERGARWNALLTSRLVTDEDLQAIQRYELRDEDARADMMDEEGDACARAFLNVLGDVSQTEYVQYVLALVARMLSDDKTRAAHFLAVEKKDDDAYAVFLRLLAAPDWFTREKAMFCLTRLIDQRPARDKGLRFSED----GEPATPAGVAAVRLSRWLCQSADPPFHPQRAVPSCVTALASLLSIREVRPVATRAGAARAIAPLLKVAAGPHNVQELYEAGLCAWLLTFHPPACDAMARCGVIRGLMEVAGAAAKEKVVRVATLALRNLASATGAREVAQESALRKLVQNLRLRDFHDEELLAALADLED.. 369
143 4.000e-35UniRef50_A0A2N1JGZ1 Vma13p n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1JGZ1_9BASI  ali  21  25DWLDSTADRLRDRQTAWEGYQRADLISNEELQMLRDAEQAGREHKMQTVLEKGAAYAALYMRLLNRLNRADTLQQVLLLSNDLAQAAPDKLGWFFAPADEEDQPFQSTVKLLDVDNAYVNLKGAQLLAIFATFQGDASAQAPKGALEALVRYIYKVFGAAIGR------DGSTADESEGNATLIVLTILADALRVDKFRRLVWHMDTFNLVSHLITIVRTTAHPQEQYLTLLCLWILSFDKDAASKLETHFSIPVLVYAAETALKQKIVRLVIGIWSNMLAAEPNATRLLGAKTLVLCETLEGRKYADKEMEAELEHVMRTL 372
144 6.000e-35UniRef50_A0A0G4LMP5 Uncharacterized protein (Fragment) n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4LMP5_9PEZI  ali  20  66.YLASLQNNIRQRPIPWDGAVRAGTITEDHLARIRAADKKKPEARKEVVEADLDGYRLLFVGEQGKPSAIEVIHYVLVLLSDLLQSVPSLSKALLKSGDPYKS-FLPLLANSNNTEDPIPLLTATALTKLIASSRDESAAT----------------HRALPLLFTYLSGL--TKSSDAGLQDIAVQEYSSLLYSRSSRQQFWDQRSETLL----------------YHVLLVMWQLSFEAEDIELSDEYDIVLLYTHLLRLSPKEKTTRLIVSTLHNLLESKTLLPTAVLARLPALLTNVSGRHMTDPDLLEDLASLKELL 363
145 7.000e-35UniRef50_O14265 V-type proton ATPase subunit H n=3 Tax=Schizosaccharomyces TaxID=4895 RepID=VATH_SCHPO  ali  21  23.QVDEIINNVRCVAIPWQGYQRSGSLEENELQEIENLTGKPLSAYVKTAEEDTTAYSNLFLKLLSMKDTPDVVNFALVKLADTLLNSNKFLSAFG----------PAFYDFLEKDESYI------------NYLDDDSKLLFARVFALCSSSSPCSVAKAFTLFLEYLGKLMQSLNPLTRL--FAVQCLNGVLTLKAHRYALWAENTCFRLAELLRNSIG--DTQLQYYSLFCFWQLTFESHIAQDINKFDLIKLLVQIIRSDTKTKVYRLVLAILVNLIDKAPTISTMLLEHVDKAVQLLQKRKWADEDITNYLDFITSTL 321
146 7.000e-35UniRef50_A0A226NYN7 Uncharacterized protein (Fragment) n=2 Tax=Neognathae TaxID=8825 RepID=A0A226NYN7_COLVI  ali  28  1......................................................MCAKTFINLMTHISKEQTVQYILTMVDDMLQENHQRVCIFFDYAKRKNTAWSHFLPMLNRQDLFTVHMAARIIAKLAAWGRELMEGSDLNYYFNWIKTQL--------------------SSQSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFCVWLLAFSPQMCEYLRRYNIVPVLSDILQESVKEKVTRIILAAFR............................................. 201
147 1.000e-34UniRef50_A0A177B1L8 V-type proton ATPase subunit H n=1 Tax=Intoshia linei TaxID=1819745 RepID=A0A177B1L8_9METZ  ali  21  20NEIEKMAIDVRRCRINWHSYYEAEMISHYEFKVMQEISVLPVHNRNRHLVENLDKCTSVMLALVSRMSKDQTIQYILTILDDLLKDLPYNVYVIFMEIMKSNSDFGPLLKLLTRSDKFITNQCSQIITKI-----------------LLLFNPNLLNQEDIFYYFSYLIDALSNVTPFTGV---SIRCLQSLLKIDEYCTVFHKKGGFAIISSILLNMK---SYQLQYQLTFCLWLISFKQEYCSYIISLDVVNIMCQIVRESTKEKVARMIFATFRNIINNQQIVFSMIRNDFIKKIESLETKGIHDIEYKEDVTFMND.. 325
148 1.000e-34UniRef50_A0A1Y1X9A2 ATPase, V1 complex, subunit H n=5 Tax=Neocallimastigaceae TaxID=29007 RepID=A0A1Y1X9A2_9FUNG  ali  23  17.YLTEKVESLLQNKISWDSISSANIITSEQASIISKGEPTPE-------------YIDALMNVAENVSTVETLQHTLALVDDATTKNVSLLNNF------DEKYLNTLIKLLSKDDETIQLLAGRIIA-------------------SKLSNVYHVTPVDYTPVFQWVTNLLDSENMD--VVDLASQYIQGYLSAIPLRTEFYNCDGVSKIINVL--VKRSPNSQLQYQLIFSLWLLTFEESICAEINKHNIIPVLIDIAKSAIKEKIVRVVLQAFRNMLEKAPNMIPMLGNKMVPFCETLLGRKWSDSEITDDLTYLKEEL 299
149 1.000e-34UniRef50_W1Q9G6 V-type proton ATPase subunit H n=2 Tax=Saccharomycetales TaxID=4892 RepID=W1Q9G6_OGAPD  ali  21  15DTINDIVSNARTRAIGWDSCVRADYLTVEEADCLKKVAGTDVREKTNYILKNADFYSTKIISLLAKAPHDDIVRFVLVSLIDTMVAPKSTFNILSIAHLDASLPYQPLIKLLGSNDESIKLSSSYVLTLLLIDDSESHDG----------------QEKVLRPLFDFLSVRLLS-STKLDLNFFSIQLLKELLTIKQYRTFFWENHETLFPPLLKVFTERRGELQMKYYATMSIWLLTFIPQALEDIETQYLVGTLYVVAKDAVKEKIVRLAISSLLNLLDRDQLVKQFLLVKGLEITKQLIERKWADEELKTDLETLLEIL 328
150 2.000e-34UniRef50_A0A075APZ4 V-type proton ATPase subunit H n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075APZ4_9FUNG  ali  20  1..............MSWDGYSKANIISDNEANMLNNYEKSKMKDSMYFCVQNGKDVAFSLLAVLPKLKDDEGIQYALTLIDDLIPSKRLRILYYRFVLYESITIYLEQFRIMKKEDVFISLKAATIFTSLASIDHSFPES-------------------EFESIIEWIA--QNITSDDKERVMIASQILPSLLRIEEFK--ITCSKNSKFMSSLVKALKGESNPQIQYQIIVSLWMLTFVEETAQTLSEHQVLPVLIDIIKGTVKEKVIRATLSLFRNMLEKAENMHALIGAKTLSVIETLAGRKFTDEDITNDIKFLGEEL 311
151 2.000e-34UniRef50_UPI00077FDBC3 V-type proton ATPase subunit H-like n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI00077FDBC3  ali  19  46..IQMEAYSIRQEPIDWSSYAEQNIISEDDCNFIHSFQSKTKKERDTIIHSFQGRAYLTVKTLIEKVRNVDDMRKLLVVIDDMFWEDDSRMRGFEPVTKE---PWKIFMPLLEWKDDFVRNIGGRVISYLMVASEERPTQNDMNYFLHWLKDEL---------------------DQDNPYMMSVIRCLQKLLRRDDYRMAFMAMSGIFKIVRLLTFKLK---AQAQYQLSFCLWVASLNPQLAEKMNRSGTIPVLSEVLQSCPSEKIPRIIIAIYRNLLEKPRNALVMLQCKILTYLRNIEHK.................. 331
152 2.000e-34UniRef50_G1XAC7 V-type proton ATPase subunit H n=3 Tax=Orbiliaceae TaxID=47021 RepID=G1XAC7_ARTOA  ali  24  11....SLIQSIRARPILWDQYQRTHIINEQELKLIKAVDKVPKDKRVAIVEGDLGEYGRLIVGLERCAKRVEFIQYLLALAVEICEDVPS----FVTTLTSHSDPYSHLMTLLDHTDAPIPIISSYLLTTLISSSLSKSR-------------TDNPTKQALPTLFKYLAT--ISSSSESNLQDLAVQSYVLLLRNSYSRNTFWEMSGISSAVPLLSTGSSSVNLQLLYHVLVAIWQLSFEEEIAEELDKYDLIPPLVHILRSALKEKILRVCLAIITNLINKAPSSNLPSLLLSRLLPLLTKARKFTDPDLTTDLETSLTAL 366
153 2.000e-34UniRef50_A0A2D4BMP5 V-type proton ATPase subunit H n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BMP5_PYTIN  ali  24  27..LAREEALHRFRDINWATYTRAGSLDKEEINALKEIEATNTNAVDDFLLDSGRVLGSALLKLVKNVTEPTVVKYTLARMEELLPDGRKRVAYFVDEGKALDAA--PFLRMIRNDTGYVQYAAAHLLALFLT-SMVLLVYRGLIADAKWSIDSVRPRFEDVDALCQWPSTNSLNDPNRANVTRAAVASMMVLLRHQKSRVVFVKQSGVTPIVELLKNSQNRAQL--SYELTFLLWTLSFCDEAMDKFVSSGALDVLIQQIVSAPREKVVRVALETLQNLLGKGYFTERMIDGGLLKTLNNLKERKWADEDVTKNIQSIRDVL 364
154 4.000e-34UniRef50_A0A1E4TUI7 V-type proton ATPase subunit H n=1 Tax=Pachysolen tannophilus NRRL Y-2460 TaxID=669874 RepID=A0A1E4TUI7_PACTA  ali  20  15.FFESLTKPISSRPVPWEGYARSNQLSIDEADSMKKLDIQEIQEKIDTIDSNVALYSTKVLAVLNKLDRNDAIENLLDLIAKTYTDNNTRNGLLELNNIDSSLPFNTIAKFLDNQNETIQMLSSYDLTILLISAPKSM----------------RISNDIVSNLFQLITTQFLV-SENKNLVFFGIQLLKELLSISSFRHIFWSFQSNFFPPLYKLLNQNSTDLQLRYYTLLSIWLLSFNKEISIKLPEKDIIAKYLSLSKDSVKEKIVRLAVSTLANFISIPKNENIILYEKAVDIFNQLIERKWADDELKQDLSLILTTL 329
155 6.000e-34UniRef50_F0V7Z5 V-type proton ATPase subunit H n=19 Tax=Eimeriorina TaxID=423054 RepID=F0V7Z5_NEOCL  ali  19  54...QVKQDAVLANAPEWKTLEKAGVLPAGLSVVLSKISPLCLDEFSEMLAADPD-LVRSLIGLVRLEGDLHTVQYVLTVLCEVVRDDSSKYEALCSAAADGE-VFEAFRQLLENLDAYTADRAAFLLSGLMCRARSGSFTDTQVEYLIQGLLHGRAANKFLLSEAGRL------------------DAFVNLLKIDRYRPMIWASRGFPEL--VLKNLSLTLPASVLYKAMFCVWLLTFHDTFLPQLNEKGIVLAVCVVLKESRVEKVIRVGLGVLHNLLKCDASVETIIEQNVAQVLALLEFEKWRDGDMYDDIRIAASHL 352
156 3.000e-33UniRef50_U4LB29 Similar to V-type proton ATPase subunit H acc. no. O14265 n=1 Tax=Pyronema omphalodes (strain CBS 100304) TaxID=1076935 RepID=U4LB29_  ali  19  7NVLDEYKSLIRNRAISWESYIRFQLVTAEDVDKIRAID-TDKARRVQIVERDAKGYAQLVLGDSSSENKLDVVQYILTWTGDLLDDVPSFANALLALLKPFEFLLQLLQQM---PDPRVPLLSASILTTLIATSLTSSPDT-----------PSAELKDALSKFYKYLSTV--SKSGDQDQQDLAIRSYVALLRTQQAREIFWNMDTVSPLAAILAVFQGGVPLQLLYHVLLVIWQLSFEETVAEEINDFDIILPVTVIIRNSIKEKIARVSLAFLANLVTKAPSLPPLLVTNVLPHLQTIQSRYEGDPDIAQDFETIISAL 340
157 4.000e-33UniRef50_A0A0S7FSV1 VATH n=4 Tax=Euteleostomi TaxID=117571 RepID=A0A0S7FSV1_9TELE  ali  24  14NIIAAKAAEVRANLVNWQSYLQSQMISTEDCEFIKKFEKANSEEKQVILTKEGHQCAKTFLNLMAHISKEQTVQYILTLIDDTLQENHQRVNIFFDYAKKKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGRDLMEGSDLNYYFNWIKSQLSSQN.................................................................................................................................................................... 172
158 5.000e-33UniRef50_A0A2A9M1F6 V-type proton ATPase subunit H n=1 Tax=Besnoitia besnoiti TaxID=94643 RepID=A0A2A9M1F6_9APIC  ali  18  52...QVKQDAVLANPPDWKILEKAGFLPAGLSAVLTKINPLCLDDFAEMFAADPD-LVRALIGLVRLEGDLRPVQYVLTILCEIVRDDTSKYEALCAAVKESE-VFEAFRQLLETPNSYTADRAAFLLSGLMCRARTGTFSDDQLQYLIQGLLHGRAANKFLLSEGGRL------------------DAFVNLLKIDRYRPMIWHCRGFPEL--ILRNLSLSLPASVLYKAMFCTWLLTFHDAFLPLLNDKGIVLAVCVVLKESRVEKVIRVGLGVLNNLLKCDSSVETIIEQNVAQVLALLEFEKWRDADMYDDIRVATSHL 350
159 5.000e-33UniRef50_A0A0F8B0I6 Putative aminomethyltransferase mitochondrial n=1 Tax=Ceratocystis fimbriata f. sp. platani TaxID=88771 RepID=A0A0F8B0I6_CERFI :_  ali  17  8.YLATLQNNIRQRPIAWDGAVRASSITDAQLGKIRALSSQKPEDRRKTIENDMNGFAELFLGAPGKPSSLEIIQHLLVLFGDILEHT-------------------------------IPLLASTVLTTIIASTRDQSAPVLLTYLSGLAKNQDSGLQAVAVQQYSSLLYGQAPRQEFWAHRSETVEPLINILRNGNSSVSMWSGVSSGRSAGVDGFINGGVGLQLLYHVLLVLWQLSFEAEEIDLDDEYDIIVLYTQLLKVSPKEKTTRLLIATLNNLLEKNPLLPTAVLARLPSQVETMISRHMTDPDLVEDLTSLKEML 323
160 5.000e-33UniRef50_A0A2T9YY65 V-type proton ATPase subunit H n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YY65_9FUNG  ali  21  48.HFNNETALISSRTLPWEGYHNAELISEAEMHLFRSLYQD--KAIGEKYTPETVKCVATILKLVDKIHRIEFVQSLLVILDQLLKYQASSVECLAYTSQTHPTIYHLLESFFDSPDSYIRLKSCKIIVSLLSFQNSDKNTKLFYFLSSELEFNSDFSQDVSIQLLQSALHLKDSRSFLYDNNQACIQKLCEILKETAN----------------QSSSLSTSISQTQYQIGYCLWLLSFEPEISKNLNKYNIIPSMVKIARSTLKEKVIRIMIATLKNFLALQPNLPSIITSGTHGCLLALKSRKIQDSDLVSDITEFLNDL 359
161 1.000e-32UniRef50_A0A0P1B8H9 Vacuolar H-ATPase V1 sector, subunit H n=1 Tax=Ceraceosorus bombacis TaxID=401625 RepID=A0A0P1B8H9_9BASI  ali  24  1................................MIRSIDATSSTSKEETMEKQGNAYAQLYLRLLAKLGRTDTIQQVLVLVTDMLKDHDERIELFKHVPAPQEPPWAPLIKLLDVTDDFVQLKAAHILTLLATKPPQHAIERLLDFLSLLINTGGASGAAALHPSRALAPPSATTGYAEGNGADVAIQLLQALLRDGALRQQVWSHQTPGIISGLTSILRATISAQTTYQVIFSLWLLTFAKDIASALNFTGTISLLVDVARGANKEKVVRITLATLRNLLSKAENAKAMLGAKGLDLVAALKGRQWGDEEIKEDLDAIGEVL 366
162 2.000e-32UniRef50_I2JZC8 Vacuolar atpase v1 domain subunit h (54 kDa) n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JZC8_DEKBR  ali  19  16ENINDILINARSRTIAWGACAKANYLSASEAECFKKVDYGDVKGRVALILKNPDVYAKNIASLLXKDTQSDIIRFVLVSMIDTLXGTEFAKSVLALSHLDTSLPYEPLVKLLXSKDEGIRLCAAYVLTLLLTDEAAAKQG----------------NEKHIGPLYGYIASKLLS-SGSMDYKFAGVQLLKELLQVKEYREIYWSQQKILFPPLFKILVEREGELQMKYYTALSVWLLTFIEQAVIDLNEDYIIEVLYSISKDAVKEKIVRLAIDSLLNLVKKEQVVKHYLLASGLEITKQLLERKWADSELKDDLNTMLEIL 331
163 2.000e-32UniRef50_A0A1L0DJ64 V-type proton ATPase subunit H n=1 Tax=[Candida] intermedia TaxID=45354 RepID=A0A1L0DJ64_9ASCO  ali  19  13.HLSDSKKLIREKIIPWEGLARAGIISNDQADLIKVLETQNVDSKRQTVLNSQELYSKTILNLLNKLSRDDVLKSVLVLINDLLVDPEAASFLLLLSSIDSSLPFSPFIKHLDNNDSLIKTLSFYNVTILLTQSAKLGASAD--------------KEILIKLFDLVCSDAFIGNNLDTNLQSIGVQLLQELVVSKAYRLVFQTHNSVNSLIEKLAKQPNVTNLQLLYNALMTTWILSFSASINKVLVHNYLVGNLLVISKDGIKLKVVRVAVSTLKNFSEKLSVVKLVLFQDGLNIVKTIQTRKFSDEELSNDLAFLNDTL 344
164 4.000e-32UniRef50_H3GYG9 V-type proton ATPase subunit H n=26 Tax=Oomycetes TaxID=4762 RepID=H3GYG9_PHYRM  ali  21  11..LAREEALHRFRDINWATYTRVGSLEKTEITALKDLDATNVKAVDEFMSDAGPLVGGALLKLVKNVTEPTVLKYCLARMEELLPDGLRLHKRMVYFVPEGSTVDAPFLRMIRNDTGYMQYAASHLLALFLTIRPRQEDAEALGQWLIQSLKTGA-------------LPTSTNDAARANVTRAAVSSLMVLLRNEKLRVVFVKQGGVPPVVDLLENSQNRAQLA--YELTFILWTLAFCNEAMEKFVAAKALDAIVLQVAAAPREKVVRVALEALQNLLGKLSFNERMIDSGLLKTLNNMRERKWADEDISKGIQAVRDVL 329
165 7.000e-32UniRef50_A3M036 V-type proton ATPase subunit H n=16 Tax=Saccharomycetales TaxID=4892 RepID=A3M036_PICST  ali  19  14.FLTDSKKIIRDRIIPWEGLSRSGVVSEDDASYIKILEKQSAENKRSTVLSQLDLCTKTILNLLSKLSKDDVLKNILTLINDLLLELPGQEFLLSLSEVDASLPYTPFLKHLDNNDGLIKSLALYNVIILLSKASKNHTTAV------------KIDKEVLIKIFDLLSSPQFIGSSEANFQLIGIQLLQELLIVKQFKKLVSNFKAINSLISSSAKYPNATGLQLSYNILLTTWILTFSAPINKSLVSNELVSNLLAIAKESIMVKIVRVSVGILKNLVSVTTSIKILLFHEGLPTINLLKGRKFSDEELANDLVYLTDVL 347
166 9.000e-32UniRef50_A0A0G4IFP4 V-type proton ATPase subunit H n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4IFP4_9ALVE  ali  17  20DEGSVLHDKIVNNPPEWSHFERSGYLPTGGADWLKSFHRLSLPDKSESIGNDPTACAIVF-SAVAIEAEPQPAQYALTILYDIVRDDSSRYDAIGK-NLPDLDLYKAFSSVLPHLDAYTGDKAAVLLCGFMC------------------RLTRRFTEDQVKFVLGQLVSGKYRASDGGRL-----EAFGNILKIDAYRVMFWHIPKSPSI--ILQSINAGLPASVLYRSLFCAWLLSFNPDTLDGLIGTDFVPRLRMVLAESRVEKVVRISVQTIHNLMQNETAIEKLVEENVVQSLQLLEYEKWRDPELYEEIRQVIAEL 328
167 1.000e-31UniRef50_A0A2T7IR86 Vacuolar ATP synthase subunit H (Fragment) n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IR86_THEOR  ali  18  21.............SPDYEEWLNTGALDVESVELLKLYASLNTLEKVEMIRKN-ELISKIFLNATYATGPGLLRSYSLQHLADVCRVDNGIYDILLK-ILDGRDVFSIYYDIATHRDKRIVEKTLYLLTDLALANPRT---------GFVAHGRGCFSDDQVDSVVKLLLKLSIDPYAK-------LHALSNVLQLKKNHALV---QNPAVLALLRAGLGRESPPNTQYKCVFCVWLVSRSEEYVPVLHDNELVRLLCELLAATKVEKVIRICLLVFGNLLGNAQCLEVMVETNVLQTLTLLAYDKWHDDELYDNIHRLHAQL 309
168 1.000e-31UniRef50_A0A0E0ECV8 Uncharacterized protein n=11 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0E0ECV8_9ORYZ  ali  99  2.........................................................................................................................................QNGIVPNGEASNSKSKLTSTQDVLRGLVDWLCSQLRNPTHPNCSVPTAMHCLATLLREQYVRALFVQVDGVKLLIPLISPASTQQSIQLLYETCLCIWLLSFYDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGL 186
169 4.000e-31UniRef50_A0A2P8YZ78 V-type proton ATPase subunit H n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8YZ78_BLAGE  ali  25  1.....................................................................................................................................................................................MQSVARCLQMMLRIDEYRFAFVAVDG---ISTLLAVLQGRVNFQVQYQLIFCLWVLTFNPLLAEKMNKFSVIPILADILSDSVKEKVTRIILAVFRNLIEKPEHCIAMVQCKVLKQLSILEQRKFDDEDIVADIEFLNEKL 145
170 7.000e-31UniRef50_UPI000846425C V-type proton ATPase subunit H n=2 Tax=Neoptera TaxID=33340 RepID=UPI000846425C  ali  26  1..........................................................................................................................................................................HRVLPSQNNEYIQSVARCLQMMLRVDEYRFAFVSVDG---ISTLIRILSTRVNFQVQYQLIFCLWVLTFNPLLAAKMNKFSVIPILADILSDCAKEKVTRIILAVFRNLIEKPEHCIAMVQCKVLKQLSILEQRRFDDEDITADVEYLSEKL 156
171 1.000e-30UniRef50_A0A2R6PC82 Uncharacterized protein n=1 Tax=Phlebia centrifuga TaxID=98765 RepID=A0A2R6PC82_9APHY  ali  27  24............................................................................................................YHTAHCYDDFVQLKATQILTVLLSSESSPIQS------------------QYLLPFLNTLSAFVTHPLPHKR--DIAVQCLETVLPRSEVRRAVWENAT--LVGGLVDILKHNPGPQMCYQIGFCFWLLTFEQEVAEQLNKFDIIPLLTDIAKAAVKEKVVRVIVATFRNMVSKAPNLPAMLVAQLLPFVKNLSTRKWTDEDIVEDVQYLRDEL 218
172 1.000e-30UniRef50_A0A2V1AK83 Uncharacterized protein n=1 Tax=[Candida] duobushaemulonis TaxID=1231522 RepID=A0A2V1AK83_9ASCO  ali  21  11.SLSDSRKLVREKIIPWEGLARAGIINNDQADLIKILETQNADSKRETVLSSVDLYSKTILNLLNKLSRDDVLKSVLVLLSDLLTDPEAKVFLKTLLGLSKVDPFHPFVKHLDNNDSLIKTLSFYNLVILLGKAAKDDIEVD---------------KEVLIKLFDLACSKTYIGNTDQNSQSIGVQLLQDLIVHKNYRAIFQEHNSINTLIELSAKKPNTTNFQLLYYVFLTVWILSFSSTINKTIVHNFLIGNLLTVSKESIKLKVVRVAISALKNFSEQYSVVKLVLFHDGLNIVKTIQTRKFSDDELSSDLAYLNDTL 342
173 1.000e-30UniRef50_F2UK75 V-type proton ATPase subunit H n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UK75_SALR5  ali  22  16NSILDERVQIHGTRMDWGSLGVLNVVDPDGLLLMQEYDVPDKGSRLHFIEESGRDIMRVLLELYMHVVAEDRLKYIVTTFDRIAEDDPSTTDLLIEVESAPPSPLHPFLQKLEMPSLYIAHQSSRVIARLIEHGAP-------------------YEDKHIQTYLNWL--QKQLSHQESSAVRLALAAVVSVLKVPRNRPLVAHSRSF--LDALKSLLHPSGHFQILYQTLACLWMLTFDASAVQSI-RFEVLHSLVEIVKEAKKEKVTRVAFAFLRNCVENLEAKQAMVTHKLLPVVERLRAAAHEDEELAEDVEFLLEKL 328
174 2.000e-30UniRef50_C5KI04 V-type proton ATPase subunit H n=2 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5KI04_PERM5  ali  19  20....SREAAILSSKPDWQSLESAGQIPKGSAQWLDQIHGTSSSAVVTLAQRNEEVLVG-LLSVLKSVEDMHAVQYALTVIYEATRFDCSFWNLLVALAR-KNDMMLPFTRFLSSDRAADDSYSSDKATILACQLYVLTD--------IMSHDGGRKFNPQEAKMIADSVADDKNMKFKGVSDLGRLDAFCNLLKFDGFRAVVWNIRKVQKCIMNAISGVESADPLVLYRGVFCIWCVSFNKELVSADMGDDIVQALLSVVANCRVEKVIRMTLAVLSNFLGDDKMCTAIVESGIIHYVQNLEYEKWRDQELYEDIRKVAA.. 328
175 6.000e-30UniRef50_A0A1Y1WHA4 ARM repeat-containing protein n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1WHA4_9FUNG  ali  22  16.FFDEFTDKVRVKPIPWEGYSRAGLISSVELGQLREFQQKQQEGK------EVGGYAGLLLELADRLSSIDAQQYLLVSLDDLV----DSSGAELAELAKSGELARVLFRSMEKKDDYLGLKAGKILVGVLAGAPGLQRGFRYGRLYEYLSGCMR--------------------SELTSVADVAIQILQSALRERRARTVLFHESSGCSV-GQRSAKGVVAVPQTQYEGGL--------------DKQYDVIPAMVEIARSAVKEKVIRIIVATWRNMLGLAAA------ANVPAMLVAKAGRNFKDADLKEDLRELAEEL 285
176 7.000e-30UniRef50_A0A1R1XTQ4 V-type proton ATPase subunit H n=4 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1XTQ4_9FUNG  ali  16  47.YFDGVTRNVHKRPMPWEGFFNAGLITEEEMITFRSLQQSKRNFKDYPIETRK--CTNLVLGLLVKLHRIEVIQYLLVLLDDLVENQDTAIDCISYKSDRYATIYTLLEKNFESHDDYIGLMACKVIIKLLNSQNSYDFSFDFTNLFVYFEQKL--------------------DSTDPSISDVVIQLIQSVLSINGSRKFIFHNSPSCLEKMVLILKDTVLSPNQH-----------GLKVSVAQTQKYDIIPTLVKIARSTLKEKVIRVMIFTIKNMLSLESNLPSIVVSGVQSCLIALSGRKIQDADLSEVISDLSQKL 337
177 1.000e-29UniRef50_A0A183IRN5 Uncharacterized protein n=2 Tax=Nematoda TaxID=6231 RepID=A0A183IRN5_9BILA  ali  23  42..LHMESMQVRANRPNWKSYLQSNMISQDDYNFITAYEITKGDEHKSLIDNNKIQCAKTFISLMSNISKDQTVRCVLIMIDDMLKEDPTRVQIFANYARKEQSVWSPFLAMLNRSDGFIINQVSIIIAKMACFSQELMDGADLTYYLVWLKDRL--------------------KSPGNEYLQTTARCLQMMLRIDEYRYAFVNLECVNT................................................................................................................ 230
178 1.000e-29UniRef50_A0A1X7UHY2 V-type proton ATPase subunit H n=2 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7UHY2_AMPQE  ali  24  31...ASVTREVRKRDFSFKDYSKNRQISPQAAKFGNSLPGVSKEEKSFAVRQQAGLCVELFRSILSNFRSSEPLQFILTLLVDITEDHDTTALLVKKHNGHELTPL--LVAILGRHDLFCQSQACLCITRIIAFSPDPMEG------------------DQLTQLISWITSQLKAGN---EYLECITKALMSFLRRQVYRVPFFEAHGIKPILDLLD---HRINFQLQYELIFSLWMLSFEEYIVSRMKEFPVAIVLSDVLKTSSRPKVQRIILATFRNLIEKSDYAAEMIHFKAVQVLTILEGRSLDDDDFEDDVKFLQEKL 331
179 2.000e-29UniRef50_D3BF90 Vacuolar ATP synthase subunit H n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BF90_POLPP :  ali  27  26........KVATRIVPWSSHLKSDFITREEYSLIDKYDKKSETEKKTIFSTEGDRLAQFFVDFLQKSADLDTIQYVLYLVNEIIRIEPKALNNFVRLNSAKDAPYNIFFRLFNREDAYVNLIAGIILGNILAAGSPPQKE--------------------IEHFINWSLPLLRKSEPRE--VEVALIALQAFLAKEDNRVLFNKLQGTNLLVEIVSNSPNTLLLPLLYEALYCIWLLSFSPVVAHDASEKNIVPTLVQITKTITKEKIIRLSIASLRVIIKFAKQIPP.................................. 289
180 2.000e-29UniRef50_A0A0G4EF78 V-type proton ATPase subunit H n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EF78_VITBC  ali  22  29.....QEDSVLSADIGWHKYEQSHLLKPGSASVLQMLHNMPSEERANHILTHSEVPPVVFSVL--NLMDLQAIQYIITLIMEVVRDDGSRYDVLM-GCLPDADIFTPFHKTLSRQDTATSDKAAYLLSGFMCRGGSKKFSESQVTTFVTSIVNASYTMTELGKL----------------------ESFCNLLKNNAYRNTVFEARGVTDM--ILKNVDPERPAPNLYKACFCVWLSSFRPDLLKQLIDRGVVLALRKVLGDSRVEKVVRVCIHTLPALLEEDKAVEDLLERNTLQVLQLLEYEKWRDAELYEEIRQ..... 315
181 3.000e-29UniRef50_UPI0009057854 V-type proton ATPase subunit H-like n=1 Tax=Nicotiana attenuata TaxID=49451 RepID=UPI0009057854  ali  69  1.........VLRRDIPWETYMTTKLITETGLQLLRRYDKKAESDKAQLLDDDGPAYVSVFVTILQDIFKEETVEYVLALIDEMLTANPRRAKLFHDNSFANEDTYEPFLRLLWKGNWFIQEKSCKILSVIVSARPKVQNGVDANGDASSSKRKLTSAEDVLRGLVEWLCAQVS..................................................................................................................................................... 164
182 3.000e-29UniRef50_A0A091L0W9 V-type proton ATPase subunit H (Fragment) n=9 Tax=Euteleostomi TaxID=117571 RepID=A0A091L0W9_9GRUI  ali  31  1...............................................................................................................................................................................TQSSQYVQCVAGCLQLMLRVNEYRFAWVEADGVNCIMGVLSNKCG---FQLQYQMIFCVWLLAFSPQMCEYLRRYNIVPVLSDILQESVKEKVTRIILAAFRNLLEKSEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLDKL 151
183 4.000e-29UniRef50_J5QZ12 Uncharacterized protein n=2 Tax=Trichosporon asahii var. asahii TaxID=189963 RepID=J5QZ12_TRIAS  ali  29  14.YLDDQLSKLAAKQIPWE---RAKLLSQEECTLLRSLEK---IQRGSVFAKQGAEYAKLYIDLLRKLQRVDTVQAVLASISNMLAD-PDTLHYFHDLSKDDPDPYQPIVKCLDTEEEFVHLESLRILALLIA---------------------------------------------RNQPRDIAAQALNAVLIKKQFRTAVWKEGGCIS-------------------------------------GKYDIVNLFLELAKSAVKEKVTRVIVATWRNLLEIAPNVPSMFVVRLLPFIQSLSDRKWSDEDIVEDIGYLKEEL 250
184 4.000e-29UniRef50_A0A1E3P315 V-type proton ATPase subunit H n=6 Tax=Phaffomycetaceae TaxID=115784 RepID=A0A1E3P315_WICAO  ali  19  25.YLEDYRTAIRSKTIPWDGFARSELLTQQEAKQLIELEGHTIKKRKETAPDHIDDYTNTLLNLLSRLERNDVKKYILVLFADLLENDLFIDKLIELNNGNPDVILTPFVKYLDNNDEIIRLFSIYNLTSILIQPEIQPTDDSIVLKLFQSLN-------------------HLIESSNFNLKFLSIELIVDLLLIKPYRSIYWTKHNLFLNLNEYLNNNSSDSIQFQYKILLSIWLLSFNSKILKELSTIYQNEILLKLVKISIKEKIIRLIISILNNFTSIPSDLKLILIGNIEPVLNNLQNRKWSDDELIEDLEKLSSK. 345
185 2.000e-28UniRef50_A0A2T9ZBT1 V-type proton ATPase subunit H n=1 Tax=Smittium megazygosporum TaxID=133381 RepID=A0A2T9ZBT1_9FUNG  ali  22  47EQFVQLEKKISSQPIPWEGYYNANLISEEDMHLFRSLTQQKN----------------------RFIHRPEFTSYLLVMIDEILKISDENEYCLSFSNESNSNIFSLFERLLVSSDEFTRLKSLLIITRLLSKNDKSLEYDYSKIFSVLSDEIDQETGFSQDVSIQLIQSLLDLKPPRQYLFFENPDCLEKMCKILKL-----------TIVSRSLTSASVSTSQTQYQIGYCLWLLSFDPIVCESLNKYDVVHVMTRIARSTLKEKVTRIMISTLKNLLAMEYNLPSIIASGVHGCLVALKSRKIQDVDLENDIDQFMADL 341
186 4.000e-28UniRef50_A0A1D3TE04 V-type proton ATPase subunit H n=57 Tax=Eukaryota TaxID=2759 RepID=A0A1D3TE04_PLAMA  ali  17  21...QILHDSILNKMPCYDKYAEINILSSEEVQLLKKFHDFNKKEKFDYFKEN-DMIVSVLFNCLQTDFNIHLIQYVLTIFYEIIRNDGSSYSYIL-SILSDKNLYTYLMKLCTHNDIYIADKSSFLLSGSFCYNNNYFTDTE-------------------------IKDFILKIDFFNVTEEGKMDIYINILKIDEYRKDIYELEQFLTIIN-KNLDLANNNANKQYKSVFCVWLLTFKDYFIRKLYKNNIIIVVINLFKKCRVEKILRVSLNIIKNIMHMDDCFEIIVDNNIIQTLTVLQYDKWRDNDIYDTIVQLLHKL 311
187 1.000e-27UniRef50_A0A1E3NLP7 V-type proton ATPase subunit H n=2 Tax=Pichia membranifaciens TaxID=4926 RepID=A0A1E3NLP7_9ASCO  ali  20  17DFVSQLLTNIRTRSISWTSFVKANYLSSENMAVLKSVDQEDPASRVDVLIKDLPTYSKVLLDSITDISKNKSKYLDLTKILLVINSVPEHTMTHEIMKISKNNPYPPFVEILESSSSGEQDNQDEFVISILC-------AHILIFFLTTNPPSSKKTAFELVSTVLKFIQDGLVTSSNAQYRFLGVQLLKELLSVKEFRD-IYIKKTEYLDALIKIMLDKNVELQMRYLSIYCLWTLTFDSKTNQLLTTAEIIPTMFKFSNDAVKEKVVRLSISILINFLDQTEIIKKFLLANGLTIVKNLIERKWSDNELKDDLNTLYDLL 356
188 3.000e-27UniRef50_A0A267F9V9 Uncharacterized protein n=4 Tax=Bilateria TaxID=33213 RepID=A0A267F9V9_9PLAT  ali  27  15........................................................................................................................................HCQSGIENHRQNCLLGNQLMEHTELLHYLSWLREQLRLPS--NEYIQTVARCLQMMLRVGPYRQAFCDIDGIATLASVLS---TKVNYQIQYQLVFCLWCLSFDADIVMRMKKYNLIPICADVLCESEKEKVNRIVCAFFRHLLEKPTDSAPMVHCKVLKQVELLVQKKYDDPEHEDDLQFLFERL 201
189 3.000e-27UniRef50_A0A0M3J7I3 Probable V-type proton ATPase subunit H 2 (inferred by orthology to a C. elegans protein) n=3 Tax=Ecdysozoa TaxID=1206794 RepID=A  ali  23  2...........................................................................................................................SSVIAKLACFGTTLMEGSDLSYYFTFLKEQLKL--------------------SSNDYINTTARCLQMMLRIDEYRHAFVAIDG---IASIVTALSGKANFQLQYQLIFSLWCLTFNASIAERIPSSGVIQILGDILSESSKEKVTRIICATFRNLLEKREAALQMVQCKTLKTLELADSKKFDDVDLHDDIEFLCEKL 184
190 4.000e-27UniRef50_Q5CT91 V-type proton ATPase subunit H n=8 Tax=Cryptosporidium TaxID=5806 RepID=Q5CT91_CRYPI  ali  21  22...AEKRSRILSHAPHWKKYELAGALPVGSSVKLMALHNQSLLVRSQLLSSDK-QLRQLVLNCLGITPDLEPAQYILTMIYELVRDDAGQYHGFVET-TKGIPIFEKFMQFLERPDSYLSDKLLFFLSGLISHSNDGAYTKENITELIDHLFKTPENRRSLSGAVNRMESSYSTLNGGYCSVIGALDVLGNLVKVDAYRMLVLSHP--NVVEFISSNLSSSSPTSHIYKACVIVWLLSFNEETVPILVSRDLIRQIANTIIDCRSEKVVRVTLNLLKNVMNNDAAIESIIDLGLLQYLTILEYEKWLDPEIYEEIRQ..... 348
191 6.000e-27UniRef50_A0A086JE72 Putative vacuolar ATP synthase subunit H n=1 Tax=Toxoplasma gondii p89 TaxID=943119 RepID=A0A086JE72_TOXGO  ali  18  48...QVKQDAVLANPPDWKTLEKAGVLPAGLSAVLSKINPLCLDEFAEMLAADPD-LVRALVALVRLEGNLHTVQYVLTVLCEVVRDDSSKYEALCSA-VADSEVFEAFRQLLENLDSYTADRAAFLLSGLMCRARSGTFSDSQVEYLVQGLLHGRAANKFLLSEGGRL------------------DAFVNLLKIDGYRPMIWDCRGFPEL--VLRNLSLTLPASVLYKAMFCVWLLTFHDAFLPQLNEKGIVVAVCVVLKESRVEKVIRVGLGVLHNLL-NPALLSLATDAQGSRLLEGL..................... 324
192 1.000e-26UniRef50_A0A182G1C1 Uncharacterized protein n=3 Tax=Diptera TaxID=7147 RepID=A0A182G1C1_AEDAL  ali  20  25..LQQQAGDIRQNKPNWSSYKQSQMISQEDYACVSSLDK-DKKSQAQYLQENPGQCAKTFLNLLSHVSKDQTIQYILVMIDDLLQEDRTRVQLFHDANKRKESVWAPFLNLLDRQDGFIVNMASRVVGKLACWGQELMPKSDLHFYLQWL............................................................................................................................................................................ 172
193 5.000e-26UniRef50_A7AN39 V-type proton ATPase subunit H n=4 Tax=Babesia TaxID=5864 RepID=A7AN39_BABBO  ali  17  21.............SPTFSEWVGTGALDEQSGELLKQFESLNSVERCDFIKDN-ELVARVLLNATYATGPGLLRRYSLERLCDVCR-VDNSMYTFLLATLNDRDVFEIYFDIATHEDRKIVEKALFLLSGFIAYGSGRFTQDQMLNSLRCVLDSKIEPAPKLY-------------------------AIANLLEEEGNRSVVFANN--DVLVLLKSCLQHETPANAQYKAVYCLWLYSRKPEYVDAMYDHGLVHAMCNLFCTTKIEKIVRVCIRLLKNLFDNMRCLELIIEKNVAQTLTLLEYDKWRDVELYDSIHQLHAVL 301
194 7.000e-26UniRef50_J4C451 V-type proton ATPase subunit H n=1 Tax=Theileria orientalis strain Shintoku TaxID=869250 RepID=J4C451_THEOR  ali  14  22..............PDYDEWLNTGALDVESVELLKLYASLNTLEKVEMIRKN-ELISKIFLNATYATGPGLLRSYSLQHLSDICRVDNGIYNILLK-ILDGRDVYSIYYDIATHEDKKIVEKTLYLLTGSICIEKGSNSSLCSDNDRNWSRYRQRLPKQGFIAYGNGCFKDEEAESVVKLILKLSIDNYSKLLTHPNSEKYHNLIENENVLRLLKINLGKENAPNTQYKCVFCVWLISRSEEYIPVLHRNELVHLLCTLLSSTKIEKVIRICILVFNNLLKNPQCLEVMVEMNVIQTLTLLAYDKWNDSELYDNIHKLHMQL 342
195 7.000e-26UniRef50_A8XJ94 Protein CBG14054 n=15 Tax=Bilateria TaxID=33213 RepID=A8XJ94_CAEBR  ali  25  1.....................................................................................................................................................MSSIIEKPHEDIHQLIATLKEQIQKNSG-TDAVNATVRHIQTLLREDKYRHEFVKADGVQTI---VTALTGSTNFQLQYQLIFALWCLTFNASIAQKAPSFGVIQVLGDILSESTKEKVIRIILATFANILNKRQAALQMVQCKTLKTLELIESKKFDDPDLEDDVKFLTEEL 176
196 1.000e-25UniRef50_A0A080WNN5 Uncharacterized protein n=4 Tax=Trichophyton TaxID=5550 RepID=A0A080WNN5_TRIRC  ali  18  8.YLTSLQNNIRARPIPWEGAVRAGNITEEQLKRVKAVDKVRKDSRQKTIEKDVAAYTSLLAGLESATRRTDIIQYILVLAGDLISDVPALTSALVESSESYRH-FLPLLTNSTNSEDPIPLLTSSLLANLVSAS------------LRATPKTSPKDEVALPKLYAYLSTL--TKSADTGLQDIGVQGYSALLRTKRSREIFWKNNTVEPLIGILRAAAGPTGIQLLYHVLLVLWQLSFEGDLIGA............................................................................ 267
197 2.000e-25UniRef50_A0A1B0DPC2 Uncharacterized protein n=3 Tax=Holometabola TaxID=33392 RepID=A0A1B0DPC2_PHLPP  ali  24  26..LQQQAGDIRQTKINWQSYMQSQMISSEDYNCVSALDG---DKKNSYLQQNQAQSAKTLLNLLSHVSKDQTIQYILVMIDDLLQEDRTRVEIFHDYATKKESVWGPFLNLLNRQDGFIVNMSSRILAKLACWGHEQMPKSDLNFYLQWLKDQLTVN..................................................................................................................................................................... 178
198 2.000e-25UniRef50_A0A1N6LWD2 V-type H+-transporting ATPase 54 kD subunit n=1 Tax=Babesia microti (strain RI) TaxID=1133968 RepID=A0A1N6LWD2_BABMR  ali  17  20...............PWDFWLERKFLSTEEVEMLKTFEALSSIEKTSRV--NDKLFISVLKNALSSPNN-DLIIYSLHTISDICRIDSSNYDIFL--------------------DIFEGNEIINLFTTLAKDKKGNVASKAFSFLSRVMSYNAGFTLSQVDELLDNMNSIELDLSAKSRL-----EIVCNLLKYDGYREIVFNKKGVPTLIN--KCLHDSNNADSQYHAVFCYWLLSFKPKFIPEMVASGIILQLCNLFNSTKVEKIVRVFLLLFDNLQNYGPCLEIIADTNVNQTIKLLEYDKWKDKELYGEIVRIYNQ. 295
199 2.000e-25UniRef50_A0A2P4WN61 Uncharacterized protein n=2 Tax=Caenorhabditis remanei TaxID=31234 RepID=A0A2P4WN61_CAERE  ali  20  387................................LIKLLESSHDPLILCVAAHDIGEYVRHYPRGKTVVEQYQGKSAVMRLL--TAEDPNVRYHALLAVQKLMVHNWEYLGKQLDSDAQKDSVTSNVVFAVLLVKLCLTSFFSDIYTLMSSIIEKPAEVTQSIHELIHTLKGQIKNAST-NDSVNTTVRSIQTLLRQDVHRREFVEADGVQTL---VAGLTGSTNFQLQYQLIFALWCLTFNPEIAKKAPSFGVIQVLGDILSESTKEKVIRIILATFANILNKCDAALQMVQCKTLKTLELIDAKKFDDPDLEEDIKFLTEEL 685
200 3.000e-25UniRef50_A0A1I7XVH1 Uncharacterized protein n=3 Tax=Rhabditida TaxID=6236 RepID=A0A1I7XVH1_HETBA  ali  19  35........KVRANKPNWGSYLRSQMIPQEDFNFITAYENKSKEERDVVLTENNGQAARTIVNLIANVAKDQNVRYVLTLLDDMLQEDKSRVEILHAARKQKRTVWSWFLGILQRQDNFIVNQMSSIIAKLACFGTTLMEGSELNYYFSFLKDQLRNTTVLIYFLYDEILIL----------------------------------------------------PHFLNSVGYILFILKVYFLMAFFQVIRIIMATFSNILKKVDEREIKR-------------EAALQMVQCKTLKTLELMDAKKYDDIELEEDIEFLSEQL 287
201 5.000e-25UniRef50_P41807 V-type proton ATPase subunit H n=42 Tax=Saccharomycetaceae TaxID=4893 RepID=VATH_YEAST  ali  16  12.HFNEIRSIIRSRSVAWDALARSEELSEIDASTAKALESSSSNNAHSGFKVNGKTLIPLI-HLLSTSDNEDCKKSVQNLIAELLSSDKYGDDT-VKFFQEDPKQLEQLFDVSLKGDFQTVLISGFNVVSLLVQNGLHNVKLVEKLLKNNNLINILQNIEQMDTCY------------------VCIRLLQELAVIPEYRDVIWLHEKKFMPTRIVATNSNHLGIQLQYHSLLLIWLLTFNPVFANELVQKYLFLDLLKLVKITIKEKVSRLCISIILQCCHKKVIKQLLLLGNALPTVQSLSERKYSDEELRQDISNLKEIL 346
202 5.000e-25UniRef50_A0A0U5GWI0 Putative Vacuolar ATP synthase subunit H n=1 Tax=Aspergillus calidoustus TaxID=454130 RepID=A0A0U5GWI0_9EURO  ali  19  17.YLNSLQNNIRARPIPWDGAVRAGNITDDHLKKIKAVDKVRKEQRRQTIEGDIPGYVSLLAGLEAAARRSDIVQYILVLAADLINDAPSLSSALI-AHPSPYKPFLPLLRQSTNAEDPIPLLTSTFLTNLVSTSITTSSK------------STPQDEEALPQLYSYLSTLTQ--HQDSGLQDIGVQGLSALLRSSKARQIFWAQRTVDPLIEILRAAAGAKDLQLLYRVLLVLWQLSFEGELIGE............................................................................ 278
203 6.000e-25UniRef50_C3KGU2 Vacuolar proton pump subunit H n=1 Tax=Anoplopoma fimbria TaxID=229290 RepID=C3KGU2_ANOFI  ali  24  14NIIAAKAAEVRANQVNWQSYLQSQMISAEDCEFIKKFEVANSEEKQVILTNEGHQCAKTFLSLMAHISKEQTVQYILTLIDDTLQENHQRVSIFFDYAKKKNTAWSYFLPMLNRQDLFTVHMAARII................................................................................................................................................................................................... 141
204 1.000e-24UniRef50_L0PBM3 Uncharacterized protein (Fragment) n=1 Tax=Pneumocystis jirovecii (strain SE8) TaxID=1209962 RepID=L0PBM3_PNEJ8  ali  20  18.FLEELLSSIRLRPIPWIGHLRAGLVTDEEVKMIKALDWHSRKRRSLVLMKESKEYAELFLTLFQRFQRIDLLQYLLTLCSDLLDDVPKFSNVLLLYKNKENFPFSPLMRLLKHDDQIISLLSGKIMSSLVSAAPIIPTTT-------------------LSWFFEWISSLCQSPDH--NIQDLAVQALTGTLKNSFNRLRFWKESTYMQN............................................................................................................... 206
205 2.000e-24UniRef50_A0A0G4IW32 V-type proton ATPase subunit H n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4IW32_PLABS  ali  24  39.........................LTPSAVELIKS----AGTSAKDVYKQDGPALVSAILQCIQNSADEDVVQYVLTIADEILQSNPEAANLFMKLATKDYNPVVLLIRMLSRSN-YKSFTMGAICSVL-------------SVIMNALPKNDTQYDKWILQLGAWVSSKATDVTDR--YHTVALSSLKLFLRRHNTQILFADNGTLACLVNILR-IESTRNTQLVYQAAFCLWMLSYNTDVLRLFLRDNVAVSLVEVLQSVSREKVTRVILATIRNLVGKLSFNELFLQLNFLSVVDSVTQRSSTDPELLDDILVIRTAL 315
206 4.000e-24UniRef50_A0A2T7IDV2 Vacuolar ATP synthase subunit H (Fragment) n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IDV2_THEOR  ali  20  148...............................................................................................................................................................QLSXFLVTWPKRLLPPIRPXSYGRRGRVARPRRLYGPEKNHALVQNPA--VLALLRAGLGRESPPNTQYKCVFCVWLVSRSEECVPVLHDNELVRLLCELLAATKVEKVIRICLLVFGNLLGNAQCLEVMVETNVLQTLTLLAYDKWHDDELYDNIHRLHAQL 308
207 5.000e-24UniRef50_A0A2P5BAQ9 ATPase, V1 complex, subunit H n=6 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P5BAQ9_PARAD  ali  70  2..............................................................................................................................................................................PSHPSDGIPTAVNCLATLLKEPVVRSSFLQADGVKLLVLLISPASTQLSIQLLYETCLCVWLLSYYEPAIEYLATSRTLPRLIEAVKSSTKEKVVRVVVLTLRNLLSKGTYGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLDEGL 149
208 6.000e-24UniRef50_A9V9J6 V-type proton ATPase subunit H n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V9J6_MONBE  ali  20  24NSILEQAERIRSHKVPWEAF--SGIAGDEAVAAIKQLDGSSESTAAELAKADPKALIAT-LKLFSKLSNAVTLEYLVTLLDDFAELDSAHTSRIMSAGEKLEDGIDIFVKRLAADNDYVAHQAARMLARFALDG-------------------FKFEEDAIKKYLDWAANRIASGDRPGVL--LALTSLSRTFRKDEFREGAVKHAT--LLDVLKTLLTSTSQIQTQYQVLLVLWVLTFTEHSVAGMRQHALLTPTAEIMKAASKEKVVRMAFGFARNMIVKHEYCALLIKCVMPRVTELVTQQPYSDEDLLQDATEISEQL 367
209 6.000e-24UniRef50_A0A0P5ETY7 Putative V-type proton ATPase subunit H (Fragment) n=3 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5ETY7_9CRUS  ali  23  1...............................................................................................................................................................................................MLRDEKYRLVFAGMEGVSVLANILS---GRINFQIQYQLSFCLWLNVITPQLVEQMNKHKIIPILGDILNDSVKDKVTRIILAVFRNMIEKPENCVAMVQAKVLKQLSILQQHKFDDEDIMADIEFLTEKL 135
210 8.000e-24UniRef50_UPI00084669D6 V-type proton ATPase subunit H-like n=1 Tax=Drosophila navojoa TaxID=7232 RepID=UPI00084669D6  ali  25  21..LQQQAADIRTKSINWASYMQSQMISQEDYQTISALDKS----RATFLAQNSTQVVKTMLNLVSHLSKDSTIQYILVLLDDLLQEDRSRVDQFHETSAKKQCVWGPFLNLLNRQDGFIVNMSSRILAKFACWGHETMPKSDLNFYLQFLKDQLASN..................................................................................................................................................................... 172
211 9.000e-24UniRef50_A0A090M1M7 Armadillo-type fold n=2 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A090M1M7_OSTTA  ali  22  10..........LDREPAWESFLRGRLLREEDVARLTKIERRSREARGTMMRHHGGAVCETLLGALGNVGATEATEHVLALVDVVVHSRTWDVELAAVDGTADADAFYAMSRTLSRPDSFIKETSARVLAKLIEARPRTGVEAESKAESA--RRAARVVVSWASKELRSWTE-----SGDDGVVPAVACALAGSLEIPESR-VFAATEGIVGLLTPVLRANDRFSVQTMYEVALCFWLMSFTKEGRKDMCARGAVKALMACAGAASKEKVIRMCVLALKNVTDRQGAQGEAVLDNLQKLVRNLSLKGFEDEELSVTLTELDEDL 378
212 9.000e-24UniRef50_T1GCP5 Uncharacterized protein n=3 Tax=Diptera TaxID=7147 RepID=T1GCP5_MEGSC  ali  24  45..LQQQAAEIRQSQINWQSYKQSQMISQEDFACITTLDG----ERSNFIAQNGAQTVKTFLNLLSSVSKDSTIQYILVMIDDVLQEDRSRVDLFHEYTSKKENLWSPFLNLLNRNDGFTINMASRILAKLACWSHERMSKSDLHFYLEFLKNQLQSNDDI.................................................................................................................................................................. 201
213 1.000e-23UniRef50_H3FNC8 Uncharacterized protein n=3 Tax=Bilateria TaxID=33213 RepID=H3FNC8_PRIPA  ali  30  1..............................................................................................................................................................................................MMLRVDEYRAAFVALDGVSSIVHALS---GKANFQLQYQLVFAIWCLTFNADIARKLATMGVIQTLGDILSESSKEKVVRIILATFRNILEKREAALQMVQCKTLKTLELLDSKKYDDPDVEEDSEYLREKL 136
214 1.000e-23UniRef50_M2WUD8 V-type H+-transporting ATPase subunit h isoform 1 n=2 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2WUD8_GALSU  ali  20  8...............PWMELARSHLLQKSEAELLQSCEQNLSEEREGFLDKNCRSVVGAILSVLSLSSNVNEQQRAANLFLSLLTSRKEEAIVAVAKQDSKRNLFQPLITFLEKENRALAASCAQILAILFS--------VDSTYKLEPLDLVKKQCSHIADWFGNNLLE---NDSTDEGFLLTILSSLCQFVRHDNSRLAFAEKGKDNVNLSYLLEKNKQEPVSIIYKTLFVLWMLSFKQVVAESLEKIFISRHILEVLKYFTMEKVIRVTLSFTRNLAAGSRIRRELIGAGVLEQVVILSSKGWSDKDIVDDINAIQSCL 317
215 1.000e-23UniRef50_A0A0P5ZC95 V-type proton ATPase subunit H-like protein n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5ZC95_9CRUS  ali  22  106.................................................................................................................................................................................................RDEKYRLVFAGMEGVSVLANILS---GRINFQIQYQLSFCLWVMTFSPQLVEQMNKHKIIPILGDILNDSVKDKVTRIILAIFRNMIEKPENCVAMVQAKVLKQLSILQQHKFDDEDIMFDIEFLTEK. 237
216 2.000e-23UniRef50_F0XDT9 V-type proton ATPase subunit H n=2 Tax=Ophiostomataceae TaxID=5152 RepID=F0XDT9_GROCL  ali  18  9..LASVQSNTRMWVIAWDGAVRASNVLDWQLTLIQAIDKDKKDVRKQVVEANLDGYRILFNGLESAVNNDRVVQYMLVLQGDLLESIPSLSKAILKDTEPYRHLLPLLAHAKQAEDS-IALLASTVLTALLSSAQDASPATVQRVLPSLLSNSNAGLQDIGVKEFSSLLYSRETRQQFWAQRSETVAPLIAILRTEAVSASLWSGTTSXXXXXXXXXXXXQSHLQLLYHVLLVLWQLSFDAAVVGDDDEYDIVLLYTQLLRVSPKEKTTRLLVSTLLSLLNRASLLPTAMLARLPAQLQNVAGRQHTDTDLQEDLQQLRELL 379
217 3.000e-23UniRef50_W0TF40 V-type proton ATPase subunit H n=4 Tax=Kluyveromyces TaxID=4910 RepID=W0TF40_KLUMD  ali  15  14.HFQQIRHSLNSRTIGWDALVRSSEISKFDGETTKKLE--SGMLKNEKIDMPLDTALTALLHILATSNNLDVNKCVVNLLSQLLTLEPYSEELITLISKKDS-----------------KKVLSQFYEHTLNKGLVEEQFNLISAFTFVSLLLQFEDVELTSKLLENKQFQNLFKSEHKDAVYLAIRLLQELTVNKTYKQLVWSQHAYYLPIVFEQTNTNNLQIQLQYYALMIIWLLTFDPKITEAFTKQYLSQQLLALIRSTIKEKVVRLSVSIILNGIHKSTVKNLILLGNAIPTLNQIMERKFLDDELKEDLATLKESL 334
218 4.000e-23UniRef50_UPI000C6FB6FA V-type proton ATPase subunit H-like n=1 Tax=Copidosoma floridanum TaxID=29053 RepID=UPI000C6FB6FA  ali  26  19.........................................................................................................................................................................ELHELLNPNNDYIQSAARCLQMMLRIDEYRFTFVSVDG---ISTLLSVLSGRVNFQVQYQLIFCLWVLTFNPLLAEKMNKFNVIVILADILSDSVKEKVTRIILAVFRNLIEKKEHCIAMVQCKVLKQLSILSQRKFDDEDIMDDIEFLNDKL 175
219 4.000e-23UniRef50_A0A1S3QRZ4 V-type proton ATPase subunit H-like n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A1S3QRZ4_SALSA  ali  24  1...................FHRGQMISAEDCEFIKKFEVAHSEEKQTILTNEGHQCAKTFLNLMAHISKEQTVQYILTLIDDTLQENHQRVNIFFDYSKKKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGRDLMEGSDLNYYFNWIKTQLS....................................................................................................................................................................... 137
220 5.000e-23UniRef50_A0A0E0I242 Uncharacterized protein n=1 Tax=Oryza nivara TaxID=4536 RepID=A0A0E0I242_ORYNI  ali  99  45DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDNSLSGEDIYDPFLS.................................................................................................................................................................................................................... 154
221 7.000e-23UniRef50_A0A2H1BX94 Uncharacterized protein n=1 Tax=Fasciola hepatica TaxID=6192 RepID=A0A2H1BX94_FASHE  ali  22  23.FLQTTAAEIRLTRVNWQSYVQGQIINAEQFNFMTKLDNAPNAERDHVVKEDPQLTARVFIFILNRISKEQTLQYILTLLDDLLQEDKVRVEIFRDYFQSKESLWSHFFSFFQRGDPFCMFQASRIIAKFACWSSQLMEEKDLMYFLNWLRDQLKVPVCLLHDI.............................................................................................................................................................. 187
222 7.000e-23UniRef50_A0A177V4I6 Uncharacterized protein n=4 Tax=Tilletia TaxID=13289 RepID=A0A177V4I6_9BASI  ali  31  352.............................................................................................................................................................................................................................SPAQAQYQVILCFWLLSFDADVAAQLNKFGIIPLLADIARRAVKEKVIRIIFSTFKNLLTRAPNAPAMIGSRLLPLSETLAARKWSDEDIEEDLKAVQEVL 455
223 1.000e-22UniRef50_UPI000D77E8B2 ARM repeat-containing protein n=1 Tax=Pseudomicrostroma glucosiphilum TaxID=1684307 RepID=UPI000D77E8B2  ali  31  349.......................................................................................................................................................................................................................NAKSSPVTPQMQYQVIFCFWLLSFSESISEDINKFSIVPLLVDIARGAVKEKVIRITIATLKNLLLKAPNGPVMLGSKLLPLVEILSERKWSDEELEEDLKFLASEL 458
224 3.000e-22UniRef50_A0A0C9TBK1 Unplaced genomic scaffold PAXINscaffold_297, whole genome shotgun sequence (Fragment) n=1 Tax=Paxillus involutus ATCC 200175 TaxI  ali  27  10.YLDENSAKIRSKPVPWEGYQRAELVTSEELALIKKIDRQPRAKTESILVSDGQTYALLYLRLLKKLQRVDTMQCLLVLIADALLDHDERIPLFTRAAQSDPDPYLPLLRTLEAQDEFVQLKSAQILTILLSSESTPLQ------------------HQHLQPFLKVLASLVQGQYPNKR--DIAVQCLEALL................................................................................................................................. 182
225 4.000e-22UniRef50_A0A0L0DH02 V-type proton ATPase subunit H n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DH02_THETB  ali  21  183...........................................................................................RILARADVSDPKAFFVVSKVLEVIKALARAPLPIGVTQLADLLAWAHNQTVSSMQRXXXXXXXXXXXXXXXRVLASADATVSTMSGSSSFLEPAVGLLQTLLRYNSVRQEFWARPRAFDAILSLI-VPESLQFQLIYQALNVLWLLSYSADIAAEMPSRGVIPLLMRVLKRVRKEKVFRMAIGVVINLVDRGQLGSAIVEVGMVKYGKTLLAHAWKDADMIERIEALLDSL 415
226 6.000e-22UniRef50_A0A2T7IT92 Vacuolar ATP synthase subunit H n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IT92_THEOR  ali  15  22..............PDYEEWLNTGALDVESVELLKLYASLNTLEK--------------------RLVTPSPARFPLSAWAPGVRYGQTHALAVAPPGLVDNGIYDILLKILDGRDVFSMRPSGHVGPSGASHRPDPRRDVFSIYYDIATHERDKRIVEKTLYLLTGFVAHGRGCFSDDQVDSVVKLLLKALSNVLQLKKNHALVENPAVLALLRAGLGRESPPNTQYKCVFCVWLVSRSEEYVEHLLKNELVRLLCELLAATKVEKVIRICLLVFGNLLGNAQCLEVMVETNVLQTLTLLAYDKWHDDELYDNIHRLHAQL 361
227 8.000e-22UniRef50_H3FNC9 Uncharacterized protein n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=H3FNC9_PRIPA  ali  23  23..LQLEAAEVRTQKPNWPSYLRSQMIPQEDFNLLTAYEAASKDERDRVLREHDEQAVKTIVNLLNNVAKDQNIRYVLTLFDDMLSEDKSRVDLVHRAHRQKRTAWGWFLGLLQRQDNFIVNQMSSVIAKLACYGSTQMDGQDLNYYFSFLKDQLRTS..................................................................................................................................................................... 181
228 2.000e-21UniRef50_A0A0C2C2D8 V-ATPase subunit H n=1 Tax=Ancylostoma duodenale TaxID=51022 RepID=A0A0C2C2D8_9BILA  ali  22  2...........................................................................................................................SSIIAKLACFGSTLMEGSELNYYFSFLKDQLK-------------------SSSTNEYMNTTARCLQMMLRIDPYRHAFMEAEG---IQSIVAALNGKANFQLQYQLAFALWCLTFNPDIARRTPSLGVIQALGDILSESSKEKVIRIIIATFSNILKKKEAALQMVQCKTLKTLELTDAKKYGDTELE.......... 175
229 2.000e-21UniRef50_A0A1X7QXR7 V-type proton ATPase subunit H n=1 Tax=Kazachstania saulgeensis TaxID=1789683 RepID=A0A1X7QXR7_9SACH  ali  16  14.HFTEIRNAIRSRSVAWDALARASEISEIDAAVAKKLEKNNGTEHDLETLKINENVILPLLHLLATSSNTDSIKSVLNLISELLSCDNDTVEFFKKNPDQLKNLFD--VSFIESYDQQTILISSFNIVSLLVQFSSKANEKMVKQLLDNQKETCYVTIRELQELSTIPEYRQLIWKHEDQILPTIFQIIRRSINNKNNLPYDHNSNHDNDNVVIVNTNTNNLGIQLQYYSLMLIWLLTFNNQIASEITIRYLFLNLLKLIKVTIKEKVTRVSISILLQCCHKTFIKNLILLGNGITTLDSLTGRKYSDEELREGIINLKSIL 361
230 2.000e-21UniRef50_A0A061H9F0 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H9F0_9BASI  ali  36  397............................................................................................................................................................................................................................RASTQLVYQIVLCLWLLSFDDDIAAEINKYGVVPVLYDVARNAVKEKVIRVTVATLKNLLSKAPNASAMLGSKLLPLSENLIARKWSDEEIEEDLSFIRDDL 501
231 3.000e-21UniRef50_G0V982 V-type proton ATPase subunit H n=5 Tax=Saccharomycetaceae TaxID=4893 RepID=G0V982_NAUCC  ali  15  18.HFNEIRGAIRSRTVAWDALARSGEISELDASVAKKLEPDGVAENLIIDESVVLPLIHLMAHAMENDSKFEILKSVQNLFVE-LFCSASFCDGTIEFFVQNPDQLDALFKVSLVGDVQTVLISAFNLVTLLIQPELIEKKKVSNIKMVDELLGNKDFMGILKGY------------ERTDTCYVCIRLIQELMGVKQYRSTIWSHEADIVPPRLVATSSNNLGIQIQYYSLLLIWLMTFNSTWANEFVNKYLFLNLLKLVKITIKEKISRLSISIILQCCHKSIIKNLILLGNGIPTLQSLSERKYSDEELREDI....... 365
232 3.000e-21UniRef50_A0A0E0LLZ5 Uncharacterized protein n=1 Tax=Oryza punctata TaxID=4537 RepID=A0A0E0LLZ5_ORYPU  ali  97  336DHAELTTEQVLKRDIPWESYMANKLISGTCLQLLRRYDHKPESQRGPLLDEDGPSYVRVFLNILRNISKEDTVEYVLALIDEMLAVNPKRAALFYDKSLSGEDIYDPFLNC................................................................................................................................................................................................................... 446
233 4.000e-21UniRef50_A0A2R5GX79 Potassium voltage-gated channel protein eag n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GX79_9STRA  ali  19  482.SFVLESEGANAQAPDWNAVASTAGLSSHDVSAIRAVEGQDERATSELLAENGADLGAALLKTVGAVSDANVLRYAVQLAEKVLPDLAKRAKAIFSGAGEPTDLLGSFAKLLEVQDEMVCLRARYVSSMLLSVAGDHASESQ-------------GGKTILNSICNDLTSDGRLASKS---LMAALQSLSVLLRNHTMRSAFEHRAGIIMLLDLADQGFSNMSANTQYTLALCIWLSCFSESAAARVDQAG-LSTLVRLLRLEPRLPTTRLLLATIRNPDNQQALCEAVIEAKLPKILGQLSSKKVKDVEMRANLDWLHETL 811
234 4.000e-21UniRef50_A0A066WPN4 ARM repeat-containing protein n=1 Tax=Tilletiaria anomala UBC 951 TaxID=1037660 RepID=A0A066WPN4_9BASI  ali  35  369.......................................................................................................................................................................................................................TPVSGQVGPQLQYQSIFCLWLLSFDDEVAEKLNIFPVVATLTEVAKSAIKEKVIRVIVATFRNLLQKASNAPALLGSKVLPLAESLTARKWSDEEINEDLDYIVEEL 478
235 8.000e-21UniRef50_R9AAR9 V-type proton ATPase subunit H n=1 Tax=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) TaxID=1299270 RepID=R9AAR9_WALI9  ali  21  18............KSIPWLGYLKSKSISQGDYQLITGLDNHGVDF--SVDQYSIECHIHLLNSLLNSINKLDVVQWVLYRLQQLLLINPPTTLNLL---TNTPNINENLLQHLQNNDTYTHLSTEKLLSLSLTHSPSTHH---LNSLLHSIHKDIDTGVYVDVSTLLLTQLLSLTPSKHYSYHNI-------------------------LPTLIPIMSHPQTPPQTTYNIIYSIWIISFDSSLCARINTHQIIPHLANVAKTSIKEKVVRLILATFSNLLRKKNTLNTFLALPIQPTLTSLSTRRW................ 281
236 9.000e-21UniRef50_A0A1S3QRU8 V-type proton ATPase subunit H-like n=4 Tax=Eumetazoa TaxID=6072 RepID=A0A1S3QRU8_SALSA  ali  31  2....................................................................................................................................................................................................................SITAVLSNKCGFQLQYQMVFCMWLLAFSSQLCEQLRRYNVVPALSDILQESVKEKVTRIILAAFRNLLEKSEYALAMIQCKVLKQLENLDQQKYDDEDITEDIKFLLESL 118
237 1.000e-20UniRef50_A0A0D6EMB4 SPOSA6832_02514-mRNA-1:cds (Fragment) n=1 Tax=Sporidiobolus salmonicolor TaxID=5005 RepID=A0A0D6EMB4_SPOSA  ali  28  1.................................................................................................................................................................................................................................MQYQLAFCFWLLTFDTSIAESINKYALIPLLVDLARGAIKEKILRVVVAAFRNLVVKAPTLSAMLVAKVLPFVQSLQGRKFSDEEIREDVDFLVEEL 100
238 3.000e-20UniRef50_Q2HAF8 Uncharacterized protein n=2 Tax=sordariomyceta TaxID=715989 RepID=Q2HAF8_CHAGB  ali  13  8.YLASLQGNVRQRLIPWDGAVRAGSLTEDQLARIRAVDKVKRDVRIQIVEADLDGYRTLFVGLESAAKRQDVVQNILVLLSDLLDCVPALSKAIIQTGDPYRH-FLPLLAHSSNTEDPIPLLTSTVLVKLMAGSRDESPATVGKALPV---------------IFSYLSSLTKIS--DAGLQDIGVQEYSSLLYGRATRQQFWKQRSETVISLI............................................................................................................ 209
239 3.000e-20UniRef50_A0A2T7IS49 Vacuolar ATP synthase subunit H (Fragment) n=2 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IS49_THEOR  ali  22  7.............................................................................................................................................................................................................QNPAVLALLRAGLGRESPPNTQYKCVFCVWLVSRSEEYVEHLLKNELVRLLCELLAATKVEKVIRICLLVFGNLLGNAQCLEVMVETNVLQTLTLLAYDKWHDDELYDNIHRLHAQL 123
240 3.000e-20UniRef50_U6M3K9 Vacuolar ATP synthase subunit h, putative n=1 Tax=Eimeria maxima TaxID=5804 RepID=U6M3K9_EIMMA  ali  18  3......................................................................QEQTEQVRLLNSLVRADNNHSQVKQELVMQRQPEWGLLERA-----GLIKKGMAEALAGLHALDAEQRADAIEEGLWCSRSRTSRFTDEEIQYFIQGLVGGRFPVSEAGRLD-----ALVNILKIDTWRPFVWDTRNVPDL--LLKNLSLMQPPSVVYKAVFCVWLLSFHEGFPNQLTETGILKATCEVLKESRVEKIVRVGLHVIDNFLSCEDAVEIIIEENLAQILTLLEFEKWRDADMV.......... 232
241 3.000e-20UniRef50_A0A0D1DVI4 Uncharacterized protein n=13 Tax=Ustilaginaceae TaxID=5268 RepID=A0A0D1DVI4_USTMA  ali  33  361...........................................................................................................................................................................................................................TRAGTQLIYQVVLCFWLLSFNKDIAAELNKLGLIPLLVDVARNAVKEKVTRVTVATFRNLLAQAPNAPVLLGSKALALTETLLSRKWSDEEIQEDLEYVKSEL 466
242 4.000e-20UniRef50_Q22W07 V-type proton ATPase subunit H n=2 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=Q22W07_TETTS  ali  19  35.....................QGSLVRPENQALFKKFEADINQQRDMITKSEGIGYVNMLFDITNQCNHNSIMMYVLPTIDGIILDDRRNIQKFLQSFQDQPDNKNWLTLQLPSFDKIVYEAAARVRSQILAELDKKSF------------------LNEQKQFLQWLIRSKDVSHSSNHLDDFCLTCFAFLLKHEHLVKVFLDNNGAQFLHE--NMKKNPSDLQKMYYTLLILWLISFSEKSVPFFTKLRLIGQSIEVIQKISREKLVRVAFACYKNLSQYNNCIEVIVDNDLLKVCETLLKGNIKEKEVLDDIQFMGEIL 325
243 4.000e-20UniRef50_A0A067EDD8 Uncharacterized protein (Fragment) n=5 Tax=malvids TaxID=91836 RepID=A0A067EDD8_CITSI  ali  61  2...............................QLLRRYDNRSESHRAQLLDDDGPSYVRVFVSILRDIYKEETVEYVLALIDEMLTANPKRARLFHDKSLASEDTYEPFL-----SNWFIQEKSCKILASIVRYLKHDPFA-----------QRCNSLEVGIFCYIQLLI--LKKPSHPSRGVPVAINCLAALLKEPMVRSSFVQADGVKLLTPLISPASTQQSIQ................................................................................................. 177
244 5.000e-20UniRef50_A0A2P8XVQ7 V-type proton ATPase subunit H n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8XVQ7_BLAGE  ali  24  1.....................................................................................................................................................MKLYQSNINDTTQKQVSELIHHGNFCFQKHPYQLDLIRCLQTLLQNNKYRQVFDLIDGVSFIINMLS---HRNNFQVQYQLIFCLWLLTFKSEIASKIMPSTVIKLLSDCLNDSAKEKVVRITLALFKNLLTIPENTIVMLRYRVLKQLMVLRKQKYSDEDIVNDIHFLIDHL 178
245 5.000e-20UniRef50_UPI000D7FCC1F ARM repeat-containing protein n=2 Tax=Exobasidiales TaxID=5404 RepID=UPI000D7FCC1F  ali  29  323.......................................................................................................................................................................................................................TSMGGGVGVQMVYQVVFCIWLLSFDDAIAAQLNKFGLVALLADVARNAIKEKVVRVIAATLRNLVEKAPNAPALLGSRGLALMDSLAARKWSDEEIPEDVEAVRAVL 432
246 6.000e-20UniRef50_A0A0L0FRZ9 Uncharacterized protein (Fragment) n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0FRZ9_9EUKA  ali  27  1.......................................................................................................................................................................................VVIKSLMSMLRFDQYRLKFYQTNGVGALCDLVIN--KAANFQMQYQVVFCFWLMTFNSDIAQTISKRHIPSVISNVLAKSSKEKVVRVATLTLRNILEKSENVEIMISNKLQRQLRLIQSKNWKDEDIKDDVEYVVDT. 142
247 6.000e-20UniRef50_A0A2T7IUU3 Vacuolar ATP synthase subunit H n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IUU3_THEOR  ali  16  22..............PDYEEWLNTGALDLESVELLKLYASLNTLEKVEMIRKN-ELISKIFLNATYATGPGLLRSYSLQHLADVCRGMFSDRLGLPTYGGRDNGIYDILLKILDGRDVFIVEKTLYLLTGFVAHGRGCFSDDQVDSVVKLLLKLSIDPYAKLHALSNVLMANFDRSGHDRFDHPVNVTCSGEICHCRPHKKNHALVQNPAVLALLRAGLGRETPPNTQYKCVFCVWLVSRSEEYVPVLHDNELVRLLCELLAATKVEKVIRICLLVFGNLLGNAQCLEVMVETNVLQTLTLLAYDKWHDDELYDNIHRLHAQL 426
248 6.000e-20UniRef50_I1GTM4 Uncharacterized protein n=9 Tax=Mesangiospermae TaxID=1437183 RepID=I1GTM4_BRADI  ali  90  2DRAELTTEQVLKRDIPWETYMSTKLISSTCLQLLRRYDHKPESERGPLLDEDGPSYVRIFLNILRSISKEETVEYVLALIDEMLAVNPKRAALFYDESLSGEDIYDPFLS.................................................................................................................................................................................................................... 111
249 6.000e-20UniRef50_A0A078AP22 Vacuolar atp synthase subunit h n=2 Tax=Oxytrichidae TaxID=57506 RepID=A0A078AP22_STYLE  ali  19  36.................QQYESSQMLPQGSSAKFTEFMSLNDDQQRQAIKNKAEEYIRLFFEIVKKVKEPKLVTFALMLIDGILEDSRTRIQYLVHKKDKKEDLIGLLNSFLWQNNQAEQHQRDLASHILA---------------MLIEAHEYKNCQNEAKQFLNWLIEQKQKPNISLNAYTFA---LMYLLKTNELAKEFVDQGGFELFSNYLNYECIK-SYQIAYNVINALWIISYHPFSSRGFEDYRIIERVAKVLDYFSKEKIVRIILLLLDNLKQNDVCLEIMSDINAISIMTKLQNRHWVDNDIHDLLDKLFNYL 331
250 7.000e-20UniRef50_A0A2V3IGL9 Putative V-type proton ATPase subunit H n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IGL9_9FLOR  ali  19  72.................DAYTRAGKLLTAIVDYVT--PKSRSAAFNQFLSGLGPTYLQNFINLLEK--DKEVASWYLGALGPILAEQNGDEKAIEEQKRAYSSAAADVLATITAQSLLANEEEEEEQAEEQSTSAALPAVSFSSLRSSGPHSAASSIGYIPTVADIGAPLPQPFSSAGDEQLGRILSGIAQFLSTDENRLIFCTVKPDCALLASLLDKEVGMPVQVHYQAVFCLWLLSFVSQVSDALEEAAVPRRLTLLLREVWAEKVVRVSLATLRNLLMSTTLRKEMVGAGLVSALQSLCFRRWNDEDIRDDLGVLAEAL 395
251 7.000e-20UniRef50_R7QM29 Uncharacterized protein n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QM29_CHOCR  ali  19  27.................DSLIRAGKLVVAVVDY--ATDRGNTATFSAFVSGLGPSLFAPFVNVLKH--DREVSSWFIRALGKMLGHKDDNAGCMDALDEQKAKYVSAVTSTLAAITEHCMLAHNAEDTPDINAGQQLSPSITGELASASSALGYIPTVAD----ITVTMPRGGQSNAGDEQLGRILAGLAAFLSTDNNRFVFCKTRGTSVLAALLDKDVG-LPVQVYYQTVFCLWLLSVVDTVSQALEEAAVPRRLTNVLREVSAEKVVRISLATLRNLKMSVTLRKEMVGAGLVGALHSLCFRRWNDEDIREDLGVLAEAL 345
252 9.000e-20UniRef50_A0A094ZFN4 V-type proton ATPase subunit H n=3 Tax=Platyhelminthes TaxID=6157 RepID=A0A094ZFN4_SCHHA  ali  17  1.......................................................................................................................MYQASRIIAKFACWSSQLMEENDLIYYLNWLREQLTIT--------------------NNQYDQTVARNLQMMLRIREYRAQFAKVGGIETIGDVLQ--EKSTSRQLQYQLIFCLWCMSFDSIHVTDICKSALLATVADIFLEADREKITRISLAFFRSILEKLPCGLRLVQYKVLKELELLNQKDFSDPELTEDIAFLNEKL 190
253 1.000e-19UniRef50_I1BPZ9 Uncharacterized protein n=2 Tax=Rhizopus TaxID=4842 RepID=I1BPZ9_RHIO9  ali  26  1......................................................................................................................MSLEASKLLTLLACSAPEPSSIVDLSTLYQWITEKL--------------------TSHQNEVVELVIQELESLLRISNYRLPIWNTQ---------NTIKDTDYVEYVY--------------ANDTNRKYDIIPLLVEIAKSAVKEKVIRVSIATLRNLVEKAPNLAAMLVSKLLPFTENLSARKWSDPDILEDIDFVKERL 163
254 1.000e-19UniRef50_K0RRG4 Uncharacterized protein n=3 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RRG4_THAOC  ali  24  143......................................................................................................DEWRALLRVLHSGDAFAQRGAAYCLASILMAACPSQQSGARTKEHDCSSRS---AEEPLQALISWITXXXXX--XXXXXXXXVTPTLIALMSCPEARIVFSNSGGIGYLSRHLRNPRSTVTVQQMYELCFCLWALTYECSIRNTFHRDNAVNSLVDLVSSAPREKVVRVALSALRTLAQCDTYLSDMIGCGLIKYVDQMKERHWTDPDIIDDLSVLHRVL 384
255 1.000e-19UniRef50_A0C6M7 V-type proton ATPase subunit H n=3 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0C6M7_PARTE  ali  20  37....................QHGKSIKKDTKDMFIKFTQAKLQDQKKLLETDSVGVFQMLLDIIENVAHDKPLMYILTTIDAIISENQRLFKQFMRALTPQVVPKLKQFLFLDGYDKVVYEAAAKIVTMIIADEGGNDAKEWVILFIGGIGNKLKISD------------------------QMIMPICVHFLKHDSLAIQFIKSGGIKIVSNQLTK--YPTDLHIAYYTILALWLLSFTNESIPLFNDLGLIRMIIESVQKISREKILRVSFACFKNLVDSAQCIELMVDNGLIKVVDLLLKGNLKDQDLIDDIKYVGEIL 316
256 1.000e-19UniRef50_U5CVT1 Uncharacterized protein n=2 Tax=Magnoliophyta TaxID=3398 RepID=U5CVT1_AMBTC  ali  60  6................................................................................................................HNYDMFPWIIRCCKDIIIVISARPKSQNILPNGETS--KKKVTTIDDVLKGLVEQLCSQLKKPSHPNRGVPTAVSCLATLLREPLVRSLFVKADGVKLLTPLISPASTQQSIQLHYETCLCIWFLSYYEPAVEYLATTHTLPRLIEVVKISIKEKVVKVVVLTLKTLLPNGTFGAQMVDLGLP........................... 186
257 3.000e-19UniRef50_F8W3K9 ATPase H+-transporting V1 subunit H n=2 Tax=Clupeocephala TaxID=186625 RepID=F8W3K9_DANRE  ali  28  14NIIAAKAAEVRANKVNWQSYLQGQMISGEDCEFIKKFEVAGSEDKQAILTNEGHQCAKTFLNLMAHISKEQTVQYILTLIDDTLQ............................................................................................................................................................................................................................................. 98
258 3.000e-19UniRef50_A0A238BK19 V-ATPase subunit H (Fragment) n=1 Tax=Onchocerca flexuosa TaxID=387005 RepID=A0A238BK19_9BILA  ali  26  1.....................................................................................................................................................................................................................ILSVLSGKTNFQLQYQLIFSLWCLTFNPTIAEKFPHTGAIQILGDILSESTKEKVIRIILGTFRNILEKRETALQMVQCKTLKTIELMDSKKFDDAELNDDVEFLNDKL 116
259 5.000e-19UniRef50_S4RQK2 Uncharacterized protein n=1 Tax=Petromyzon marinus TaxID=7757 RepID=S4RQK2_PETMA  ali  20  1...................FRRSQLISADDFEFIQRFTAAGTEQRRRIAEIEGTQCAQTLLHLVTRIVKESVVHFVLVLIEDLLQENGEHAQIFVFTRRNHRSQWVLFMPMLNRQEILTMHLAARVVARLAIMSRELLQGSDLGFYLTWLKTHLSVQSWLGGGRRPSSGSRLTSDNQALHYFQSAASCLQLILRTGEYRFAWVQEDG................................................................................................................... 190
260 5.000e-19UniRef50_A0A0V0QS56 V-type proton ATPase subunit H n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0QS56_PSEPJ  ali  25  36.......................DLKSNTSKQFRQFVDLLNVSEQREHLSKNAPQIFDAIQDIIDKVSYEDLIKFVLPLLDGILTDDRKNIQFIIRNITNNGDLITALQRILQKHNIIVHEAAAKILAFIYSELDSADFG--------------GKQKDFLKQLLALKDSQLGNQQIKIGNYNF-MTALVNLLKIESLVPIFLQNGGQNILSEFLKK--YSNDLQIAYYTLLNVWLISFSQEAQEHFATLGLIKSMTEVIQRLSREKLVRVAFGTFRNLCGNKDAIELMVDAQLIRFVEIQLKGNIKDQEVIEDLQHVGEVL 324
261 1.000e-18UniRef50_G4VGA9 Putative vacuolar ATP synthase subunit h n=5 Tax=Bilateria TaxID=33213 RepID=G4VGA9_SCHMA  ali  15  1.......................................................................................................................MYQASRIIAKFACWSSQLMEENDLIYYLNWLREQLTIT--------------------NNQYDQTVARNLQMMLRIREYRTQFAKVGGIETIGDVLQEKLTSRQL--QYQLIFCLWCMSFDSIHVTDICKSALLATVADIFLEADREKITRISLAFFRSILEKLPCGLRLVQYKVLKELELLNQKDFSDPELTEDISFLNEKL 190
262 1.000e-18UniRef50_A2FS41 Uncharacterized protein n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2FS41_TRIVA  ali  17  33..........................NAEDCKAFVSLFQASPENQLTEFVKNKN-HAEIFTKLLSTRSDPAPLNLLCAFIDRLLDLD-----------------FNATIGALMANSQKLSEGCAKILIGHTADHLNQAFLVRTILLLLGTIISERDTKATTEAFQTFTRTALSLLSAKLNEASIALECVKRALRSEQFRSTFISEKGTKLLLDLLTQAQKASNTDSLYHILFCIWGISFSAEGAGQLSEGDFIPILTKLLSTPEREELVRLLTFIIQQLNPSIVFIENAYDYDILRLVRNLQTKHYVDPELTTEIAKVAD.. 310
263 1.000e-18UniRef50_K8EBV5 V-type proton ATPase subunit H n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8EBV5_9CHLO  ali  30  50...DRQIKEKLEANFDWKAYEHGRLVSPTDCNLIVKYESSMNTAKSLMESSDGKLIANAFLDVFRNVSRREAVERALANVCKMLGDPKVSSEYFMTVTLSNIDAYKALTRLMAKNGWFVREKASFILGVLLSKSESLRNESFFSXXXXXXXXRCSEEMQTARTVVRWSIDLLGGGDNEERVIPTAIHALASVLQHRKTRPLARNLGAYKLIAPLLDSEKFNPNVQVLYEAALCAWLLSFDAKARKKIDNAIVVKKLINAAKTATKEKVVRVAIMALKNILSNKENAASAAHVGLQKVCENLAHRGFEDAELVDNLEQLAKGL 480
264 2.000e-18UniRef50_A0A175YS92 Uncharacterized protein n=1 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=A0A175YS92_DAUCA  ali  14  519...........................................................................TCVEESKYLEYLALGVSCIGESLVNASDIKASTISPSTSGDEYVALFVRML--GLDNDPLDRDQAVVALWKYSLGGKQFIDAIMRFRGSINLVVNLLKSESTSTC--EAAAGLLRTISAVNAYRDLVGESGAIEEIFGLLRRSSLVSDV--KEQSLFTLCNLSVDEKFRSKIVHSDLLPILIKLLED-EDIKVVEAAGGVLANLALSQSSHKIMVEAGVIPKLAKLLT---TDAE............ 743
265 2.000e-18UniRef50_A0A1Z5KS71 V-type H+-transporting ATPase subunit H n=4 Tax=Bacillariophyta TaxID=2836 RepID=A0A1Z5KS71_FISSO  ali  27  155......................................................................................................EQWKALLRILDKPDAFAQKVAALCLAQMLVTACPSQRHRSVDGKARPI--QYASAVEPLEAITAWVISQLKNATGP--LVGSCSPALKVLVDAHETRVLFCKSGGIKYMARQLRIGNKSASVQQLYEIAFCMWILTYELNHSSAIRHDFAVSALVDLIAVAPREKVVRVALASLRNLALCKFFLSEMIACGLIKAVDHLRDRQFTDPDLAEDIQLLHKLL 403
266 2.000e-18UniRef50_Q4N0S4 V-type proton ATPase subunit H n=5 Tax=Theileria TaxID=5873 RepID=Q4N0S4_THEPA  ali  14  21.............TPEYEEWLVTGALDTESVELIKHFTSLNSLERVEMVKND-HLILKILLNATYATGPGLLRLYSLQHIHDICRIDNNIYNILLE-ILNHRDVYSIYYDIITHEKD---KKIIQIILYLLTGIHYSTYYIILLWFIAYNNNNIFNNEEIENIINLILKLTINDYSK--------LYSLANILQLSRYHELI---ENESVLGLIKSNLDKEILPNAQYKAIFCLWLVSRTNKYIEFFYQQKLIHLLCNILSTTKIEKIIRISLLLFKNLLNNINCLQVIVEYNIINALTLLLYDKWNDSELYDNLQKLHIQL 313
267 2.000e-18UniRef50_T5A8N0 Vacuolar ATP synthase subunit H n=2 Tax=sordariomyceta TaxID=715989 RepID=T5A8N0_OPHSC  ali  20  11........................................................................................SAVPTLAKALLSNPDPYRHFLPMLRSNTDPIPLLTSHALTNLMALARDDSAAVMLTYLAALAKSSDAGLQDIAVQEYSALLFSHVSRDQFWKQRSETVAPLITILQTAESSASLWSGNASVRTTGFEGFLGGGVGLQLLYHVLLVVWQMSFEAEEIGDDDEYDIVLLYTHLLRLSPKEKTTRLILSTLYNLLEKKTLLPTAVLARLPALLENLASRHLTDPDMLGDLESLKELL 263
268 2.000e-18UniRef50_A0A1E5RAP4 V-type proton ATPase subunit H n=1 Tax=Hanseniaspora osmophila TaxID=56408 RepID=A0A1E5RAP4_9ASCO  ali  15  9.HFDTLKSQVKFQQTPWDSLVRSGDLNKTELDVLKNLFQNGVSDSSNKKDLD------AVFKIIKTTDNIAILQNCYSLLVDLFISEKNKPIY--EIVSAKNVCQEYLQTLLDSFKKIPKDASESNILVVETLGLYTAIVLLLQVQFDDAFFANFLSNVYFPLFKKTFGFV-------NELQYTLIRYLQELAAVSHYRSVIFSKDNDFVDHNQTVLPNNNLTIQIQYYSLLTIWLLTFENSIASKISTKYALLKLLRLVTVTIKEKITRLSISVLLNCCKNNKNFLMILLNNSKTLLANLSNRKFSDTELVQDLSTLNE.. 339
269 3.000e-18UniRef50_UPI0009E2B740 uncharacterized protein LOC110018317 n=1 Tax=Phalaenopsis equestris TaxID=78828 RepID=UPI0009E2B740  ali  12  8..........................................ASSINIFVYNHIPRRRHYLYLSLHDFSEAIRRSCLPRGSLASALKPREFPVQSRAAADDGVPIEVSISNANSGEGYIGLFV--QMLGLDNNPVDREHAVMTLWKYSDGGKNFIDVIMKFPGCVKLVLSLLKSGNFSTC--EAAAGLLRNISSVNLYRDIIAESGVIEEIVWLLHQPCLTIGV--KEQSLCTLWNLSIDEKTRIKIAHGDFLPLLVKFL-DDEEIKVKEAAGGVLANLSLSPCNHNNMVEAGVIPKLANL..................... 262
270 3.000e-18UniRef50_B9SP70 Uncharacterized protein n=15 Tax=Mesangiospermae TaxID=1437183 RepID=B9SP70_RICCO  ali  14  1..............................................................................................................................MLGLDNDPLDREQAVEALWKYSLGGKKCVDNIMQFQGCVNLIINLLKSDSSSTC--EAAAGLLRSIASVNLYRDVVAESGAVEEITGLLCQPSLTSEV--KEQSICALWNLSVDEKIRVKITNSDILPVLIKALED-EDIRVKEAAGGVLANLALTVSNHNTMVEAGLIPKLAVLLKADIEDE............. 178
271 3.000e-18UniRef50_A0A1Y3BE06 V-type proton ATPase subunit H-like protein n=1 Tax=Euroglyphus maynei TaxID=6958 RepID=A0A1Y3BE06_EURMA  ali  22  28..LHQKANDIRQKCISWRSYHSSQMISDRDFKFITLYEKVTAENRAEFVQQHAMEMAETFLTMLSTVSKDETIQYILCLIDELFLEDRNRVEIFHTYCSKHETLWKNFFPLLLRNDEFIQNMRLLECQK................................................................................................................................................................................................. 155
272 5.000e-18UniRef50_A0A0C2D5M3 Uncharacterized protein (Fragment) n=2 Tax=Chromadorea TaxID=119089 RepID=A0A0C2D5M3_9BILA  ali  22  48..LQIEAAEVRASKPNWGSYLRSQMIPQEDYNFISAYENKNKEERDGVLAANNGQAARTIVNLITNVAKDQNVRYVLTLLDDMLQEDKSRVEIFHAARKQKRTVWSWFLGILQRQDNFIVNQ........................................................................................................................................................................................................ 171
273 7.000e-18UniRef50_A0A094A4Y3 Uncharacterized protein (Fragment) n=1 Tax=Pseudogymnoascus sp. VKM F-4281 (FW-2241) TaxID=1420906 RepID=A0A094A4Y3_9PEZI  ali  22  1..........................................................................................SQTLVDGLVEHENTYAPFLPLLAQATSP---------EEAIPLLTSTALTTLLARESTTNPKGRQASDEALPILYKYLSTLA--KSSDSGLQDIAVMGYSSLLRSRRARELFWEHRTVEPLIAILRTINGGIDLQLLYHVLLVMWQLSFEGVAIGDEDEYDVIPLFTQLLKLSPKEKTTRLLVSTLYNLISGNPLLPAAALVRLPTLLQNVNGRHLTDPELIEDLTALSELL 253
274 7.000e-18UniRef50_A0A182T430 Uncharacterized protein n=1 Tax=Anopheles maculatus TaxID=74869 RepID=A0A182T430_9DIPT  ali  26  25..LQQQAGDIRQNKPNWYSYMQSQMISQEDYACVSSLDK-DKKAQAQYLQENAGQCAKTLLNMLAHVSKDQTIQYILVLIDDLLQEDRGRVQIFHDYNKKKESVWAPFLNLLNRQ............................................................................................................................................................................................................... 137
275 8.000e-18UniRef50_A0A023B3E2 Putative vacuolar ATP synthase subunit H n=1 Tax=Gregarina niphandrodes TaxID=110365 RepID=A0A023B3E2_GRENI  ali  18  28.............KPDFVNLARQGEIDQKYVDLLESAAAAASTQSDELL-KDPAILEALLMSLRSINKTPQAAEYIASLIIDGCKLDTSNWSLVANCPAIADGAYAAFSRSWPSNGKVVNDSFALLISTCLNYNPGTID-------------------------VRPLFKLIIDPSQEKMTSAGRLAAISSLLRLDALRADLCNSST---LRGVICQGLTSKDVYQTYYAVLCLWQLSFNRKVVEEYIHRSMLRSFLAMFGGIKKEKIVRASIMLLNNLVDEEWIFEILIQQKVDYTLTSLTYEKWRDEELSNDIESLQRK. 312
276 8.000e-18UniRef50_UPI0008708B10 U-box domain-containing protein 2-like n=1 Tax=Pyrus x bretschneideri TaxID=225117 RepID=UPI0008708B10  ali  15  1..............................................................................................................................MLGLDNDSLDREEAIVALWKYSLGGKKYVEAIMQFTGCINLIVNLLRSESSS--ACEAAAGLLRSISLVNLYRDVVAQSGAIEEITGLLNRP--SLNPEVKEQAICTLWNLSVDEKFRVKIANSDVLPLLVKSV-DDEDVKVKEAAGGVLANLSLSHFSHSIMVEAGVIPKLVRL..................... 170
277 9.000e-18UniRef50_Q38CG7 V-type proton ATPase subunit H n=13 Tax=Trypanosoma TaxID=5690 RepID=Q38CG7_TRYB2  ali  18  16.....................KTGFVDETMTQVLEQLFDCPQHGRETYMRGRHEDICMVLIKTLATTHNKSTLGVLLRLFADLARSSTVMGKTLGLCSSVLVDQEDPVQMFL-------------YLATTHSRDRMISDPALYLAATTLRYADPKLNEESLERFFAIVNESLSVNPLQVEAVSFTVHNCAIMAHAKALRHYFFDNKLVQYFPRLLTDTIGASLVQLTYEVLVVTWLLSYEVDGVVSLQEHKMLPHIHRVIQRMQKEKCIRVALMVLWNFVQAPSFIAEMVGVGMLKTLTQLARRKFGDEDISELIQDLLNVL 340
278 1.000e-17UniRef50_B5YMR4 V-type H-ATPase subunit H (Fragment) n=2 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B5YMR4_THAPS  ali  28  23........................................................................................................................................................................................VTPTLTALMSCPEARILFASSGGIGYLSRHLR---NGATVQQLYELCFCLWTLTYECNVRVTFARDNAVHSLVDLVSSAPREKVVRVALSALRTLAQCSTFLNEMIGCGLIKYVDQMKERQWTDPDIVEDLDVLHKLL 177
279 1.000e-17UniRef50_A0A1X0NJ38 V-type proton ATPase subunit H n=1 Tax=Trypanosoma theileri TaxID=67003 RepID=A0A1X0NJ38_9TRYP  ali  19  19.......................RIVDESTVRLLEHLFTCPPSGVQSLIEGKQQLVAVALFKAAKETHSTHILGFVLRFFADLVFSSTSLAEQLGVQDAEKLFGDAPAKFFL-------------YIATMYREDRGVSDPALFLAATALRYGVPEQNTEALQRFFAHVREILSAETLEVPAVAFAVQACAIVARKKSLRHYFFENQIVEFLPRLLFDIVASSIIQLIYETLLVAWLLSYEYIGVVELQRQKMIPHLHRVLQRLQKEKCIRVALMALWNIVEAPAFIAEMVSVGMLKTLAQLSRRKFGDEDIGGIINELQSVL 341
280 3.000e-17UniRef50_A0A2H9TGU8 V-type proton ATPase subunit H-like protein n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TGU8_9FUNG  ali  25  21.................................................................................................................................................................................................RVSSIRDAF--SRRCDDLKMLATVLIRSRNVQIQYQAIFAIWLLTFDTCTAVKIVTYGVIQSLLDVAKGAIKEKIIRMCISTWRNLLSKCPAVPVMVGAKVLEYLESIAEGKIADEEVSLDVSVLKDEL 150
281 3.000e-17UniRef50_A0A1D1YF60 Adenomatous polyposis coli protein (Fragment) n=2 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1D1YF60_9ARAE  ali  12  85.............................................................................NRIAASSAAVPDDAGGSKARSAVPPDVKACTSGDLRAGDGYVGLFVRML--GLDNDPLDREQAIVTLWKYSQGGKHCVDAIMKFPGCVILVVNLLKSDSDD--VREAAAGLLRNITSVSLYIEPVAGSGVIEEIASLLCLTDLT--PEVKEHSLCTLWNLSTDKKLRTKIARSDILQILVKCLND-EEIKVIEAAGGVLENLALSHCNHNIMVECGVIQKLAKFLKSNAEEHEVI.......... 312
282 4.000e-17UniRef50_UPI0007EDA2D2 LOW QUALITY PROTEIN: kinesin-associated protein 3 n=1 Tax=Malus domestica TaxID=3750 RepID=UPI0007EDA2D2  ali  14  102...................................................................................................................DGYVGLFIRML--GLXNDSLDREQAIVALWKYSLGGKQYVDAIMQFPGCINLIVNLLRSESSS--ACEAAAGLLRSISLVNLYRDVLXQSGATEEITDLLNRP--SLNPEVKEQAICTLWNLSVDEKFREKIANSDVLPLLVKSV-DDEDIKVKEAAGGVLANLALSHFSHSIMVEAGVIPKLVRFYFHFLSXDDIL.......... 291
283 6.000e-17UniRef50_G4VGB0 Putative vacuolar ATP synthase subunit h n=3 Tax=Schistosoma TaxID=6181 RepID=G4VGB0_SCHMA  ali  15  1.......................................................................................................................MYQASRIIAKFACWSSQLMEENDLIYYLNWLREQLTIT--------------------NNQYDQTVARNLQMMLRIREYRTQFAKVGGIETIGDVLQEKLTSRQL--QYQLIFCLWCMSFDSIHVTDICKSALLATVADIFLEADREKITRISLAFFRSILEKLPCGLRLVQYKVLKELELLNQKDFSDPELTEDISFLN... 187
284 7.000e-17UniRef50_UPI00053C3BB1 uncharacterized protein LOC104822169 isoform X3 n=1 Tax=Tarenaya hassleriana TaxID=28532 RepID=UPI00053C3BB1  ali  14  109...................................................................................................................DGYVALFVRML--GLDNDPLDREQAAQALWKYSLGGKKCVDAIMQFHGCLNLTVNLLKSESSATC--EAAAGLLRELSSVNLYRESVAESGALEEIAALLSRP--SLSAEIKEQSLCTLWNLSVDVKLRDKIADFDILRLIVSFLED-DDIKVRESAGGVLANLALSCSNHKTMVEAGVIPKLANLLK................... 289
285 8.000e-17UniRef50_A0A2J6L2R1 Uncharacterized protein n=1 Tax=Lactuca sativa TaxID=4236 RepID=A0A2J6L2R1_LACSA  ali  64  3.....................................................................................................................................................SKKKITASDDVLKGLEEWLC---IEPSHPTRRIPASVNCLATLLKEPVVRSSFVQADGVKLLVPLISPASTQQSIRLLYETCLCVWLLSYYEPTIEYLATSRALPRLLELVKGSTKEKVVRLIVLTFKNLL.......................................... 130
286 1.000e-16UniRef50_A0A199VSS6 V-type proton ATPase subunit H (Fragment) n=4 Tax=Mesangiospermae TaxID=1437183 RepID=A0A199VSS6_ANACO  ali  72  1.........VLKRDIPWEIYMSSKLISGTGLQLLRRYDKRTESQKASLLDDDGPAYVRLFVSILRDISKEEAVEYVLALIDQMLTANPKRARLFHDKSLLGDDIYEPF...................................................................................................................................................................................................................... 99
287 1.000e-16UniRef50_A0A1D2VIR1 ARM repeat-containing protein n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VIR1_9ASCO  ali  19  13.YLDDICQSIKQRPVYWERLIRANIVSEEDATRMKILEKQSTDEKISAVLSDLDLYSTTILNLLSVSNRPDILKYLLILILELITKVPNLNNLLDLNKIDNNLPFDPFLKNLKNLSTFNNDKDSIQLLSVYNLSNNDSLISLFDHLNSLVQSSNSNYRTIAVQCISELLSIKSYRSVFWSKNSHYIPSLISLLTPYSKKKLFSSSLSNPTPQSSSSTLIFRNDLQTQYKALLSLWLLSFNPSYAVDLNNKNLLKTLITISNDSIKEKIVRLSISILLNFINTTNDLNNNYTNKSLPIITNLNQRKWSDEELIDD........ 414
288 1.000e-16UniRef50_A0A1D6K8M4 Protein ARABIDILLO 1 n=6 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1D6K8M4_MAIZE  ali  15  98...........................................ARSEAVMQNGGIRMLL---DLARCSRESAQSEAAKAIANLSVNTK------VAKAVADEGGITILINLAKSMNRLVAEEAAGGLWNLSVGEDHKAARGLANLAAHGDNNDNNAAVGQEAGALEALVQL--TSSQNEGVRQEAAGALWNLSFDDRNREAIAAVGGVEALVALVQQ-CLNASEGLQERAAGALWGLSVSEANSIAIGQGGGVAPLLTLAR-SEVEDVHETAAGALWNLAFYSGNALRIVEEGGVPVLVKICSS.................. 345
289 1.000e-16UniRef50_A0A1J4JGG5 Uncharacterized protein n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4JGG5_9EUKA  ali  17  37..........................SKHTTEFIELFKVHPEQQKDNF-TSEKSHHPRAFAKLLEKRNVTETL-NLLFAFIDRLFDIDFTSTIAALVPQADGLISQCTNILLGKFDE------RFKCPFLIRTNLLLLGALLSHPDVKISKNNSGAAATYVDKVTKLL-------GGDLVEASLALEGLKRFLSLEKHRQMFVDANGVKLLINLLTAAGKLSQNDTTYHILFCIWALTYSPDGAGQLSTDEFVSILGRMLSKSETEIIIRLMVAIVKQLNSNTVFIESAYDNDILRLLRMYQTKHYVDPELQPNIVAAADEL 321
290 1.000e-16UniRef50_A0A0L0CVE5 Vacuolar ATP synthase subunit H n=1 Tax=Plasmodium falciparum RAJ116 TaxID=580058 RepID=A0A0L0CVE5_PLAFA  ali  20  1.........................................................................................................................................................................................MDIYINILKIDNFRKDIYELEQFTSIIK-KNLELSNNNANKQYKSVFCVWLLTFKDYFIKQLYKNNIIAIVINLFKKCRVEKILRVSLNIIKNIMHIDDCFEIIVDNNIIQTMTVLQYDKWRDNDIYDTIVQLLNKL 136
291 2.000e-16UniRef50_A0A2I0IVF2 Uncharacterized protein n=3 Tax=rosids TaxID=71275 RepID=A0A2I0IVF2_PUNGR  ali  13  83..............................................................................................SQKQSESPDIEEENSTSSSSADGYVALFVRML--GLDQDPLDREQAVVALWKYSLGGKKYIDSIMQFHGCINLIVNLLKSKSGSTC--EAAAGLLRSISSVNIYREKVADAGAIEEITALLARPSLPSEV--KEQSLCTLWNLSVDEKFRLQIASPDVLPIIIDLL-DDEDLKVKEAAGGVMSTLALSQSNHNTMVELGAILKLV....................... 280
292 2.000e-16UniRef50_V5B1U1 ATP synthase n=1 Tax=Trypanosoma cruzi Dm28c TaxID=1416333 RepID=V5B1U1_TRYCR  ali  24  107..........................................................................................................................SFLCLVLIHREEYGITDPALFLAATSLRYGPIEKNEEALQRFFAHVTDVLSAETLQVSAVAFAVQGCSIVARTKALRRWFFEEQIVQFLPRLLFDIVANDSVQLIYETLLVSWLLSYEYRGVVELQKHKMIPHVHRVLHRMLKEKCVRVALMVLWNMVEAPNFIAEMVGVGMLKTLAQLSRRKFGDEDISVVINELKK.. 339
293 2.000e-16UniRef50_A0A2T7IUR2 Vacuolar ATP synthase subunit H n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IUR2_THEOR  ali  13  22..............PDYEEWLNTGALDVESVELLKLYASLNTLEKVEMIRKN-ELVSKIFLNATYATGPGLLRSYSLQHLADVCRGMFWAVTGEVSAVGSGS-PCRPGFRYGGRSTSSRAWSAQY-----------------------WSPGRDKRIVEKTLYLLTGFVAHGRGCFSDDQVDSVVKLLLK--LSIDPYAKLHALSNNPAVLALLRAGLGRESPPNTQYKCVFCV------------LLTNELVRLLCELLAAT---KVIRICLLVFGNLLGNAQCLEVMVETNVLQVLTLLAYDKWHDDELYDNIHRLHAQL 316
294 2.000e-16UniRef50_Q4QC61 V-type proton ATPase subunit H n=15 Tax=Trypanosomatidae TaxID=5654 RepID=Q4QC61_LEIMA  ali  19  17.....................QLQLLDDNTIRLLEQLFRLNGELVTSLVDGREESLAVALFRLCAGTHAENILGYSLRFLADLVYADREIGVQLGRGDLVKEFGGHPASLLLQIASSH-------------SESLGIANPAIYLAATALRYGEYEGNETAFKDFFALARHTFAPETLQVTDIAFTVQACVQLARRKDFRPLLFEANLVSCIPHLLTDIVSSDSIQVIYETLLLSWLLSFEYEGLVLLVRERMIPQLHRVLQRVQKEKCVRVSLMTLLNMVEAPSLVAEMVSVGMIKTLSQVSRRKFGDEDINVMVDQLNAAL 352
295 2.000e-16UniRef50_U6MUT0 Vacuolar ATP synthase subunit h, putative n=1 Tax=Eimeria necatrix TaxID=51315 RepID=U6MUT0_9EIME  ali  20  148.........................LSQEQSEQVRLLGHLVRADANN---SQNPQVVAALVAVLRLEADIQPVQYALTILYEVVRENSSRYEAMC-GALENSNVFEDFLQLLQRPDSYTGDRAAFMLSGFMCRARS-----------------VAFSEEQVTYFVQQLIAKKFPVSESGRLD-----ALVNILKIDRWRPLVWETPG--LPEMLLKALSLSQPAGVVYKAVFCVWLLSFHEGFPLAITECGILKAACDVLKESRVEKVAR.................................................... 366
296 2.000e-16UniRef50_A0A1U8EJE7 uncharacterized protein LOC107847539 n=7 Tax=Pentapetalae TaxID=1437201 RepID=A0A1U8EJE7_CAPAN  ali  11  85................................................................................................................NTADGYIALFVRML--GLDHDPLDQEQAVIALWKYSLGGKQCLDMIMQFRGSVNLTVNLLKSESD--AACEAAAGLLRMISSVNMYRDLVAVSGAIEEINGILR--RSSLSPNVKEQSLSMLWNLSVDEKLRNKIANSDLVPLLIKFLED-EEVRVKEAAGGVLANLALTASNHNNMIEAGVIPKL........................ 263
297 4.000e-16UniRef50_A0A0R0JBT4 Uncharacterized protein n=6 Tax=fabids TaxID=91835 RepID=A0A0R0JBT4_SOYBN  ali  16  79...................................................................................................................DGYVALFVRML--GIDRDPLDREQAIVALWKYSLGGKKCIDTLMQFPGCINLVVNLLRSES--NSACEAAAGLLRSLSSVNLYRNSVADSGAIEELNRLLRQSSLASEV--KEQSLSTLWNLSVDEKLCIKISKTEILPLAIRYL-DDEDIKVKEASGGILANLASSRVNHNIMVEAGVIPKLAKFLTSNLE............... 263
298 5.000e-16UniRef50_A0A0K9PUM0 Uncharacterized protein n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9PUM0_ZOSMR  ali  10  85......................................................................................................DPPLPNLGKSSLEDSYIGVF--IQMLGLYNDPLDREQAVTTLWKYALGGKQCVDNIMKFSGCINLIVNLLKSDSPFSC--EAAAGLLQSISSVDIYRKTVEQSGAIEEITAVL--LQTTLTLEIIERCVFTLNNLSVDEELGVKIAKSDLLHMLIKLL-DREEVKVKESAGGVLANLALNRCNHNAMVEAGVIPMLAKLLK................... 278
299 7.000e-16UniRef50_B0EFX1 V-type proton ATPase subunit H n=9 Tax=Entamoeba TaxID=5758 RepID=B0EFX1_ENTDS  ali  17  72...........................DEKRTVLSLYLRQAPEERARIMNEDLKSLIEIFYILLNQSEHPGVIENTTLLFDDFINADINRIPLISEIDIQTIELCTRLIRQMKTESLTILKASIEVFTILTTYCGTFNDFVSIMGDYFQVIREIYSIANPTRSTYQPLHLFNWS--------------LYILLNKQPYRKVFSKEIPLNFLLEVHDKIVATQDNELLYSLFHIVWLQSFDEKLVEHDFPENFIQIFANVLLKIKIEKLIRIVLLIIHNLLNVDWYVRLLVQHEFNLIIPMLLSRTFSDSDIVEMLQEINEI. 353
300 9.000e-16UniRef50_E7NNW8 Vma13p n=1 Tax=Saccharomyces cerevisiae (strain FostersO) TaxID=764101 RepID=E7NNW8_YEASO  ali  15  12.HFNEIRSIIRSRSVAWDALARSEELSEIDASTAKALESSSSNNAHSGFKVNGKTLIPLI-HLLSTSDNEDCKKSVQNLIAELLSSDKYGDDT-VKFFQEDPKQLEQLFDVSLKGDFQTVLISGFNVVSLLVQNGLHNVKLVEKLLKNNNLINILQNIEQMDTCY------------------VCIRLLQELAVIPEYRDVIWLHEKKFMPTRIVATNSNHLGIQLQYYSLLLIWLLTFNPVFANELVQKYLFLDLLKLVKITIKEKVSRLCISIILQCC.......................................... 298
301 1.000e-15UniRef50_A0A1S3H602 V-type proton ATPase subunit H-like n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3H602_LINUN  ali  23  1..............................................................................................................................................................................................MMLRIDEYRHAFVNVDGISMIIQVL---PGKVGFQIQYQLTFCLWCMTFNPELAEKMNKYNVIPILADILGESVKEKVTRIILATFRTIKLERRARSQSVKTSSDKISQVLLDVNYEEE............. 117
302 2.000e-15UniRef50_A0A2C5XI53 Uncharacterized protein n=1 Tax=Ophiocordyceps australis TaxID=1399860 RepID=A0A2C5XI53_9HYPO  ali  19  8...................................................................................................................................SSTTQHALPMLLTYLSTLAKSSDAGLQDIAVQEFSALLFGRSSRDQFWRQRSETVAPLIGILQTAESSANLWRGNGTVRTMGFQGALGAGVGLQLLYHVLLVMWQMSFEAEEIELNDEYNIVLLYTHLLRLSPKEKTTRLILSTLYNLLDKKSLLPTAVLARLPSLLDNIGSRHLTDPDLLEDMESLKTLL 209
303 2.000e-15UniRef50_G7YWL8 Splicing factor 3B subunit 3 (Fragment) n=1 Tax=Clonorchis sinensis TaxID=79923 RepID=G7YWL8_CLOSI  ali  21  1......................GQIINTEQFNFITRLDNAPPEARTRVINEDPQLTARVFIFILNRISKEQTLQYILTLLDDILKEDKLRVETFCSCFQDSEAIWPHFFSFFQRGDPFCMYQASRIVAKFACWSRQLMEEKELMYYLNWLRDQLLI--------------------PKNEYDQTVARNLQMMLRIPKYRARYAEVGG................................................................................................................... 179
304 2.000e-15UniRef50_A0A182KK11 Uncharacterized protein n=2 Tax=Arthropoda TaxID=6656 RepID=A0A182KK11_9DIPT  ali  16  143.......................KLLNDEDQVVVSQVHQLSKKEASRHAIMNSPQMVAALVRALSNSNDLETTKGAVGTLHNLSHHRQGLLAIF------KSGGIPALVLSVCSSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLETLLSGLVTVL--GSSDVNVVTCAAGILSNLCNNQRNKVTVCQVGGVEALVGTIINAGDRE--EITEPAVCALRHLTSSESAQNVVRNGYGLPVIVKLLNPPSRWPLIKAVIGLIRNLALCPANAAPLREHGAIHLLVRLLFKAFQD.............. 426
305 2.000e-15UniRef50_K4C036 Uncharacterized protein n=73 Tax=Magnoliophyta TaxID=3398 RepID=K4C036_SOLLC  ali  14  57.............................................................................................LCSSDGMGEVYVNPHQDFDMINDASSNVALFVRMLGLDHDLLDREQAVIALSKYSLGGKQCVDTILQFRGSVNLTVNLLRSES--NAACEAAAGLLRMISSVDIYRDLVADSGAVEEIYAVLRRSSLSSDV--MEQGLCTLWNLSVDEKHRNKIANSDFLPLLIKFL-EYEEVQVKEAAGGILANLALTASNHNNMIEAGVIPKLAMLLK................... 261
306 2.000e-15UniRef50_D8LWD3 Uncharacterized protein n=3 Tax=Blastocystis TaxID=12967 RepID=D8LWD3_BLAHO  ali  17  42...........TTSFNWSKFTETSLLSEDQV---KAIEKLSSTEATTDAKSIVVAVDALILILKGETNKNTIRQTLLLLEKIFNYDNKYSASILSVSNLSACTILNEKMHELGSMQTPIVLLSGFLCSVSLSEEPVEPVESAESAEASNPQATLRSTFLSFV-LSSFSAVSQKSMDEMDSLLVISGLAVGSASPEPSGRGAVESAVDVSPDDRLLFDLCVTNAVQFVYELLLCIWMISFLPDTLPLFGKKNVVERLAESLNTYNSEKIIRVIVSIVQNLIKLPELVEDLIACGAIRKLNLLNQRMFKDHDISETLKVVLDVL 377
307 3.000e-15UniRef50_A0A098VSD5 ATPase V1 complex subunit H n=1 Tax=Mitosporidium daphniae TaxID=1485682 RepID=A0A098VSD5_9MICR  ali  22  49............................................................................................................................................................................LSRNQEDVSMGAVQVLNQMMEKNRKTRAILARQDPPIILQRLAQLMCKHPSPQLLYEILLCFWLLTFQPSTAAMFRDWGIIPLIKDNCSTSSTEKIIRMGLAIFRNLLRFAETSSLLIGCKVLEWTRHLLLKRFSDEEMLADIQFLQTEL 202
308 4.000e-15UniRef50_A0A1V2LHX6 V-type proton ATPase subunit H n=3 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A1V2LHX6_PICKU  ali  17  230.......ARLRNLPLSWTS-IKSSAIDSNQLSLLRELSQFPYAERGAYINERQDQFAATCLHVLTALTNQGETETQLFNKSDL-------VNFLLSIIYDGASYNNQFILKL-----YTSHKDYTPFVSLLNLELDDISKILSLYTIVSFLTLVGETKGNVKIVKSVYLELTKYLKASTQLQYIGLQLLKELLNVKSYRGYFNASS-----ELLDILEDKSIELQMKYLTIYALWVISFDSAKINLIIKENLIPVLFNLANDAIKEKVTRLSISILVNIITLNPSLATLHLANGLTITKNLIDRKWSDE............. 522
309 4.000e-15UniRef50_S8D774 Uncharacterized protein n=1 Tax=Genlisea aurea TaxID=192259 RepID=S8D774_9LAMI  ali  11  39............................................................................LPALTRAFSDGGGQDEIIVAKELDSNSLEDPQTSWKNSSDMNDGYLALFIMLGIDNELPDREQAVVALWKYSLGGKQYVDSIMRYSGALNLVVNILKSDSDS--ACEASAGLLRTVSSINIYRDAVAASGAIEEMTYLLARPELSSGV--KEQALCTLWNLAVDEKLSAVVSQSEIFPLVVEFLDDEDM-KVKEAAAGVLANLALSPSNHKIIVEAGVIPKMASFLTKN................. 263
310 5.000e-15UniRef50_A0A2T7HZR7 Vacuolar ATP synthase subunit H n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7HZR7_THEOR  ali  21  85.........................................................................................................................................................................................LHALSNVLQLKKNHALV---QNPAVLALLRAGLGRESPPNTQYKCVFCVWLVSRSEE-------------YLQVLLVGHRQ-VIRICLLVFGNLLGNAQCLEVMVETNVLQTLTLLAYDKWHDDELYDNIHRLHAQL 204
311 5.000e-15UniRef50_A0A2T7DLH1 Uncharacterized protein n=2 Tax=Panicum hallii TaxID=206008 RepID=A0A2T7DLH1_9POAL  ali  13  121................................................................................................................................GLDNDACDREHAVCTLHQYSLGGRKSIDEIMQFPGCIVLIISLLKSES--TRAREAAAGLLCNITSVQIYRKMAIESGAMEEIISLLCK--STITPEMMEQCLCTIWNFSIDESWRYKILRSDVLTKIVRYL-DEEDIKVKEAAGGIISNLALSPSNHGALVEAGVIPKLVHLLQTKEDD.............. 295
312 8.000e-15UniRef50_UPI000900AC74 uncharacterized protein LOC109156869 isoform X1 n=3 Tax=lamiids TaxID=91888 RepID=UPI000900AC74  ali  13  63...................................................................................................ASPDVDTTGDSMSTIGDGYVALFVRML--GLDNDPRDRREAIDTLWKYSLGGKKCVDTIMQFPGSVNLTVNLLKSDSDS--AREAAAGLLRVVSSVNVYRDSVAESGAIEEITG-LLRRSSSLSSNVKEQSLCTLWNLSVDEKHRIKMANFDLLHVLMKLLED-DEVRVIEAAGGVLANLTLSKFNHKIMIEVGVIPKLARLLK................... 260
313 8.000e-15UniRef50_A0A183I768 Uncharacterized protein n=2 Tax=Spiruromorpha TaxID=2072716 RepID=A0A183I768_9BILA  ali  26  15...................................................................................................................................................................................................................FSILSVLSGKTNFQLQYQLIFSLWCLTFNPTIAEKFPHTGAIQILGDILSESTKEKVIRIILGTFRNILEKRETALQMVQCKTLKTIELMDSKKFDDAELNDDVEFLNDKL 147
314 1.000e-14UniRef50_A0A1J5WYJ5 V-type ATPase V1 subunit H n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5WYJ5_9MICR  ali  15  10.........................VTLKHAHFIELYERKKMDEREHEEKEAQRSTETEFVKLRSDSQWK--KKEGFVFLTEIL---PEQIDCFVSYLAANPGSMELLLQHLGHPSLFISQAASRVLSLVLFHVYGEREWPLLKRYLEWSF----------------------QSFLDNALRKHTVLCLIYLARNKKVSDSVLLHT---DIVRRIVDGSRKADVGTKYYFVYLLWVFSFNPLAAAKEEKARIVSFSLQLFREVEKEKIARLCVFIFSNLILHGGARTALVGTRVGPFVEVVRGKKYGDEELSEEVCFLQKRL 281
315 1.000e-14UniRef50_A0A287FPQ7 Uncharacterized protein n=2 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287FPQ7_HORVV  ali  17  78......................................................................................................................VTLARSCKLEGVLEQAARALANLAAHGDNNNNNAAVGQEAGALEALVQLTC------SQNEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVS-LAQQCLNASEGLQERAAGALWGLSVSESNSIAIGQEGGVAPLLTMAQ-SEVEDVHETAAGALWNLAFYSSNAQRIVEEGGVPILVHLCSS.................. 255
316 2.000e-14UniRef50_M1ASA2 Uncharacterized protein n=1 Tax=Solanum tuberosum TaxID=4113 RepID=M1ASA2_SOLTU  ali  71  4ENAELTTEEVLRRDIPWETYMTTKLITGTGLQLLRRYDKKAESYKAQLLDDDGPGYVRVFVTILRDIFKEETVEYVLALIDEMLTGNPKRARLFHDESLADEDTYEPFLRQ................................................................................................................................................................................................................... 138
317 2.000e-14UniRef50_A0A059LFW7 Uncharacterized protein (Fragment) n=1 Tax=Helicosporidium sp. ATCC 50920 TaxID=1291522 RepID=A0A059LFW7_9CHLO  ali  45  18....STASILRTRDIPWDIYMTARLISDKDLQLLRRYDNKNPGTQARLLAENGAACFATFLTVLKNVTKDETVQYALALLDDALSADPRR........................................................................................................................................................................................................................................ 103
318 4.000e-14UniRef50_A0A0A1MVL2 Uncharacterized protein n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0A1MVL2_9FUNG  ali  27  5........................................................................................................................................................................................................................................................KCKIIPVLLDYAKSTPKEKVIRVIIATFKNLIEKAPNMSAMLVAKLLPFAEHLATRKWSDQEIVDDIEYITTEL 80
319 4.000e-14UniRef50_A0A0L0NYA2 V-type h+-transporting atpase 54 kDa subunit n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0L0NYA2_CANAR  ali  21  4......................................................................................................................................KSLSFYNLTILLVAGSREGINADKEVLITLFNLVCSKHYIGNADQNLQFIGVQLLQELVIVKRYRDIFQEHNSINTLIEVLARKPNSVNFQLLYYVFMTVWILSFSSTLNKTMVHNFLIGNLLTVSKESIKLKVVRVAISTLKNFLEQYSVVKLILFYDGLNIVRTIQTRKFSDDELSSDLAYLNDTL 211
320 4.000e-14UniRef50_A0A1S3Z1H8 protein ARABIDILLO 1-like n=2 Tax=Nicotiana TaxID=4085 RepID=A0A1S3Z1H8_TOBAC  ali  18  76...................................................................................................................................................................................RVRQEAAGALWNLSFDDRNREAIAAAGGVEALVA-LAHSCANASPGLQERAAGALWGLSVSEANSIAIGREGGVAPLIALAR-SDAEDVHETAAGALWNLAFNPGNAFRIVEEGGVPALVHLCSS.................. 198
321 5.000e-14UniRef50_A0A099NVA9 Uncharacterized protein n=2 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099NVA9_PICKU  ali  17  22.......ARLRNLPLSWTS-IKSSAIDSNQLSLLRELSQFPYAERGAYINERQDQFAATCLHVLTALTNQGETETQLFNKSDL-------VNFLLSIIYDGASYNNQFILKL-----YTSHKDYTPFVSLLNLELDDISKILSLYTIVSFLTLVGETKGNVKIVKSVYLELTKYLKASTQLQYIGLQLLKELLNVKSYRGYFNASS-----ELLDILEDKSIELQMKYLTIYALWVISFDSAKINLIIKENLIPVLFNLANDAIKEKVTRLSISILVNIITLNPSLATLHLANGLTITKNLIDRKWSDE............. 314
322 5.000e-14UniRef50_B7FQD1 Predicted protein n=1 Tax=Phaeodactylum tricornutum (strain CCAP 1055/1) TaxID=556484 RepID=B7FQD1_PHATC  ali  24  163......................................................................................................DDWRPLLRILTKSDSYVHRGSGFCLACILLEGCTLQT----------NGHLFSPISSILESFVSWIVSRLQS--SSTQSLSMVTSSLTVIILSKEVRHLFGKAGGVGYLSRRLRVHQKSASVQHQYELSYCLWIMSYDCDTSVSMRSHGSVQALVDMVAAAPREKVVRCALATLRNLATCATYLIDMIGCGLPKLIDLMMNCPIADFEISEDLDILHKLL 398
323 6.000e-14UniRef50_A0A1I8FPD4 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8FPD4_9PLAT  ali  25  1..............................................................MLAKISKDQTVQYVLTLLDDLLQEEKTRVDVFKRYEQRKENVWSPFFSLLHRQDGFIVNQASRIVAKFACWGSRLMEQTDLVHYLNWLNEQLRI--------------------PSNEYLQTVARCFKCLLRREPSQEVFCDIDGIGTLANVLS---GKVNYQIQYQLVFCL-----------------------TSCANPQKEKVNRIVCAFFRHLLEKA....................................... 179
324 8.000e-14UniRef50_UPI000C1D32B7 protein ARABIDILLO 1 isoform X1 n=6 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1D32B7  ali  17  632...........................................................................................................................................................................QLIRSPHDGVRQEAAGALWNLSFDDRNREAIAGAGGVEALVALARS-CSNASHGLQERAAGALWGLSVSEVNSIAIGREGGVAPLIALAR-SDAEDVHETAAGALWNLAFNPGNALRIVEEGGVPTLVHLCSS.................. 762
325 9.000e-14UniRef50_UPI00057ACD35 U-box domain-containing protein 12 isoform X3 n=1 Tax=Elaeis guineensis var. tenera TaxID=51953 RepID=UPI00057ACD35  ali  13  144.........................ISEEVKEQIELVHAQFQRAKGKIDPPDLQLLKDLNWALCEKHCDPIVLKLQLTTINDMKKESVALHEMVISSGGEPEECLEEMSSLLRK------LKDCVIVENPTSDTFENKTSSVKHRSPIIPDDFRCPISLELMTDPVIVSTGQKLKNGNQDEQRAAAGELRLLARNADNRVCIAEAGAIPFLVELL----SSPDPRTQEHAVTALLNLSINDSNKGHIVNARAIPRIVGVLQNGSME-TRENAAATLFSLSVVDENKVTIGAAGAIPALINLL.................... 415
326 9.000e-14UniRef50_A0A0S4JQ71 V-type proton ATPase subunit H n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4JQ71_BODSA  ali  17  17.............................DEATIKTLDQLNDDLVDSLVTGREAPIALALYKVVQASSAG-VRSFVLRFLANLCQACRTFAKEFTVEDAVEKFGSEPAAVFLDIAVQNAENVAVTSAALHLSANVIRSA-----------SGSIARYESTIQRFFGHVQTVLNVAELNANTIEYPIHACSQLVRRKAIRPYFLNSGIVEHIPRILTEACATDNIQLSYETLLICWLLSFEFPCIVALHKVKIIPTIHRVLQRLQKEKCIRVALLTLRNFAEAPNFFADMIGVGLVKTLWQLARRKFGDDDIAKEIEEMTTLL 338
327 9.000e-14UniRef50_A0A1R2CD94 V-type proton ATPase subunit H n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CD94_9CILI  ali  17  34.................HEYEQANIIPLGSADTYSNFIKMSLENQRKFLIEGSDTVIRTLFSVVESSSDDLLKRSILCTLDGIAYDTSPEPFISIMTSRLPVNILQILTRYAKQEDSIVMEAAGHLL---------------SLLLSELIIKPSAQIQDAQAQALSLIDFLLNQTVDVKSSADSMLYCMIPLFKVDQIRSFFLTTGGL-RLVIIPILASKSGIVQSVYIALFALWQITFNEESVEYFLRYELISLIVKEIKKTEKEKVLRVGLGALKNLCEMSQAIEIMIEEKLLDAIDTLSRKVLKDEDVVQLIKDLGDVL 328
328 1.000e-13UniRef50_A0A0L7LMB5 Catenin n=2 Tax=Neoptera TaxID=33340 RepID=A0A0L7LMB5_9NEOP  ali  12  111.......................KLLNDEDQVVVSQVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLETTKGAVGTLHNLSHHRQGLLAIF------KSGGIPALVKLLSSPVEAVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNVKFLAIVTDCLQILAYGNQESKLIILASQGLVRIMRSYDYEKLLWKVEGLEALLQSLVQVLASTDVNIVTCAAGILSNLTCNNQRNKVI---------VKLLQPPSRWPLVKAVVGLVRNLALSPANFAPLREHGAVHNLVRLLMRAFND.............. 393
329 1.000e-13UniRef50_A0A0Q3G1T1 Uncharacterized protein n=4 Tax=Brachypodium distachyon TaxID=15368 RepID=A0A0Q3G1T1_BRADI  ali  11  85..............................................................................................................................MLGLDSDPHDREHAVCTLRHYSLGGQKCVDEIMQFPGCISLITSLLKSESAR--ACEAAAGLLHNVTSVKLYRDVAIESGTMEEIFSCLRK--STMTPEMKEQCLCTIWNFSTDENLRYKIFRSDMLILIVRFLEDEDF-KVKEAAAGIISNLCLSHSYHGVLVEAGVIPKLVHLLQTKGDD.............. 261
330 1.000e-13UniRef50_G7IA05 Armadillo/beta-catenin-like repeat protein, putative n=30 Tax=Pentapetalae TaxID=1437201 RepID=G7IA05_MEDTR  ali  12  91...................................................................................................................DSYVALFVRML--GLDHDPLDREQAIITLWQYSLGGKKYIDNIMQFPGCINLVVNLLRAESSS--ACEAAAGLLQSLSSIDQYRNSVADSGAIEEINRLLTQSSLASEVKV--QSLNMLWNLSVDEKLRVKIAKSDLLLLAMKYLDDEDM-KVKEAAGGILANLALSHVNHDMMVEAGVIPKL........................ 266
331 2.000e-13UniRef50_I1HFN0 Uncharacterized protein n=26 Tax=Poaceae TaxID=4479 RepID=I1HFN0_BRADI  ali  11  85..............................................................................................................................MLGLDSDPHDREHAVCTLRHYSLGGQKCVDEIMQFPGCISLITSLLKSESAR--ACEAAAGLLHNVTSVKLYRDVAIESGTMEEIFSCLRK--STMTPEMKEQCLCTIWNFSTDENLRYKIFRSDMLILIVRFLEDEDF-KVKEAAAGIISNLCLSHSYHGVLVEAGVIPKLVHLLQTKGDD.............. 261
332 2.000e-13UniRef50_A0A1S3Y637 uncharacterized protein LOC107772659 n=1 Tax=Nicotiana tabacum TaxID=4097 RepID=A0A1S3Y637_TOBAC  ali  12  69................................................................................................YVNPHQDVDMLKDSSSNTGDGYIALFVRML--GLDYDPLDREQTVIALWKYSLGGKQCVDMLMQFRGSVNLAVNLLRSESD--AACEAAAGLLRMISSVNMYRELVADSGAIEEINGLLR--RSSLSPNVKEPSLCSLWNLSVDEKLRNKIANSDLLPL-LLKFLEDEEVKVKEAATRVLANLALTVSNHKNMVEAGVIPKLAMLLK................... 268
333 3.000e-13UniRef50_A0A199VRP3 Putative V-type proton ATPase subunit H n=6 Tax=Mesangiospermae TaxID=1437183 RepID=A0A199VRP3_ANACO  ali  80  1......................................................................................................................................................................................................................................................MATTRVLPRLVEVVKGSTKEKVVRVIVLTFRNLLSKGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLEALNQLEEGL 76
334 3.000e-13UniRef50_A0A2U1J9W5 Uncharacterized protein n=1 Tax=Smittium angustum TaxID=133377 RepID=A0A2U1J9W5_9FUNG  ali  12  39.YFDELTNNIRKKPMPWEGFYNAGLITEEEMQTFRALQQAKRNYK--TYPPESANCTKLILVLIQKLHRIEVIQHMLVVLDDILESQEEAVQCFEYSTYQDISVFSLLEKY................................................................................................................................................................................................................... 147
335 3.000e-13UniRef50_A0A2C5Y581 Uncharacterized protein n=1 Tax=Ophiocordyceps australis TaxID=1399860 RepID=A0A2C5Y581_9HYPO  ali  20  8.YLASLQSNIRQRPIPWDGAVRAGTLSEDQLAKIRAVDKKKTEERREIVEGDADGYRLLFVGGPGKPSHANIIQYILVLLAD................................................................................................................................................................................................................................................ 96
336 4.000e-13UniRef50_A0A0E0BDU3 Uncharacterized protein n=1 Tax=Oryza glumipatula TaxID=40148 RepID=A0A0E0BDU3_9ORYZ  ali  17  500......................................................................................................................VMLARSCKLEGVLEQAARALANLAAHGDNNNNNAAVGQEAGALEALVQL------TSSQNEGVRQEAAGALWNLSFDDRNREGIAAAGGVEALVS-LAQECLNASEGLQERAAGALWGLSVSEANSMAIGQEGGVAPLLTLAQ-SDVEDVHETAAGALWNLAFYSGNALRIVEEGGVPILVRLCSS.................. 677
337 4.000e-13UniRef50_A0A1X7YE81 Uncharacterized protein n=7 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1X7YE81_MAIZE  ali  15  516............................................................................................................IKALERAAGALANLAADDKCSLEVAKAGGVHALVTLARSCKLDGALEQEAGALEALVQL------TGSQNEGVRQEAAGALWNLSFDDRNREAIAAVGGVEALVALVQQ-CLNASEGLQERAAGALWGLSVSEANSIAIGQGGGVAPLLTLAR-SEVEDVHETAAGALWNLAFYSGNALRIVEEGGVPVLVKICSS.................. 703
338 4.000e-13UniRef50_UPI000B93734C uncharacterized protein LOC111015638 n=1 Tax=Momordica charantia TaxID=3673 RepID=UPI000B93734C  ali  12  107..............................................................................................................................MLGLDHDPLDREQAVIALWKYSLGGKKHIDAIMKFPGCINLTVNLLQSESIATC--EAAAGLLRSISLVNLYRDSVAESGAIEEITGLLSRP--SLAPEVKEQSICVLWNLSVDEKLRLKIADTDILLLLSKNLDDEDM-KVKEAAGGVLANLALSPCNHGVIVESGLIPKL........................ 273
339 4.000e-13UniRef50_G4VGB1 Putative vacuolar ATP synthase subunit h n=4 Tax=Schistosoma TaxID=6181 RepID=G4VGB1_SCHMA  ali  33  23.FLQATAAEVRSTRVNWQSYLQGQIINDEQYSFITRLDNAPTAERNHVIRADENMTARVFIFILNKISKEQTLRYILTLIDDMLQVC........................................................................................................................................................................................................................................... 109
340 7.000e-13UniRef50_UPI000711D0E8 vacuolar ATP synthase subunit n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI000711D0E8  ali  15  1..................................................MNRITCINALATVLMNDTHKVVVAEGLTILDSILHFDTKTAEKLIQ-KEAMDKLCIIFVNLLN----IINAINSPEVEVTEGYEKKESLRSLIIREAAFVSGISTASEELRAAVVDLFMETFKDVKQETVDEDECLLMMDALSLHLRYKPNRVEHKGVLAILSKVFNLCVTNATQFIYLLLLNIWMFSFVTEARATFDKYGLIAEITQSLNTYSSEKIIRVIVSIVENLLGDAALVEELLSGGAIRKLNLLNQRIFKDSDITETLRVVLEKL 271
341 2.000e-12UniRef50_A0A0C7CEB4 Uncharacterized protein n=2 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7CEB4_9FUNG  ali  24  39.YLDDTMNKIRQEPIPWEEYTNVGLISENEMAMIKHVENKSVEELEPIMIEHGRYYALLYLELMQKLARVDTLQKVLV.................................................................................................................................................................................................................................................... 115
342 2.000e-12UniRef50_A0A2T7IW66 Vacuolar ATP synthase subunit H n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IW66_THEOR  ali  12  22..............PDYEEWLNTGALDVESVELLKLYASLNTLEKVEMIRKN-ELISKIFLNATYATGPGLLRSYSLQHLADVCRGMSSRTQASGTGAVARPSTGRPMRRLALATAQTDAWTVGQHDQGLDNGIYDDGRDVFSIYYDIATHERDKRIVEKTLYLLTGFVAHGRGCFSDDQVDSVVKLLLK--LSIDPYAKLHALSNNPAVLALLRAGLGRESPPNTQYKCVFC----------------------------------VIRICLLVFGNLLGNAQCLEVMVETNVLQ---------WHDDELYDNIHRLHAQL 295
343 2.000e-12UniRef50_A0A074ZYF8 Uncharacterized protein n=1 Tax=Opisthorchis viverrini TaxID=6198 RepID=A0A074ZYF8_9TREM  ali  16  1.......................................................................................................................MYQASRIVAKFACWSRQLMEEKELMYYLNWLRDQLLI--------------------PKNEYDQTVARNLQMMLRIPKYRARYAEVGGIETIVEVL--GDKRTGLQLQYQLIFCLWCMSFDLEHVQRMCRSPLIPTVADIFREAEREKIIRISLALFR............................................. 137
344 2.000e-12UniRef50_UPI000D77D66F ARM repeat-containing protein n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=UPI000D77D66F  ali  35  360..............................................................................................................................................................................................................................SAQLQYRVLLNFWLLSFSPSIASELNKFSLVPLLVDALRGAVKEKVMRVCVATLANLLAKAPNASSMLGSGLLPHVEHMADKGGGDEEVCEDVEYLAKEL 477
345 4.000e-12UniRef50_D8UB52 Uncharacterized protein (Fragment) n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8UB52_VOLCA  ali  18  84........................................................IPLLVKLLE-SSHGDVQRQAAGVLLSLAAKNADTQLAITRAGG-----IPPLVRLLDSLDTGVQKWAAGALQNLAVNAANQVTVTQAGA---------------IPPLVRLL------HSPDTGVQQQAAGVLRNLAGNASNRVAIAQAGGIPSLVLLL----GGSHAGVQQQVIGVLWNLAVDAANQVAIIQAGCIPLLVK-LWGSPNLHVRQWAEGLLWNLASSTDNQTAIIRAGGISNVVNLLDS-SEDPAVQE......... 310
346 5.000e-12UniRef50_A0A1X6NMJ1 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6NMJ1_PORUM  ali  22  205.....................................................................................................................................GDVPLTPEQARAEEHADDEAAHAREEAIHRTLRALAAYMMVDEHRAAYIQIIVEPIARLVRPADAXXXXXXXXXXXXXXXXXAGMANRSSVQIVYEALLCLWLISFKDTVSGAMDTAAVPRRLAALLRDAAAEKTVRVALATLRNLVTRAQLRREMVGAGLVAILGRLSARGWSDEELRGDLASLSEAL 404
347 7.000e-12UniRef50_A0A0C7BIJ5 Uncharacterized protein n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7BIJ5_9FUNG  ali  27  5........................................................................................................................................................................................................................................................KCKIIPVLLDYAKSTPKEKVIRVIIATFKNLIEKAPNMSAMLVAKLLPFAEHLATRKWSDQEIVDDIEYITTEL 80
348 1.000e-11UniRef50_A0A058Z606 Uncharacterized protein n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058Z606_9EUKA  ali  17  44.............................................................................................................SMMNNHDEVTLDQALSAVSVLCYSNELSMKRSASLFYLNLIKEEFRATRETLKPLMNLLT------CDDLEVLRPATIALGNLAATDRNKTLIVELQGLRLLTNLLI----NPSSDILCNVCGCFTNLSSSDENKSRIVECGALPFLVA-LCSFPDVRVVRNACGTLLNLSQHRPNCQHLIRAGCLTVFITLLSS--DDPDTVKYASAALSNL 245
349 1.000e-11UniRef50_A0A0N8A1R2 V-type proton ATPase subunit H-like protein n=2 Tax=Daphnia magna TaxID=35525 RepID=A0A0N8A1R2_9CRUS  ali  25  1...............................................................................MNDMLQEDMNRVEIIREYAKKKETVWSPFLNLLNRPDSFIQNMTSRIKTNLACWSRDPMEGSDLTFYLTWLKDQLQ--------------------TPGNEYVQTTARCLQMMLRDEKYRLVFAGMEGVSVLANILS---GRINFQIQYQLFFCGW....................................................................................... 135
350 1.000e-11UniRef50_E1ZBG9 Uncharacterized protein n=1 Tax=Chlorella variabilis TaxID=554065 RepID=E1ZBG9_CHLVA  ali  12  111....................LRGSSSEEVQKQTVKALCNLAFSSPNNRAIIAAADAIPVLVQFLRSSGSEAVLAKAASTLANLCIDSPDITTAILEAAVQAETTGALLHLSANSTSSSVAIVASGAIPLLVGRLRRSSEAVQEHAAALLANLAFGSPDNRAAIAAAGGIPQRLRSSSSEAIQVAAAGALANLSAESSNRTAIVDAGAIPVLVGHLR---SSCSEEVQKCAAGVLANLAGSPDDMAAIVAAGGIPALVQRLRSSSSEAVNMRATSALLNLCDSPSNNAAIVAAGGIPALQALHSSSPCDE............. 418
351 2.000e-11UniRef50_L8GGR7 Vacuolar atp synthase subunit h, putative n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8GGR7_ACACA  ali  32  22.........................................................................................................................................................................................................................................................SNLVSQLVEVIRKEDRVKIRRVGVATLRNILSKGENNEQMIKAGMVKLAAGLTQKKWKDEDIEQDLAVLNEVL 94
352 2.000e-11UniRef50_L7JUU0 Vacuolar H+-ATPase V1 sector, subunit H n=2 Tax=Pleistophoridae TaxID=35232 RepID=L7JUU0_TRAHO  ali  17  59...........................DDFYLKVKSIEIMSRRYSNALRDDPNSSFWTFVRATLTTEEDHEIVNFLLKCLRNFFLENLEREQIFPDLNTA------------VVFEKQDRKDSDRKDQRENVGDTNPNNACAPDNQSSKTDTGTCSEKDVDDINIILKCSKFIPYSQRYDQRE----------RVESFRVHFVSDTAVQR-----RLLSFIETDDFCYNALFLIWLLSFTEKVFDKLSAVDLIEALENKIRKDTQDKIVRMACLVLMNLKEHDLFISLKNLHRMLNISKIMLNRKSEDLEYNHDKKELYN.. 324
353 2.000e-11UniRef50_H0ES64 Uncharacterized protein n=1 Tax=Glarea lozoyensis (strain ATCC 74030 / MF5533) TaxID=1104152 RepID=H0ES64_GLAL7  ali  17  8.YLSSLQNNIRTRPIPWDGAVRAGTVSEDQLNKIRAVDKVRKDQRKQIIEGDIEGYKALFSN-----DPEAPIPLLTSTVLSTMIGGASGTSKQVSAALPKKDTIEPLVEILRS................................................................................................................................................................................................................ 115
354 2.000e-11UniRef50_A0A0S7FRP6 VATH (Fragment) n=2 Tax=Euteleostomi TaxID=117571 RepID=A0A0S7FRP6_9TELE  ali  28  3................................................LVHQAEKCAKTFLNLMAHISKEQTVQYILTLIDDTLQENHQRVNIFFDYAKKKNTAWSYFLPMLNRQDLFTVHMAARIIAKLAAWGRDLMEGSDLNYYFNWIKSQLS....................................................................................................................................................................... 110
355 3.000e-11UniRef50_A0A0L1KLN0 ATP synthase n=1 Tax=Perkinsela sp. CCAP 1560/4 TaxID=1314962 RepID=A0A0L1KLN0_9EUGL  ali  18  19..........................................DEQEQTMFRSIWLLRDKLASLKIVVSENEQVAVSALLKVSIRANEPLQIQLFSLCTL-----------LCRHVTEFANQLAVSKLAEGLVEPLHMSSDEAFLAYILALNDKHTTHGCIFASHLNSAVSESLEKGVRTGKTSLSINNLWILVRNKKIRAFFRTINGVQNIFRFVWRFCLTDQVAMLYEALGICWLCLYDKENVQTAYKNRVIAITHAVLKHNTKEKCIRMSLLILEILLLRSVLYIDMSSSGMLKTFHALRKKNWEDGDITDALATL.... 300
356 4.000e-11UniRef50_A0A061FZ39 ARABIDILLO-1 isoform 1 n=11 Tax=malvids TaxID=91836 RepID=A0A061FZ39_THECC  ali  13  567...................................................................................................................................CKFEGVQEQAARALANLAAHGDSNSNNAAIGQEAGALEALVQLTSLNEGVRQEAAGALWNLSFDDKNREAIAATGGVEALVA-LAQSSSSASQGLQERAAGALWGLSVSETNSIAIGRQGGIAPLIALAR-SDIVDVHETAAGALWNLAFYRDNALRIVQDGGVQPLVHLCSSSIS............... 741
357 7.000e-11UniRef50_S9UDP5 Vacuolar protein 8 n=1 Tax=Strigomonas culicis TaxID=28005 RepID=S9UDP5_9TRYP  ali  14  411.................................................................................................................................LLYTDSLAILENVCMVIGYITREDVSKKEIREIGGLEKITATLRHPSDSIKTKM--AGAVWNCASNADNRSYLRNLGAIPALLELLRQPSDAVDPFVRENAAGALWNLSVDAENKAMILDYGGIPALVQVIASSSSVAVVENVSGTLWNCSAAVETRPLIRKAGGIPILLGLLDDN................. 588
358 8.000e-11UniRef50_J9DAG9 Uncharacterized protein n=1 Tax=Edhazardia aedis (strain USNM 41457) TaxID=1003232 RepID=J9DAG9_EDHAE  ali  18  7...........................ESTYKKTKDFEVLNESFQQDELSRKCPNIEHSISNLL-KSQTPCVIRWVLYKKNLDLRFEDS------------------LLNLLDHTDAYIHLKTCQILASLYSDIIPSQRFVDWLKSKLQTPHNYDEVNQLLSFVADILPNRKKSLRIENG----------ELFDRNVVKIDFVKDEN-----WLKILKDFLTICETQYFALKIVWILSFNAFCLNIMLEKKIVSHVIRILKEKQREKLTRLSLSIIRHCLEKDVTFSVCTSHKLL----NLCSEPLNDEDMENNRQYIKEKL 263
359 2.000e-10UniRef50_UPI000C04A597 uncharacterized protein LOC111318064 n=1 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C04A597  ali  14  117..............................................................................................................................MLGLDHDALDREQAIVALWEYSLWGKECIDAIMRFQGCINLTVNLLNSKS--SAICEAAAGLLRSISSINLYRDLVAEGGAIEAITGLLSRPSLTSEV--KEQSLCTLWNLSVDEKLRVKIANLDILLL-LINSLDDDVIKVKVAAGGVLANLALSHCNHNIMVEVGVIPKLAKLL---ITDVE............ 292
360 2.000e-10UniRef50_A0A2A2LUS7 Uncharacterized protein n=1 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2LUS7_9BILA  ali  16  123..........................................................................YLLSKEDHTIVTYPNLIEALIAASRSHNDAMGALSHISEHRDGPMLIFRSGGLAELIRMLYCPVESVV-HYAVTTLRNLLIHVEPVKAQARALDAVQALSPTNPKLLAQVADSLYFLLLDDPNSKLIFLSLGGPKTLVTIMNT--YPDHRKLIYTVIRCIRSLSTCMQNKAALISLGCLPALYHELCRAADERTQTAVLVAMRNLSDAATN-EENLTSLVIRLLNLIRESN................. 358
361 3.000e-10UniRef50_A0A1Y1UA39 ARM repeat-containing protein n=1 Tax=Piromyces finnis TaxID=1754191 RepID=A0A1Y1UA39_9FUNG  ali  19  14..............................................................................................................................................................................................NLAVTVPNKLLIVQLGGLEPLIQLMK----SSNVEVQCNAVGCITNLATHNENKGKIARSGALVELVKLAK-SKDIRVQRNATGALLNMTHTEDNRHQLVNAGAIPLLVSLLNSNDKD.............. 126
362 3.000e-10UniRef50_A0A2N6N848 Vacuolar protein 8 n=3 Tax=Dikarya TaxID=451864 RepID=A0A2N6N848_BEABA  ali  16  11...........................................................................................PVLADSEREAVADLLQFLENRGETDFFSGEPLRALSTLVFSENIDLQRSASLTFAEITERDVREVDRDTLEPILFLLQ------SSDVEVQRAASAALGNLAVNTENKVLIVQLGGLTPLIR----QMLSPNVEVQCNAVGCITNLATHEENKAKIARSGALGPLTRLAKSRDM-RVQRNATGALLNMTHSGTLVFKM................................. 197
363 4.000e-10UniRef50_A0A0M0JYS7 Vacuolar protein 8 n=3 Tax=Haptophyceae TaxID=2830 RepID=A0A0M0JYS7_9EUKA  ali  14  123................................................................................................................................................................................ADSEAAGNAAGALVSLAVNAINKDVIREAGGIAPLVALLGAGADSEAAR---YAACALWNLSVNATNKDVIREAGGIAPLVALLGAGADSEATRYSAGVLMNLSVNATNEDAIREAGGIAPLVVLLG................... 246
364 4.000e-10UniRef50_A0A094B747 Uncharacterized protein (Fragment) n=1 Tax=Pseudogymnoascus sp. VKM F-4513 (FW-928) TaxID=1420907 RepID=A0A094B747_9PEZI  ali  18  8.YLSSLRNNIRARPIPWDGAVRAGTITEAQLGRIRAVDKVRKEVRVKTVEEGVGEYRGLFLGAEEDGGERSILEKAARRAD................................................................................................................................................................................................................................................. 87
365 5.000e-10UniRef50_A0A1S3DCJ1 armadillo segment polarity protein-like n=3 Tax=Pancrustacea TaxID=197562 RepID=A0A1S3DCJ1_DIACI  ali  12  1.....................................................MEMVAALVHAISNSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGG----------IPALDDADLATR--AIPELIKLLNDEDQDDADLATRAIPELIKLLNDEDQDDADLATRAIPELIKLNDEDQVVVSQAAMMVHQLSKKEASRHAI--MNSPQMVAALVHAISNSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGGIPALVKLL-SSPVESVLFYAITTLHNLLLHQEGSKMAVLAGGLQKMVLLLGRN................. 239
366 5.000e-10UniRef50_E7KUZ1 Vma13p n=1 Tax=Saccharomyces cerevisiae (strain Lalvin QA23) TaxID=764098 RepID=E7KUZ1_YEASL  ali  13  12.HFNEIRSIIRSRSVAWDALARSEELSEIDASTAKALESSSSNNAHSGFKVNGKTLIPLI-HLLSTSDNEDCKKSVQNLIAELLSSDKYGDDT-VKFFQEDPKQLEQLFDVSLKGDFQTVLISGFNVVSLLVQNGLHNVKLVEKLLKNNNLINILQNIEQMDTCY------------------VCIRLLQELAVIPEYRDVIWLHEKKFMPTRIVATNSNHLGIQLQYXSLLLIWLLTFNPVFCKR............................................................................ 262
367 5.000e-10UniRef50_U6LL81 Vacuolar ATP synthase subunit h, putative n=1 Tax=Eimeria brunetti TaxID=51314 RepID=U6LL81_9EIME  ali  21  28NHL-VKQELVLQRQPEWHLLERAGLIKKGMGEALGGLHALDAEQRADAIAENPA-IVPALVAVLRLEADIHPAQYALTILYEVVRENSSRYEVMCKA-LEGTNLYEDFMQLLQRHDAYTGDRASFMLSGFMSRSRST-------------------------------------RFSDNEVEYFVQ---------DRWRPVVWENRTLPEL--LVKNLSLMQPPSVVYKAVLC----------------------------------IVRVGLHVIENFLSCEEAVEIIIEENVAQILTLLEFEKWRDPDLYEEIR...... 260
368 6.000e-10UniRef50_A0A1Z5JHE2 Uncharacterized protein n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JHE2_FISSO  ali  25  146........................................................................................................WRILHRVLSKSDLFAQRGAAFCLACILYEGCLQEE----------IGQLFSSLSSVLRSFVTWITSRLQSATSPSAL-AAVTPSMTIILEIKEARLCFVYNGGLGFLSRHLLTSDKDPNVQQLYELTYCLWLLSFHHSLRKHFHRDGAVPALVDLVAAATREKITRLALSTLRNLATFHTFRTEMIGCGLLTRLERLKEGKWN............... 364
369 6.000e-10UniRef50_S4RQK3 Uncharacterized protein n=1 Tax=Petromyzon marinus TaxID=7757 RepID=S4RQK3_PETMA  ali  21  1...................FRRSQLISADDFEFIQRFTAAGTEQRRRIAEIEGTQCAQTLLHLVTRIVKESVVHFVLVLIEDLLQENGEHAQIFVFTRRNHRSQWVLFMPMLNRQEILTMHLVCHIIPG................................................................................................................................................................................................. 111
370 7.000e-10UniRef50_UPI000CD5E144 armadillo repeat-containing protein 3 isoform X2 n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD5E144  ali  13  58................................................................................................................ENKSSLVGLGVMEPLCHLLSHGDSLVSRNAVMALGVMSSNNDVKGVLKKMDIIPLVISK-LSPDDDVVVHEFATLCLAALSTEFTNKIRICDNNGLDPLIHLL----SSPDPDVQKNSLECIYNLVQDLPNCSAVCKLDGIPPLLHLLQ-SEFPVIQQLVLRTLERVTSDAEARSALRGQGFHQLLELLSSREHSD.............. 248
371 7.000e-10UniRef50_A0A2G8JT01 Putative vacuolar protein 8-like isoform X1 n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8JT01_STIJA  ali  12  85.................................................................................................QDEERAAVNELLTYLNREHEMKPVLTPQRLRALCILTYSENSDLQRSAALCLAEISERLLQPLTSEMMEPVLALLESDDIETQKAASLAVSNFALVGPESNKEVIVNSDTLPVLIRLL----GNSDLEVQCNACGCITTLATSNRNKSQIVACGAVIPLIKLAKESD-VRVQRNATGALLNLTHLEKNREILVGCGAVKVFVDLLSS--EDTDIQ.......... 292
372 1.000e-09UniRef50_A0A2R6WBY6 Uncharacterized protein n=3 Tax=Marchantia polymorpha TaxID=3197 RepID=A0A2R6WBY6_MARPO  ali  13  134................................................................................................................................GLDNPEVEREEAVRALWRHSAGGKYYIDQIMEFPGCLNLIVSLLR--SHRTAAAEAAAGVLRNISSIETYRSAVTEAGALEEILGLLT---RRDIPEVREHATCVLWNLSVEEGPRAKLVNPEILQVLSSML-GSEKDGEREAAAGVLANLTQSSCYSDELVKVGIIPKLAKIL.................... 301
373 1.000e-09UniRef50_R1GGS0 Putative vacuolar protein 8 protein n=7 Tax=Fungi TaxID=4751 RepID=R1GGS0_BOTPV  ali  15  143................................................................MNSPNVEVQCNAVGCITNLATHEDNKAKI------ARSGALPPLTRLAKSRDMRVQRNATGALLNM-THSALSNIAVDANNR--------KRLAQTESRLVQSLVHLMDSSSPK--VQCQAALALRNLASDERYQLEIVRARGLPSLLRLLQ----SSYLPLILSAVACIRNISIHPSNESPIIDAGFLGPLVDLLGSTENEEIQCHAISTLRNLASSDRNKQLVLEAGAVQKCKQL..................... 359
374 1.000e-09UniRef50_F0YLZ5 Uncharacterized protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YLZ5_AURAN  ali  16  207..........................................................................................................................TGAILALITVLRDGTNNESAAGTLWHLAAKDDYKADIAAAGGIPLLCDLL--SDEHDMTKMNAAGALWELSGNDENKIAINRAGGIPPLVALLGNGRDIARI----RAAGALWNLAVNDENKVVIHQAGGIPPLVTLLSVSGSGS--EKAAGALANLARNSTAAVAIVEAGGISALVAVMS................... 379
375 2.000e-09UniRef50_A0A2I4HGG7 V-type proton ATPase subunit H-like n=3 Tax=rosids TaxID=71275 RepID=A0A2I4HGG7_9ROSI  ali  68  1....................MTTKLITGTCLQLLRHYDNRAESYRVQLLEDDGPAYVRVFVTILRDIVKEETVEYVLALINEMLTANPKRARLFHDNSLANEDTYEPFLS.................................................................................................................................................................................................................... 90
376 2.000e-09UniRef50_Q5VRH9 U-box domain-containing protein 12 n=35 Tax=Mesangiospermae TaxID=1437183 RepID=PUB12_ORYSJ  ali  16  257............................................................................................CIQKWLDSGHKTCPKTQQPLSH----TSLTPNFVLKSLISQWCEANGIELPKNKQNSRDKKAAKSSDYDHAGLVSLMNRLRSGNQDE--QRAAAGEIRLLARNVNNRICIAEAGAIPLLVNLL----SSSDPRTQEHAVTALLNLSIHENNKASIVDSHAIPKIVEVLKTGSME-TRENAAATLFSLSVVDENKVTIGAAGAIPPLINLL.................... 456
377 2.000e-09UniRef50_A0A210Q471 Vacuolar protein 8 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q471_MIZYE  ali  14  61....................QQTGGLVDDSYEMI-----LLESERQAV--GNLLHYLEHEANGEPVLNEEHVRALSILAYSDNVELQKSAALCFTEISERTKAPLKPLVKLLRSRDLQVQKSATLAVSNFTLQGPDSNKATIVEALVCLLQSSNTDVQCNTAGCITTLATLRLMKSQDLRVQRNAAGAVLNLTHLQNHRNDLVAGGVIPVLVDLLQ----SPDQDIQYYSAASLSNIAVNEKHRALMVHTDVIRNLIRLV-SAKEEKVQCQACLALRNLASDGNNQPLIVKYGALPRLQKVLRTGHKD.............. 366
378 2.000e-09UniRef50_A0A0D6MCG7 Armadillo/beta-catenin-like repeat protein n=2 Tax=Ancylostoma TaxID=29169 RepID=A0A0D6MCG7_9BILA  ali  16  374..........................................................................YLLSKEDRSIASYPGLIDALIKASKGDNDAIGALSHISEHPQGRMQIFRSELIRMLYCPFETVVQYAVTTLRNLLMHVDTVKAQARVLGAIEALAPLLL-RNNWKFLALVADSLYFLLLDDPQSKIVFLSLGGPQTLVHILNN--YTQYPKLMYTVIRCIRSLSVCQQNKAALISLGCLPALYKELCAATDDRVLLAILVAMRNLSDAATN-----EDNLAPLVIRLLE................... 603
379 2.000e-09UniRef50_UPI00085A812F protein ARABIDILLO 2-like n=3 Tax=Raphanus sativus TaxID=3726 RepID=UPI00085A812F  ali  17  581...........................................................................................................................................................................QLTRSHHGGVKLEAAGALWNLAYDEKNRELIAALGGVQASVA-LAYSCMNASRDLQKSAAGALWSLSHSNGNSIVIGLEGGIPPLVSLARSQYKD-VHEAAAGALWNLSSNHDNALGIVEEGGVLALGRLCT................... 710
380 2.000e-09UniRef50_A0A183JZ68 Uncharacterized protein n=1 Tax=Schistosoma curassoni TaxID=6186 RepID=A0A183JZ68_9TREM  ali  22  1...........................................................................................................................................................MEENDLIYYLNWLREQLTITN--NQYDQTVARNLQMMLRIREYRAQFAKVGGIETIGDVLQ--EKSTSRQLQYQLIFCLWCMSFDSIHVTDICKSALLATVADIFLEADREKITRISLAFFR............................................. 119
381 2.000e-09UniRef50_S9V6R7 V-type H+-transporting ATPase 54 kD subunit n=2 Tax=Strigomonadinae TaxID=1581334 RepID=S9V6R7_9TRYP  ali  32  6................................................................................................................................................................................................................PRLLTDIVSNDSASIIQLIYETLLLTWLLSFEYEGIVQLVRHRIIPQLHRVLQRVQKEKCVRVALMALWNMVRGPSLVAEMVSVGMIKTLNQLQRRKFGDEDILVLVEDLNRAL 166
382 3.000e-09UniRef50_A0A0K0DIA8 Uncharacterized protein n=2 Tax=Strongylida TaxID=6308 RepID=A0A0K0DIA8_ANGCA  ali  14  127..........................................................................YLISKEDRSIVSYPALIDALIKVCKSDNDAIGALSHISEHPQGRMQIFVAELIRMLYCPLDTVVQYAVTTLRNLLMHVDTVKAQARILGAIEALAPLLL-KSNWKFLALVADSLYFLLLDDPQSKIVFLSLGGPQTLVQILN--HYVDFPKLIYTVIRCVRSLSVCQQNKAALISLGCLPALYKEMCAATDDRVLLAILVALRNLSDAATN-----EDNLAPLVVRLLE................... 356
383 3.000e-09UniRef50_A0A225WZN3 Putative vacuolar protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225WZN3_9STRA  ali  14  583.................................................KADVARLAHERLSQVGATSKDRRILTLLGSFFSLCLEYEVHHLLLTAAYAATDNKGGFLLQRLACDGDVEAQSMCFNAVCILFDGRSLSRDELLRL----IGRIFPVVIEVCTRKNKAKCSDNVVDSADHGLQAACVACFTRFASVAEYRVTMVE----NGLLGALAVFAGSEDAETLRLCVHTYALLSQDRAVGGPLLRGGVIKALT-LLAAAPEEAVRRACAVTLCNLSAEVAYVEELAKLGALRALLVLACVKSTDPE............ 835
384 3.000e-09UniRef50_UPI000A3B6EC8 vacuolar protein 8-like n=1 Tax=Anas platyrhynchos TaxID=8839 RepID=UPI000A3B6EC8  ali  12  13..........................................................................................................................AARGITPLLSLANSYDPRVQQNAVGAILNLTQSERQQVLCKEGALPVLIFLLESPDSEVQYYSCAALSNIAVNAQHHEA-MLRTGERFLLRVLTSLLSSPVDKVSSQACVCLRNLATSADTQAEMVSQDVLPKLCSLLASGS-EAVQRASVALLWILSQHPHNQDALVCAELLQSLGTLLSAHTTDPVI........... 200
385 3.000e-09UniRef50_T0QVF4 Uncharacterized protein n=6 Tax=Saprolegniaceae TaxID=4764 RepID=T0QVF4_9STRA  ali  16  909.......................................................CAKVLFNLLAHDDTREVVDGALYALIKLAKLDMEDIRQLCLRSIYNISLEPTKVPRL--VDMEIVRILSGMYAQDYS---KEMKRLICGILSNVSAVSGHELQLLHEGALAILTSLVKTRDPETRV--YCAHVLCNVTCNVDVRDLVLKDDG--HVVGLLISLTRAESKDIRRYSAGAIANLSASRVGVDAMTRDAMVPSLCDLLQRLSCDITLGLCVTALRNLMTEPANQLQLVACHGVQILSVLMVSA-TDPEI........... 1156
386 3.000e-09UniRef50_W4FYH9 Uncharacterized protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=W4FYH9_9STRA  ali  20  23..LAREEALAKFKDINWATYTRAGSLDKTEIAAIKEMEIVAKNASDTFLREYGTALGAGLLKLIKNVTEPSVLRYAFARIDDLLPDGRSRKRATYFVGEGAYVEAAPFLRLLRSESGYTQYAAGHILAQFLTFRPKEQDIVSLIQWILDAVKASAQSNDVARAATA----------------RNAITTLMVLLRNETARKLFTRAGGLASLADLLKYSQGKAQLAY................................................................................................ 243
387 3.000e-09UniRef50_UPI0008194F26 protein ARABIDILLO 1-like n=1 Tax=Gossypium arboreum TaxID=29729 RepID=UPI0008194F26  ali  18  467.....................................................................................................................................................................................LQEAAGALWNLSFDDKNREAIAAAGGVEALVA-LAQSSSSASRGLQERAAGALWGLPVSESNSIAIGRQGGIAPLIALA-CSNIEDVHETAAGALWNLAFHRENALHIVQDGGVKPLIHLCSS.................. 587
388 3.000e-09UniRef50_A0A2T7ILY5 Vacuolar ATP synthase subunit H (Fragment) n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7ILY5_THEOR  ali  16  1....................................................................................................DNGIYDILLKILDGRDVFSIYYDIEKTLYLLTDQGLGAPITQLRPPGQHDPNGPFCPDLAHAHRLTGFVAHGRGCFSDDQVDSVVKLLLK--LSIDPYAKLHALSNNPAVLALLRAGLGRESPPNTQYKCVFCVWLVSRSEEYVEHLLKNELVRLLCELLAATKVEKVIRICLLVFGNLLGNAQCLEVMVETNVLQVLTLLAYDKWHDDELYDNIHRLHAQL 319
389 3.000e-09UniRef50_UPI0008F9B274 V-type proton ATPase subunit H-like n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9B274  ali  26  5.......................................................................................................................................................................................FVGRCFQVVLRLDKYRLAFIKVEEPPTL--LKVFASGQVNFQIQYQLIFCLWLLTFNPKFAQKMNRLGVIPILADILSDS........................................................... 82
390 3.000e-09UniRef50_F0Y3Z1 Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y3Z1_AURAN  ali  13 1894...............................................................................................................................................................................HDDLENRVKAAAELRVLALDGDNKVAIVAAHGIGPLVDLCRDGTNEENAAAAECAARALWNLSINNDNKVAIAESGAIGPLVTLLSKGGTIGAKEAAAGALRNLAVNVDNQVLIVEAGAVRPLVELCKE.................. 2022
391 3.000e-09UniRef50_A0A251T1L5 Putative ARM repeat superfamily protein n=30 Tax=Mesangiospermae TaxID=1437183 RepID=A0A251T1L5_HELAN  ali  12  90................................................................................................................RSGDSYVGLFIRML--GLDNDPLDREQAVDALWKYSLGGKKCIDEIMKFRGSVFLTINLLKSES--SVACEAAAGLLRQISSVNIYRDLVAESGAIEEITSLLTRP--SLTFEVKEQSLCVLSNLSVEERFRLQIANSDLLLLLIKLLDDDEM-KVKEAAGSVLANLALSDSNHKTMVEAGVIPPL........................ 268
392 5.000e-09UniRef50_A0A0F4YQK9 Vacuolar armadillo repeat protein Vac8 (Fragment) n=2 Tax=saccharomyceta TaxID=716545 RepID=A0A0F4YQK9_TALEM  ali  13  1................................................................................................................DNRQQLVNAGAIPVLVQLLSSPDVDVQYYCTTALSNIAVDAANRKRLAQTESRLVQSLVQLMDSSTPKVQCQAALALRNLASDEKYQLEIVRAKGLPPLLRLLQ----SSYLPLILSAVACIRNISIHPLNESPIIDAGFLKPLVDLLGSTDNEEIQCHAISTLRNLASSDRNKELVLQAGAVQKCKDL..................... 186
393 5.000e-09UniRef50_A0A261C1Z9 Uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis latens TaxID=1503980 RepID=A0A261C1Z9_9PELO  ali  13  668.....................................................................................DHRAFIEALMHASNSNVNVRRNAIGALSHMSEFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSESRGQARALNAVEALTPH-LHKTNPKLLAQVADGLYFLLIDDAQSKISFLSLLGPQILVSILR--EYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPALYAELCAAKDERSQTAILVAMRNLSDSATNEENLTQL-IIKLLEIIRT................... 889
394 6.000e-09UniRef50_A0A2N6N856 Vacuolar protein 8 n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2N6N856_BEABA  ali  14  4................................................................................................................ENRQQLVNAGAIPILVQLLASPDVDVQYYCTTALSNIAVDANNRRKLASSEAKLVQALVALMESSSPKVQCQAALALRNLASDEKYQLDIVRANGLAPLHRLLQ----SSYLPLILSAVACIRNISIHPLNESPIIEANFLKPLVDLLGSTENEEIQCHAISTLRNLASSDRNKALVLDAGAVQKCKQL..................... 189
395 7.000e-09UniRef50_UPI00094F1B0D armadillo repeat-containing protein 4 isoform X1 n=3 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094F1B0D  ali  13  368..FDDTQKGARSKNIS--HFSESSY--AEQLSSMKLKSQLQPGEVFSETSSESDQSYEEEEQPARRQRNTDSEYWQIQKLVKYLRAGDQTATLLTLYALMDYDLTHETYH-LAMQDS----GGLKVLTNILHLDEVNLQLGSLQILRDISHNAQTRRAIVDNGGLRSIVNVLDSRNKD--VKALAAETIANLTSFRRARRTVRKYNGISKLAKLLDCAPDLANVDAKQEGVLALWSCSRSPKNKEAIHKAGGVPLLGRLLKSPQMNMLIPV-VGILQNCADEESCKDAIQTEGMIKLVQNLSNDN................. 669
396 1.000e-08UniRef50_A0A1I7V4F2 Uncharacterized protein n=1 Tax=Caenorhabditis tropicalis TaxID=1561998 RepID=A0A1I7V4F2_9PELO  ali  25  13.HFRKEADKMRLMKTNWGLFTRSRNIAQSDYDFIVTYEQASESERSTVLNVFREKAVYAFVHLMTQISKDDYVRYTLTIIDDMLREDVTRTLIFED.................................................................................................................................................................................................................................. 108
397 1.000e-08UniRef50_F0YIG3 Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YIG3_AURAN  ali  15  5..............................................................................................................................................................................SDQPVPRKEAAARELWTLALNNDYKVAIVSAGAIPALVLLCRQPPSG---KCAEYGARALWNLAINAENKVAIAEAGAVRPLVTLMTNGS-VHCREAAAGAIRNLAVNEKNQEEIVAEGGVRPLVELCS................... 129
398 1.000e-08UniRef50_A0A1Z5L048 Secreted protein (Fragment) n=6 Tax=Eumetazoa TaxID=6072 RepID=A0A1Z5L048_ORNMO  ali  14  81.................................................................................................................SSNKPAIVEAGGVQATAMHLGHQSQRLVLKCLWTLRNLSDAAIKQENVDGLLSSLVQLL--GSNDINVVTCAAGILSNLCNNHRNKVTVCHVGGIEALVRTVIQAGDREEI--TEPAVCALRHLTCRHPEAEAVRNNYGLQVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGAIPRLVQLLHKSYQD.............. 276
399 1.000e-08UniRef50_U5D7P0 Uncharacterized protein n=1 Tax=Amborella trichopoda TaxID=13333 RepID=U5D7P0_AMBTC  ali  56  11....EEIPKVLTRDIPWEAYMATKLISGKSLQLLRRYDNRSESYRAQLLDDDGPAYIRVFVSICGTLPRTE........................................................................................................................................................................................................................................................... 77
400 1.000e-08UniRef50_A0A0M0JGP5 U-box domain-containing protein 4 n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0JGP5_9EUKA  ali  17 2921..........................................................................................VNLLASESVETQENAVAALLHLASQDVASRNTAVKQLVAVLSQRSATAQALAVLAARSEENRKAITAANAIEPLVVLLGDGRRVKV--NTPQERAAAVLADLARTGDNKSSIVKVGGVGPLVAML----SSDSRDAQTHAACAIWQLAALGTNKTIIVDTGAIPPLVALLAIDQKMLPQRYAAGALWHLASSADNKTQIANAGAIPLLVEILYSKFS............... 3141
401 1.000e-08UniRef50_A5BYQ2 Uncharacterized protein n=1 Tax=Vitis vinifera TaxID=29760 RepID=A5BYQ2_VITVI  ali  12  411...............................................................................................................................................................................DGSDSTCEAAAGLPQEISSINLYKESVAESGAIEEITGLLRHSSLTSEV--KEQSICTLWNLSADEKLRMKIANTDLLPLAIKSLED-EDIKVKEAAGGVLVNLALSKSLHSIMVEAGG............................ 526
402 1.000e-08UniRef50_S9U3L1 Vacuolar protein 8 n=2 Tax=Angomonas deanei TaxID=59799 RepID=S9U3L1_9TRYP  ali  13  322.................................................................................................................SKNEIRNIGGLEKITATLRHPSDSIKTKMAGAVWNCASNAENRAYLRQLGAIPALLELLKKPEREADVRENAAGALWNLSVDAENKTMILEYGGVPILVQVMS---SSQSVAVVENVSGTLWNCSASVETRPLIRKCGGIPVLLSLIDGTVSDKILDNAAGTLRNCAINDQNKPAIQNAGGVELLESLTSKK................. 528
403 1.000e-08UniRef50_A0A2X0P2M5 BQ5605_C007g04418 protein n=1 Tax=Microbotryum silenes-dioicae TaxID=796604 RepID=A0A2X0P2M5_9BASI  ali  12  199............................................................LTRLARSKDMRVQRNATGALLNMTHSDENRLQLV------NAGAIPVLVNLLSSPDTDVEYYCTTALSNIAVDGQSDRRVGLREFGELILVYITAANRKKLAQSEPKLVTSLISDSPSLKVQCQAALALRNLASDDKYQLEIVKNGGLPA----LLRLLRSSFLPLILSAAACVRNVSIHPLNEAPIIESGFLSPLIDLLAYDENEEIQCHAISTLRNLAASSENKRAIVEAGAAERIKEL..................... 432
404 2.000e-08UniRef50_A0A2P4UWU0 Uncharacterized protein n=2 Tax=Caenorhabditis remanei TaxID=31234 RepID=A0A2P4UWU0_CAERE  ali  13  447.....................................................................................DHRAFIEALMHASNSNVNVRRNAIGALSHMSEFRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSESRGQARALNAVEALTPH-LHKTNPKLLAQVADGLYFLLIDDAQSKISFLSLLGPQTLVSILR--EYSEHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPALYAELCAAKDERSQTAILVAMRNLSDSATNEENLTQL-IIKLLEIIRT................... 668
405 2.000e-08UniRef50_UPI000BBD5503 vacuolar protein 8-like isoform X1 n=2 Tax=Astyanax mexicanus TaxID=7994 RepID=UPI000BBD5503  ali  17  61...............................................................................................HLKRESSSRLNHHLPTVQNRDSTVLLETC--CTLLQSDDVEDQRTVTLSMLNLLIDRKVKEEHVIEMGLLEPLVDLLQSG--DNTVQCHSSACIALLASSDSNREVIVASDAVLPLLVLARAF----DPKVQQNAVRALLNLTKSENTVDVLCKEGIIPVLALLLQSTDSE-VQFCSCYALSNIAAVPEHHTKMLQIGLLKSLVLLMGS.................. 263
406 2.000e-08UniRef50_A0A2H5NSZ9 Uncharacterized protein n=1 Tax=Citrus unshiu TaxID=55188 RepID=A0A2H5NSZ9_CITUN  ali  70  26................................................................................................................................................................................................................................................PLVVEYLATNRTLPRLIDVVKSSTKEKVVRVVVLILRNLLPKGNFAAQMIDLGLPQVVQSLKAQAWSDEDLLEGLNQLEEGL 109
407 2.000e-08UniRef50_W4YDQ0 Uncharacterized protein n=2 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4YDQ0_STRPU  ali  13  44...........................................................................................................LLHYLNREYEEKPTISEERLEALCTLTYSENADLQRSAALCLAEISERLMQPISAKVMEPILVLMESSDVETQKAASLALSNFALCGHESNKSVIVKCGALPVLIKLL----SSNNVEIQCNACGCITTLATSNTNKMAIVSCNGVPPLMA-LTTSPDIRVKCQACFALRNLASDDSNRTVLVSLGAVTTFLTLLQSRDTD.............. 239
408 3.000e-08UniRef50_A7L6B1 Beta-catenin (Fragment) n=5 Tax=Bilateria TaxID=33213 RepID=A7L6B1_HALAI  ali  17  50.................................................................................................................SSNKPAIVEAGGMASLAMHLGHQSQRLVQNCLWTLRNLSDAATRIDAVEGLLQMLVQLLT--SNDINVVTCAAGILSNLCNNQRNKVMVCQVGGIEALVRTIMQAGDREEI--TEPAVCALRHLTARHPEAEMAQNHYGLPVLVKLLHPPSRWPLIKAVVGLIRNLALCPANHAPLREHGALPRIVQLLIRAHHD.............. 245
409 3.000e-08UniRef50_A0E6Z4 Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0E6Z4_PARTE  ali  17  18......................................KESCKSRRNSWKLTQLECFQWFQISYENLIHDKPLMYILTTIEAIISDNQRLFKQFMRALTPQVLPKLKQFLFLEGYDPMAYEAAAKIATMIIAEEGGNDAKEWVILFLGGIGNKLKIAD------------------------FMIMPVCVHFLKHETLAVQFIKSGGIRIITNLLSK--YSTDLQIAYYTILALWLLSFTTESISLFNTIGLIKLIIESVQKISREKILRVSFACFRNLVDASPQCIELMVDRLIKQLMLLLKWKF................ 267
410 3.000e-08UniRef50_R0FT21 Uncharacterized protein (Fragment) n=1 Tax=Capsella rubella TaxID=81985 RepID=R0FT21_9BRAS  ali  59  1................................................................................................................................................................................................................................QLLYETCLCVWLLSNYEPAIEYLATSRKMQRFTEVVKSSTKISVLCVVILTFRNLLPKCTFGAQMVDLGLPRVIHSLQTQAWSDESVT.......... 108
411 3.000e-08UniRef50_F6I4A9 Uncharacterized protein n=1 Tax=Vitis vinifera TaxID=29760 RepID=F6I4A9_VITVI  ali  13  69................................................................................................................................................................................SSSCTCEAAAGLLREISSINLYRESVAESGAIEEITGLLRHSSLTSEV--KEQSICTLWNLSVDEKLRMKIANTDLLPLAIKSLED-EDIKVKEAAGGVLVNLALSKSLHSIIVEA.............................. 181
412 3.000e-08UniRef50_K7MLX6 RING-type E3 ubiquitin transferase n=8 Tax=rosids TaxID=71275 RepID=K7MLX6_SOYBN  ali  12  28.....................................................................................................................HTTLTPNYVLKSLIALWCESNGIELPKKQGNCRTKKCGGSSLSDCDRTAIGALLDKLTSNDIEQQKAAGGELRLLGRNADNRVCIAEVGAIPPLVDLL----SSSDPQTQEHAVTALLNLSINESNKGTIVNVGAIPDIVDVLKNGNMEA-RENAAATLFSLSVLDENKVQIGAAGAIPALIKLL.................... 208
413 3.000e-08UniRef50_A0A2K1KH59 Uncharacterized protein n=2 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A0A2K1KH59_PHYPA  ali  12 1118........................................................AALMAKLLGPASPKEVVRDVLMTLSNLSRMNKDFYE-----PIGQANIWGALKACLNHTDPGIRSKVCSALGNMCRHTPYFYDALIEHDIINILIDRCVDPDRHTRKFACFAVGNAAYHDDRYDQLQRCIPYLTRLLLEDE--EDKTKANAAGALSNLVRNSSRLCDDIISKGAIQALCQVISVCAAAPNNEK-----------RELSSESPLKISLFSLGNMCIHAPCRQHLRSPELFKVLMKL--KKFTDPTIVKYITRITNK. 1363
414 3.000e-08UniRef50_A0A2B4S4W6 Catenin beta n=2 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4S4W6_STYPI  ali  12 1440........................................................ATTTAHSIKGDDDDDYMKTHMAFEWEQPGFSEQEMHAMNQQFVSTRSQRIRQAMFPETLEEGTHIPSTQFDSAAHTAVQRLAEPSLMLKQAVVNLINYQDDADLATRAIPELNKLL--NDEDQVVIRQASMMVHQLSKKDASRHAI--MNSPQMVASLVKALNNSNDPETIRCAAGTLHNLSHHRQGLLSIFKSGGIPALVRLL-GSPVEAVVFYAITTLHNLLLHQEGAKMAVLAGGLQKMVALLGR.................. 1683
415 4.000e-08UniRef50_M1UVY6 Similar to V-type ATPase V1 subunit H n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1UVY6_CYAM1  ali  20  169..............................................................................................................................................AHYADPLLMDALLSTTAFLRNSTARIIFSTSNVFHEGDGEPNKAAEAAEMPSAPSSFFGKQHVHGISALSAYLEQPA-AAPLEVIYQVLFSLWLLSFSEIGPEPFESGRLPLRLNGVLRELKAQKAVRLTLAVLRNLSEDATLCREMIGAGIATYLNNAALRRWNDEELQLDVMHLRSRL 351
416 4.000e-08UniRef50_E1ZF63 Uncharacterized protein n=1 Tax=Chlorella variabilis TaxID=554065 RepID=E1ZF63_CHLVA  ali  14  20............................................................................................................................FLVQQLCSSGSEVVQHQAAAALSNLAHGSSAGRAVVAAAGAIPSLVRLLGSSSSVELQVEAAGALCNLAHSPSNTAAIAAAGSIPILVQLLR---SSGSESLQAAAARALWSLAGDSDCRADIAASGAIPILVQRLSTSSNEHVQLTAAAALSNLSVDADNQAAITSAGAIPVVVQRLGSSST............... 201
417 4.000e-08UniRef50_A0A093EZN7 Armadillo repeat-containing protein 4 (Fragment) n=2 Tax=Amniota TaxID=32524 RepID=A0A093EZN7_TAUER  ali  18  512..............................................................................................................................................................................DSPDKDLKCLAAETIANVARFKQARRTVRQHGGIKKLVGLLECVSVGSASLTLYQAALALWSCSKSTKNKEAIRKAGGIPLLARWLKCSQANILTPV-VGTLQECASEPSYRLAIRTEGMINLVKNLSSEH---EELQ.......... 655
418 5.000e-08UniRef50_UPI000B8F322F catenin delta-2-like isoform X3 n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B8F322F  ali  16  255.......................................................................................................................................PRPEYLSPSANAHPGNYGVRWRDPDLHEVIQFL------GNQNPVVKANAAAYLQHLCYMDDPVKAKTRALGGIPP---LVALLSHDQPEVHRNACGALRNLSYNDENKKAIKSAGGIPGLVRLLKRTPDNEVKELVTGVLWNLSSCEELKRAIIDDGILTLVNNI..................... 414
419 5.000e-08UniRef50_D3BQS3 Aardvark n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BQS3_POLPP  ali  13  315.....................................EDLDSDFMKTFDANDENGQIKKIIGVMMKHSQNSLVQRETCYILKRLSYRQRKEDEHEALIARYDGIKLILQAMKNHPNAGVQEDACGALGNLTCDSPNSFGVYSNNNYL----------EVVELDGIKLILAAMRNHLHNPGVQYNTSFVLRNLARNDLSESRVAQEGGIHAIATAMRN--HPNHIGIQTQGCGALRNLGCNDKNKVLSAKEGGINLILNSMKCASHPDLQLNGCGALRNLARNERNKDLITKLGGIQLVLQAMTNHYQDPDVQDE........ 581
420 5.000e-08UniRef50_R1CJA6 Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1CJA6_EMIHU  ali  22  36.......................GIISKDEYQLVEIVQSKSVAAQAALIEMRSAEHAQLFKALLTGVNKDEVVMYILSLLDELLKQKPTLASLFHAALYESIDAKAHAMKLLKHEDPEVQKYALTCVQRLMV.............................................................................................................................................................................................. 151
421 6.000e-08UniRef50_A0A1I7WYI0 Uncharacterized protein n=1 Tax=Heterorhabditis bacteriophora TaxID=37862 RepID=A0A1I7WYI0_HETBA  ali  14  104.......................................ADNDERVYLMSKEDHTIATLIEALLSKSDNLNVKRDAMGALSHLSEHPDGRLHIFRSGGLAE------LIRMLYCAVESVVHYAVTTLRNLLIH-----VDAMTTTLNQIQNVEPLKVQARALGAIEALSPLLFRTNPRL-LAQVADSLYFLLLDDPQSKVVFLSLGGPQTLVYIMNN--YSEHRKLMYTVIRCIRSLSVCPQNKAALISLGCLPALFNELCRATEDRTQLAVLVAMRNLSDAATNEDNL................................. 344
422 6.000e-08UniRef50_A0A197K5B3 Vacuolar protein 8 n=8 Tax=Fungi TaxID=4751 RepID=A0A197K5B3_9FUNG  ali  13  200................................................................................................................ENRQQLVNAGAIPVLVSLLSSPDTDVQYYCTTALSNIAVDAANRKKLAQTETKLVNSLIGLMDSTSLKVECQAALALRNLASDEKYQLEIVRSRGLTPLLRLLQ----STFLPLILSSVACIRNISIHPLNESPIIDAGFLDPLIELLAYDENEEIQCHAISTLRNLAASSENKKAIVEAGAVERVCAL..................... 385
423 7.000e-08UniRef50_A0A0G4MFR7 Uncharacterized protein n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4MFR7_9PEZI  ali  15  197.......................................HSDENRQQLVNA---GAIPVLVQLLS-SSDVDVQYYCTTALSNIAVDGNNRRKLFPDVREVDRDTLEPILFLLNSSDIEVQRAASAALGNLAVNTENKVLIVQMSGLQPLIRQMLSTNVEVQCNAVGCITNLRLAKSKDMRVQRNATGALLNMTHSDENRQQLVNAGAIPVLVQLL----SSSDVDVQYYCTTALSNIAVDGNNRRKLAQSELVSSLVALM-DSSSPKVQCQAALALRNLASDEKYQLDIVRSNGLAPLLRLLQSSY................ 498
424 7.000e-08UniRef50_G7E0H8 DNA-directed RNA polymerase subunit n=9 Tax=Pucciniomycotina TaxID=29000 RepID=G7E0H8_MIXOS  ali  12 1949.................................LRSLATLSFSENVDLQRSAALAFAEITEKDVREVSRDTLEPIMFLLQSHDVEVQRAASAALGNLAVNTDNKIEPLIRQMLSPNVEVQCNAVGCITNLATHDE---------------------NKTKIAKSGALVPLTRLARSKDMRVQRNATGALLNMTHSDENRQQLVNAGAIPVLVSLL----SSPDTDVQYYCTTALSNIAVDGVNRRKLAQSELVHNLIGLM-DSPSLKVQCQAALALRNLASDEKYQIDIVKNRGLDALLRLLNSSF................ 2205
425 8.000e-08UniRef50_A0A023FNA7 Putative armadillo/beta-catenin/plakoglobin (Fragment) n=22 Tax=Bilateria TaxID=33213 RepID=A0A023FNA7_9ACAR  ali  15  427.................................................................................................................SSNKPAIVEAGGVQATSMHLGHQSQRLVLNCLWTLRNLSDAALKQESLEPLLASLVQLLASG--DINVVTCAAGILSNLCNNHRNKVTLCHVGGIEALVRTVIQAGDREEI--TEPAVCALRHLTCRHPEAELAQNSYGLQVIVKLLHPPSRWPLVKAVIGLIRNLALCPANHAPLREHGAIPRLVQLLHKSYQD.............. 622
426 9.000e-08UniRef50_F1A573 Uncharacterized protein n=1 Tax=Dictyostelium purpureum TaxID=5786 RepID=F1A573_DICPU  ali  12  70....................................IDKLPKEYYKTFDKSDENGQIKKIIGVMKNNLHNPTILRETCYILKRLSYRQRKEDEHESLIARYDGIGLILCAMKNHYDAGVQEDACGALGNLTCDSPN----------NLGLYSNDNYLTVVEMGGIGLILHAMKNHLMNPGVQYNTSFVLRNLARNDVSESRVAQEGGIQSIATAMRN--HPNHIGIQTQGCGALRNLGCNDSNKILSAKEGGIGLILRAMRAASHPDLQLNGCGALRNLARNEDNKNMISRQNGIQLVLAAMSNHPDDPDVQDE........ 337
427 9.000e-08UniRef50_UPI0009482ABE catenin delta-2-like n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI0009482ABE  ali  13  306...............................................................................................YSNYNGQPPTDNYAPVSYMEDPGTPVMRAPLAEPETPGSMGSLRAHTPSLDSTHRADPMAWRDPDLPELIEMLRE------PHPPVQANAAAYLQHLCYDDPVKAKIRSLGGIPELVQLL----DHPSPDVHRNAAGALRNLAYNDENKSAINNANGIPALVRLLRKTPDTEVQELVTGVLWNLSSHPP-LKQAVIDDALAVLTN...................... 503
428 9.000e-08UniRef50_A0A1X7R925 Similar to Saccharomyces cerevisiae YEL013W VAC8 Phosphorylated and palmitoylated vacuolar membrane protein that interacts with A  ali  12  163............................................................VGCITNLATRDDNKHKIATSGALVPLTRLAKSKHIRVQRNATGALLNMTHSHENRKELVNAGAVPVLVSLLSSADPDVQYYCTTALSNIAVDEENREKLSQTEPRLVSKLVALMDSTSSRVKCQATLALRNLASDPSYQLEIVRAGGLPHLVKLIQ----SDSIPLILASVACIRNISIHPLNEGLIVDAGFLKPLVKLLDYRDSEEIQCHAVSTLRNLAASSENRKEFFESGAIEKCKELA.................... 401
429 9.000e-08UniRef50_P0CM61 Vacuolar protein 8 n=34 Tax=Dikarya TaxID=451864 RepID=VAC8_CRYNB  ali  14  77.............................................EKEVREVGRDTLDPVLYLLS-SHDPEVQRAASAALGNLAVNAENKLLVVSLGGLE------PLIRQMLSPNVEVQCNAVGCITNLATHDENKTQ---------------------IAKSGALVPLTRLAKSKDMRVQRNATGALLNMTHSDENRQQLVAAGAIPVLVSLL----NSPDTDVQYYCTTALSNIAVDAANRKKLAQSELVQSLVQLM-DSQSLKVQCQAALALRNLASDSKYQLEIVKFGGLKPLLRLLHSSY................ 306
430 1.000e-07UniRef50_A0A061QN36 Vacuolar protein 8 n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061QN36_9CHLO  ali  17  132...............................................................................................................................VRILHESEFGGKESAAGALGNLACNDDNKVLVAEAGGIEPLVSLLQ--DGPISGRESAAGALWNLAMNEDNRVAIPQADGIRPLVELLGDISTEAG---KEASAVCLWNLACNADNRVLIAAESAIPALVRLLSHGES-KVRKAACGALGKLALLGENRKEIHRHQG............................ 292
431 1.000e-07UniRef50_A0A067D1J0 Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067D1J0_SAPPC  ali  17  910.......................................................CAKVLFNLLAHEDTREIVDGALYALIKLAKLDMEDIRQLCLRSIYNISLEPAKVPRL--VDMEIVRILSGMYAQDYS---KEMKRLICGILSNVSAVAGHELQLLHEGALSILTALVKTRDPETRV--YCAHVLYNVTCNVDVRDLVLKDDG--HVIGLLISLTRAESKDIRRYSAGAIANLSAIRAGVDAMTRDAMVPALCDLLQRLSCDITLGLCVTALRNLMTEPANQLQLVACHGVQILSVLMASA-NDADI........... 1157
432 1.000e-07UniRef50_UPI00073838B2 armadillo repeat-containing protein 4 n=3 Tax=Braconidae TaxID=7402 RepID=UPI00073838B2  ali  14  368................................................................................................................................................................................DRIKLEENCALAIFKCASNKLTRDMVRQAGGLDPLCRLVQSEQVRSNKRLLAAVTGAIWKCAISPENVSRFNQNGLVASLVPLLEENEDEEVLAHVVGALAECCVDPANRAVLRINNGLPKLIRLLSCTYE............... 498
433 1.000e-07UniRef50_A0A1B6EZ30 Uncharacterized protein (Fragment) n=1 Tax=Cuerna arida TaxID=1464854 RepID=A0A1B6EZ30_9HEMI  ali  15  16..............................................................................................................................................................................NDEDQVVVSQAAMMVHQLSKKEASRHAI--MNSPQMVAALVRAISNSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGGIPALVKLL-SSPVESVLFYAITTLHNLLLHQEGSKMAVLAGGLQKMVALLQRN................. 144
434 1.000e-07UniRef50_D2VMV0 Predicted protein n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2VMV0_NAEGR  ali  11  301..............................................................................................................................................................................KFPNEGLQSKAAGALWNCASNTENKMTLRELGAISILLDLLA----SNNPGVLENVTGCLWNLAVDNDNKKEIYEKGGIPKLVQLL-TYENEAVIENITGTLWNCASQAEVKVIIRKTNGLPLLHCLQSDN................. 427
435 1.000e-07UniRef50_A7SKL8 Predicted protein (Fragment) n=3 Tax=Eumetazoa TaxID=6072 RepID=A7SKL8_NEMVE  ali  13  31........................................................ATTTAHSVKGDEDDDYMKTTHMSFEWEQSFNDHEMQAMNEQFVSTRSQRIRQAMFPETLEEGAQIPSTQFDSTSSTAVQRLAEPSLMLKQAVVNLINYQDDADLATRAIPELAKLL--NDDDQVVVGQAAMMVHQLSRKDASRHAI--MNSPQMVAALVRALNNMSDVETTRCAAGTLHNLSHHRQGLLSIFKSGGIPALVKLL-GSQVEAVVFYAITTLHNLLLHQEGAKMAVLAGGLQKMVALLGR.................. 274
436 1.000e-07UniRef50_A0A061SDB7 Vacuolar protein 8 (Fragment) n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061SDB7_9CHLO  ali  17  146...............................................................................................................................VRILHESEFGGKESAAGALGNLACNDDNKVLVAEAGGIEPLVSLLQ--DGPISGRESAAGALWNLAMNEDNRVAIPQADGIRPLVELLGDISTEAG---KEASAVCLWNLACNADNRVLIAAESAIPALVRLLSHGES-KVRKAACGALGKLALLGENRKEIHRHQG............................ 306
437 1.000e-07UniRef50_UPI000B913AC8 vacuolar protein 8-like n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B913AC8  ali  11  72.......................................................................................................................................SRNDDLQRSAALCLAEISERLLHPINNKVMEPLLTLMESRDIETQKAASLALSNLALHGHDVNKEVIMRSGALQLLIKLLR----SPNEEIQCNVCGCITTLATTDANKKEIVSCGGVPPLINLARSPDM-RVKRNATGALLNLTHIDSTRTVLVSHGAVPLFV--ASLHSDDSEIQ.......... 241
438 1.000e-07UniRef50_A0A1D2JIV2 Vacuolar protein 8 n=6 Tax=Pezizomycotina TaxID=147538 RepID=A0A1D2JIV2_PARBR  ali  15  106....................................................................................................NRETLEPILFLLQSPDIEVQRAASAALGNLAVNTENKVNIVLLGGLAPLIRQMMSPNVEVQCNAVGCITNLRLARSKDMRVQRNATGALLNMTHSDENRQQLVIAGAIPVLVQLL----SSPDVDVQYYCTTALSNIAVDAENRKRLAESRLIQSLVQLM-DSSTPKVQCQAALALRNLASDEKYQLEIVRARGLAPLLRLLQSSY................ 328
439 2.000e-07UniRef50_L7JUU4 Vacuolar H+-ATPase V1 sector, subunit H n=2 Tax=Pleistophoridae TaxID=35232 RepID=L7JUU4_TRAHO  ali  26  186................................................................................................................................................................................................................................NVQYNASIILWYVSFSKETIEYFE--LIVPHLLHLLKTRECEKMVRTTFFIIRNLLKNGFFFSLVTCHDIINDTANM---KYEDEELKSTIDQVARVL 278
440 2.000e-07UniRef50_UPI00093E26B8 armadillo repeat-containing protein 4 isoform X1 n=10 Tax=Amniota TaxID=32524 RepID=UPI00093E26B8  ali  17  70..............................................................................................................................................................................DSPDTDLKCLAAETIANVARFKRARSTVRHYGGIKRLVGLLDCMSVRSTSLIPYQAALALWSCSKSTKNKEAIRKAGGIPLLAKWLKSSHVDILTPV-VGILQECASEPSYRLAIRTEGMINLVKNLSSEH---EELQ.......... 213
441 2.000e-07UniRef50_A0A1S4E9R6 armadillo repeat-containing protein 4 n=7 Tax=Neoptera TaxID=33340 RepID=A0A1S4E9R6_DIACI  ali  14  124......................................................................DVPQQVLTVAWDDLDADKKEMVYVVRGSIK---ALWSLSQCRKNKEAMRKAGVVKILARLLRCAHEDIIAPTLGTIQQCATEKNYQLAIQTEGMICDLV-KFLSSSNEEIKKYCASAIFKCAAADEVTRSLVREHGGLDPLVSIIKNEKNRQNKPLLAAATGAIWKSAMNQENVRRLDELKTVNVLIHLLED-EDEEVLTNVVGALGECAKVSSNRDAIKRYNGIQPLVNLL--NLTNPELLENVTKVL... 365
442 2.000e-07UniRef50_Q6FJV1 Vacuolar protein 8 n=47 Tax=Dikarya TaxID=451864 RepID=VAC8_CANGA  ali  16  20................................................ITDNEREAVTLLLGYLEDKDRLDLKALTTLVYSDNLNLQRSAALAFAEVTEKSRDVLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVDMGGLEPLINQMMGTNVEVQCNAVGCITNLKLAKSKHIRVQRNATGALLNMTHSEENRRELVNAGAVPVLVSLL----SSNDPDVQYYCTTALSNIAVDEANRKKLAQTRLVSKLVSLM-DSPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVNLIQS.................. 303
443 2.000e-07UniRef50_A0A1E3QC14 Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QC14_LIPST  ali  19  23.YLDEIVENIRSRTGTWSRHVGADGLTDEQATTIAYIDKLPKRSKLEALSKDPSFYANIFCTIFTRITRVDVLQSALALAADLIPGRFLYSIDMLRGSLSTCDDYK........................................................................................................................................................................................................................ 127
444 3.000e-07UniRef50_A0A0G4GUW6 Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4GUW6_9ALVE  ali  12  192..........................................................................................................................VALLASPLSTAGVRQAAATAIQYLALSVENGERIADAGGIPLLISLLTGGMP-----NEKESAAWALCSLASNSESRERIVAAGGIPPLVRMLSNFLFTSRPNQAAAAAAALHNLTLSDENGERIAAAGGIPPLVSLL-TFGTPDTKASAAGTLWRLASIAENRETIAAANGIPPLVVLLT---TDP............. 370
445 3.000e-07UniRef50_I7ANS6 Vacuolar H+-ATPase V1 sector subunit H n=6 Tax=Microsporidia TaxID=6029 RepID=I7ANS6_ENCRO  ali  19  3....................................LERLEAKTRDSLPPEVISKSVDRFKEIKSHGDRKE-VSAFLG------KENSGASILLSHPDLLDED---ELIDLLFCSDIYSRYKSAEMLTKLYENKSHRKEYFSFFKQMLKDSTSYDESNYLLSLLIDFLS--CKSNSNFDVEKRKVALVTNKMFMEILHTSVFVK--------------------EVQYNTLMVILIFSYSTECVGKMGT--LIDDVVIIVKEKAREKILRVCYGIIANVLESGYVFSPGRLNDISKCTDLLLEGGYGDEELEQDLKKVRAR. 253
446 3.000e-07UniRef50_O44326 Beta-catenin-like protein hmp-2 n=17 Tax=Rhabditida TaxID=6236 RepID=HMP2_CAEEL  ali  14  160.....................................................................................................................FRSGGLAEIIRMLYDSLESVVHYAVTTLRNLLMHVSDSRAQARALNAVEALTPH-LHKTNPKLLAQVADGLYFLLIDDAPSKITFLSLLGPQILVSILR--EYSDHRKLIYTVVRCIRSLSVCPSNKPALISLGCLPALYVELCTAKDERSQTAILVAMRNLSDSATNEENLTQL-IIKLLEIIR.................... 340
447 3.000e-07UniRef50_A0A2P8Y436 Uncharacterized protein n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8Y436_BLAGE  ali  14  367.........................................................................QTGYDELDPSLIPPRQDHYRITPSPGGPVDRYDQITHPWNIDDEPSQLPHGEDPKLVYGYAPPSPYGTVPAAYGSNGADPRTYEEEDDEELRKHLSMHPSIPSPSVDDEQRAEICTKLTSHVLGMR---WRDPN---LTEVIGFLNNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVMLLSH-ESPDVYRNACGALRNLSYNDENKRAIKNAGGIPSLINLL-RKSSDAEVKELVTGVLWNL 621
448 3.000e-07UniRef50_UPI000C1CE465 protein ARABIDILLO 1 n=1 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1CE465  ali  17  3......................................................................................................................................................................................................................LARSCSNASHSLQERAAGALWGLSVSEANSIAIGQEGGVAPLIALAR-SDAEDVHETAAGALWNLAFNSDNALRIVEEGGVP.......................... 83
449 3.000e-07UniRef50_A0A060VZX1 Uncharacterized protein n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060VZX1_ONCMY  ali  14  255......................................................................................................NPLSQTHHYHGAPDGAVQNQAMSRAQML-----QFPHKRCSMVSLDSIRKDPRWRDPNLREVITMLS------HPMDPVKSNAAAYLQHLCYENDHKQDVRQLKGVPVLVGLLDHPK----AEVHRKACGALRNISYDHHNKVAIKNCDGIPALVRLLRKSSNMEVRELVTGTLWNLSSHEPLKMMIINHGLQTLTD....................... 439
450 3.000e-07UniRef50_A0A075A4A4 Uncharacterized protein n=1 Tax=Opisthorchis viverrini TaxID=6198 RepID=A0A075A4A4_9TREM  ali  18  230..............................................................................................MRLSVSHEHSLVCFNGSPRCTNHHTTLRSSFFMTGYLSERTLIQQTSIVYRDEMHCSRFNEPTLKFNVCLLESLRSQVQLPQSRQILANRALRCCSMSARNPSPPPDFWLFSLLMDLLKLVRDEPLGSDDAVIEEELCCLWDLTVNRDVVPYLEEFGVIAILTDVLLCQRYPRLLEIGVGILTNMACNSSVCQQMSDNELL........................... 461
451 3.000e-07UniRef50_A0A0F4X541 V-type proton ATPase subunit H n=5 Tax=Hanseniaspora TaxID=29832 RepID=A0A0F4X541_HANUV  ali  15  150.........................................................................................................NYTIKQKTKMDDVEEFLTAVYFPLLQSLANKNAQNADISTSTVRKLYLMIRSAEQLVSLRTDYKNTFKYDNQFSSALFDVIIFNKYYFNINTINQQSLSGMFNNTIRSAAALPPTNSSVQLQYYTLLLVWVLTFEKSYCVTLTTKYYALQLLKLVNTSTKVKVTRVALGILQQLIIYVPSFKVLVYENSDMILNNLSNRNLPDEEMNESLSYILNQ. 371
452 3.000e-07UniRef50_D8RVS0 Ubiquitin-protein ligase, PUB17 n=3 Tax=Embryophyta TaxID=3193 RepID=D8RVS0_SELML  ali  13  380....................................................................................................................EATKLTAAFLVGKLASGPPEVQKQVAYELRLLAKCGTDNRVCIAEAGAIPFLVPLLSSRDAKT--QENAITAILNLSICDANKKLIVSAGAVDPI---LAVLKSGSTVESRENAAATLFSLSVVDEYKVLISKSETFTSLIALLREGSSARGKRDAATALFNLAVYHGNKGRIIAAGAVPLLVELLT---EDADITDD........ 570
453 3.000e-07UniRef50_A0A1J1J1N0 CLUMA_CG017829, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1J1N0_9DIPT  ali  19  360.................................................................................................................SSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLDNLLQGLVHVLA--SSDVNVVTCAAGILSNLCNNQRNKTTVCQVGGVEALVRTIINAGDREEI--TEPAVCALRHLTQESDAAQNLVRNYGLPVIVKLLHPPSRWPLVKAVIGLIRNLAICPSNSAPLREHGAIHHLVRLLIRAFQD.............. 555
454 3.000e-07UniRef50_E0VL50 Armadillo segment polarity protein, putative n=16 Tax=Pancrustacea TaxID=197562 RepID=E0VL50_PEDHC  ali  17  334..............................................................................................................................MQALAMHLGHHSQSLVQNCLWTLRNLSDAGTKVDGLEGLLQSLVQLLSSTDVNVVTCAADILRNLTCNNQRNKVTVCQVNGVEALVRTIVNAGDRE--EITEPAVCALRHLTSSERAQNAVRHNYGIQVIVKLLHPPSRWPLVKAVIGLIRNLALCPANHAPLREHGAIHHLVRLLTRAFQD.............. 517
455 3.000e-07UniRef50_G4YE00 Uncharacterized protein (Fragment) n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4YE00_PHYSP  ali  13  681........................................SADSRRLIVEIGGLQIAVELLRVGSDVQREQSARVLACLSLDIPPIMELLRFGISEQKEQAAKVLVNLTLYERSRDLGAREGVIPPCVELLRYGNEKLKEYAALVLANLAHSAKDRCAIAESGAIAFLVSLLRGGTPS--QRESAVWALANLSVDKKNRSLIAAAGGIAALKALLQSGTDN----QKGQTARALTNLTLDQGCREEIAREGCIPVFVGLLR-SGDEKPKEQTVRALTNMAVSQSHRRRMIQAGCVACFVGLL.................... 947
456 3.000e-07UniRef50_A0A2M3ZGW6 Putative armadillo/beta-catenin/plakoglobin (Fragment) n=5 Tax=Pancrustacea TaxID=197562 RepID=A0A2M3ZGW6_9DIPT  ali  15  33..............................................................................................................................................................................NDEDQVVVSQAAMMVHQLSKKEASRHAI--MNSPQMVAALVRALSNSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGGIPALVKLL-SSPVESVLFYAITTLHNLLLHQDGSKMAVLAGGLQKMVALLQRN................. 161
457 3.000e-07UniRef50_K1QWZ8 Catenin beta n=20 Tax=Bilateria TaxID=33213 RepID=K1QWZ8_CRAGI  ali  14  187..............................................................................................................................................................................NDEDQVVVGQAAMMVHQLSKKEASRHAI--MNSPQMVAALVKAMNNTSDLETTRCAAGTLHNLSHHRQGLLAIFKSGGIPALVKLL-SSPVESVLFYAITTLHNLLLHQEGSKMAVLAGGLQKMVALLQRN................. 315
458 3.000e-07UniRef50_UPI0009752871 catenin beta-like isoform X1 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI0009752871  ali  14  187..............................................................................................................................................................................NDEDQVVVGQAAMMVHQLSKKEASRHAI--MNSPQMVAALVKAMNNTSDLETTRCAAGTLHNLSHHRQGLLAIFKSGGIPALVKLL-SSPVESVLFYAITTLHNLLLHQEGSKMAVLAGGLQKMVALLQRN................. 315
459 4.000e-07UniRef50_A0A1D2N7L9 Catenin delta-2 n=4 Tax=Entomobryomorpha TaxID=730330 RepID=A0A1D2N7L9_ORCCI  ali  12  476.......................................................................................................PPPPNNSFMLSNNKHF-HPAATSSNSILNDDHEPSPSNSNQHLTVSAGTSSPGVRWRDPDLHEVIQFL---GNPNPVVKANAAAYLQHLCYMDDPVKAKTRALGGIPP---LVALLNNDQPEVHRNSCGALRNLSYNDENKKAIKSAGGIPALVRLLKRTADNEVKELVTGVLWNLSSCEELKKAIIDDAMVALVNIV..................... 669
460 4.000e-07UniRef50_A0A2K6L8U3 Armadillo repeat containing 4 n=1 Tax=Rhinopithecus bieti TaxID=61621 RepID=A0A2K6L8U3_RHIBE  ali  11  143.........................................................................YWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCHKSHTNKEAIRKAGGILLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLV--KNLSSENEELQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAA---VTGAIWKCSISKENVTKFREYKVIETLVG-LSTDQPEEVLVNVVGALGECCQEHENRVIVRKCGGIQPLVNLL.................... 366
461 4.000e-07UniRef50_A0A287FPP4 Uncharacterized protein n=2 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287FPP4_HORVV  ali  15  576......................................................................................................................VTLARSCKLEGVLEQAARALANLAAHGDNNNNNAAVGQEAGALEALVQLTC------SQNEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALGFTCTTMSECFGRPSGESCWRIMGTICFRIEQSIAIGQEGGVAPLLTMAQ-SEVEDVHETAAGALWNLAFYSSNAQRIVEEGGVPILVHLCSS.................. 754
462 4.000e-07UniRef50_A9RX18 Predicted protein n=3 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A9RX18_PHYPA  ali  13  35...............................................................................................................LEIEEGYVSIFVRML--SLNNPVEDREAGVLALWRHSAAGADKVKEIVMFPGCLNLVVALL--PSEREATAEAAAGLLRNISAIEEYRSLVAEAGTLEEIAGLLT--RHKRSPEVRKQALSVLWNVSLNERERNKLADLELLPALLAIVDDFHQESEKEAAIGVLATLSYSPCNHEMLIRAGVIPRLARIL.................... 237
463 4.000e-07UniRef50_A0A1Y2I509 Armadillo-type protein n=4 Tax=Opisthokonta TaxID=33154 RepID=A0A1Y2I509_9FUNG  ali  15  308.........................................................................QWQIQKLVKYLKAGNQTATIIAICSLRDYDLLNENNQLAIRN----VGGLDILVNLLDTDDPKCKIGSLSILNQISNNYVIRKAIAALDGMRPLVDLLH---DDHVDVKCLAAETIANCAKYAKNRRMVRKFSGIRSLVSLLHPEPSNPDSERIASGALALWTCSKSQRNKEAIRLAGSIPLLAELLK-SPNEKLLIPVVGILQECASDEQYRAAIRSSGMIKFLENLSSQN................. 533
464 4.000e-07UniRef50_G3AER7 Uncharacterized protein (Fragment) n=6 Tax=saccharomyceta TaxID=716545 RepID=G3AER7_SPAPN  ali  13  70...........................................................................................................MTHSGENRQELVNAGAVPVLVSLLSNDDADVQYYCTTALSNIAVDEVNRKKSTEPKLVGQLVNLMDSPSPR--VQCQATLALRNLASDSGYQVEIVRSGGLPHLVQLLTCNHQPLVLA----AVACIRNISIHPLNEALIIEAGFLKPLVGLLDYNESEEIQCHAVSTLRNLAASSENRTALLAAGAVDKCKEL..................... 260
465 5.000e-07UniRef50_A0A183J6D6 Uncharacterized protein n=2 Tax=Ecdysozoa TaxID=1206794 RepID=A0A183J6D6_9BILA  ali  29  65....................................................................................................................................................................................................................................................................HKSTKEKVTRIIMAIFRNLLEKPENAIQMVQCQVYKTLELIMSKAYDDPEFNEDTQFVTEQL 133
466 5.000e-07UniRef50_A0A1Q9DNI7 Ankyrin-1 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9DNI7_SYMMI  ali  17 1173............................................................................................................................................................................KLRGADVEAQEQAARKLANLGSDSDNKASIAAAGAIPPLVELLR----SRTPEVQAAAEEALWLLAFNTDNQALIAKAGGIPPLVELLSSSNS-AVQQEAVGALRQLALSADNKALIAEAGGIPPLVSCLKS.................. 1301
467 5.000e-07UniRef50_A0A059F3T7 Uncharacterized protein (Fragment) n=3 Tax=Anncaliia algerae TaxID=723287 RepID=A0A059F3T7_9MICR  ali  19  54..............................................................................................FAYKLKEEKYEEYLLRLLEYNDVYIQFKSCEILTYIYERKIPSKEYLVFINKFLINSFCYKELNQILNFIIKIINNLKNDKIKEDYLNDS---SFINLVSTYILRREL------------------------QYNGLLIIWILSFDNTL-EIFDKFNLIEVLPKVISERNKEKVLRVCFGLLSNLYKTDFRYNACITNELLKKIDICLGNTL-DIEFIGYLTEVKEK. 251
468 5.000e-07UniRef50_A0A2P4J868 RING-type E3 ubiquitin transferase n=29 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P4J868_QUESU  ali  14  256.....................................DNSPNKSLDEIKKLDPIAIPDDFLCPISLELMRDPV--------IVATGQTYERSFIQRWIDSGNATCPKTQQKLEN---FTLTPNYALRSLIAQWCAKHNIEQPTGLTNGKIKKSDGSFRDVSGDIAAIRALVRKLSSRSVEEHRTAAAEIRSLSRSTDNRILIAESGGIPILVNLLT----SEDVLTQENAVTSILNLSIYENNKGLIMLAGAIPSIVQVLRNGSMEA-RENAAATLFSLSLGDENKIIIGASGAIPALVVLLQ................... 506