Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF04210.13; Q12VV0_METBU/7-70; Tetrahydromethanopterin S-methyltransferase, subunit G , from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# E-value Template Links and tools%idFirst TTPSVVTDPVDFNEVLEKLNLIDEKIEFVNSEIAQRIGKKLGRDIGIMYGAVAGILIFLIYISLLast
1 2.000e-14UniRef50_A0A151BEA4 Tetrahydromethanopterin S-methyltransferase, subunit G n=1 Tax=Candidatus Bathyarchaeota archaeon B25 TaxID=1779369 RepID=A0A151B  ali  46  10TVPAVMTPP-EISELTERLETVDGKIEFVLGELALRRGLKVGTWTGILYGFTIGICIFLKFV.. 72
2 5.000e-14UniRef50_A0A1V5Z7M0 Tetrahydromethanopterin S-methyltransferase subunit G n=3 Tax=Euryarchaeota TaxID=28890 RepID=A0A1V5Z7M0_9EURY  ali  53  23..........QFLEIESKLDEIETKLEFVEGEIAQRVGRKVGRDIGILYGVVAGLMTYIIVTEL 76
3 4.000e-11UniRef50_P80656 Tetrahydromethanopterin S-methyltransferase subunit G n=51 Tax=Euryarchaeota TaxID=28890 RepID=MTRG_METMA  ali  61  4KAPAAFVEPGEFNEVMKRLDQIDEKVEFVNSEVAQRIGKKVGRD.................... 47
4 2.000e-10UniRef50_D5E7Y9 Tetrahydromethanopterin S-methyltransferase subunit G n=22 Tax=Methanosarcinales TaxID=94695 RepID=D5E7Y9_METMS  ali  67  10.IPAVVVDSEDFDKILKKLNDIDEKIEFANSEITQKIGKKVGRD.................... 52
5 3.000e-10UniRef50_O32868 Tetrahydromethanopterin S-methyltransferase subunit G n=2 Tax=Methanopyrus TaxID=2319 RepID=MTRG_METKA  ali  36  6SVPKMVAPEDDIREIHSRLDEIERRLDFVWGEVYQRFGKRIGRD.................... 49
6 7.000e-10UniRef50_A0A1D2WB10 Tetrahydromethanopterin S-methyltransferase subunit G n=4 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A1D2WB10_9EURY  ali  41  9.IPTVIVPSDDFNKANERLDDMEEKVEFTWGEISQRMGQQ........................ 47
7 3.000e-09UniRef50_H8I4E1 Tetrahydromethanopterin S-methyltransferase subunit G n=4 Tax=Methanocella TaxID=570266 RepID=H8I4E1_METCZ  ali  46  2.IPAASVDPQEFSAVQKRLDVIEEKVEFTNAEIQQSEGRKLGRE.................... 44
8 1.000e-08UniRef50_Q50774 Tetrahydromethanopterin S-methyltransferase subunit G n=48 Tax=cellular organisms TaxID=131567 RepID=MTRG_METTM  ali  46  8TIPRVLVSADEFNKANEKLDEIEEKVEFTVGEYSQRIGQQIGR..................... 50
9 2.000e-07UniRef50_A0A1V4TN44 Multifunctional fusion protein n=22 Tax=root TaxID=1 RepID=A0A1V4TN44_9EURY  ali  54  185..........QFLEIEKRLDKIEKKIEFVDAEIAQRVGRKIGR..................... 217
10 5.000e-07UniRef50_A0A1V4YVZ3 Tetrahydromethanopterin S-methyltransferase subunit G n=1 Tax=Methanocella sp. PtaU1.Bin125 TaxID=1811677 RepID=A0A1V4YVZ3_9EURY  ali  51  42.....VIDPKDYTAAIKRINDIEEKVEFVASEIQQSEGKHLGRE.................... 80
11 1.000e-06UniRef50_A2STR2 Multifunctional fusion protein n=2 Tax=Methanocorpusculum TaxID=2192 RepID=A2STR2_METLZ  ali  48  186..........QFLEIEKRLDAIEQKIEFTDAEIAMRVGRKIGR..................... 218
12 2.000e-06UniRef50_A0A2P0QM85 N5-methyltetrahydromethanopterin-coenzyme M methyltransferase subunit G (Fragment) n=2 Tax=uncultured archaeon TaxID=115547 RepID  ali  50  66..........QFLEIEKRLNKIEKRLEFVDAEVAQRVGRKIGRD.................... 99
13 5.000e-06UniRef50_A0A1M4MNB7 Tetrahydromethanopterin S-methyltransferase subunit G n=4 Tax=Euryarchaeota TaxID=28890 RepID=A0A1M4MNB7_9EURY  ali  60  45..........QFLEIEERLNAIEERIEFVDAEIAQRVGRKVGR..................... 77
14 1.000e-05UniRef50_A0A2I0PE71 Tetrahydromethanopterin S-methyltransferase subunit G (Fragment) n=2 Tax=unclassified Methanomicrobiales (miscellaneous) TaxID=38  ali  51  107..........QFLEIEKRLDKIEKNIEFVDAEIAQRVGRKIGR..................... 139
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.