current user: public

If you have questions about the server, please let us know.

Query: PF07837.12; R6RB74_9CLOT/5-181; Formiminotransferase domain, N-terminal subdomain, from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# E-value Template Links and tools%idFirst LIECVPNYSEGRDLEKIEKIVECFRAKKGVRLLDYQTDPNHNRLVVTVIGEPEPLRDAVVASFGRAVELIDMTKHEGQHPRMGAVDVVPFIPCRNATLEEADALAKEVAKTVGEQYGIPCFLYESSATAPHRANLASIRKGQFEGMAEKMQDTEKWAPDFGPAAPHPTAGVSAVGARLast
1 2.000e-69UniRef50_A5IIU0 Glutamate formiminotransferase n=53 Tax=Bacteria TaxID=2 RepID=A5IIU0_THEP1  ali  53  3LIESVPNFSEGRRKEVVEKIVAEAKKYDRVWVLDWSMDADHNRSVVTLVGEPENLINALFDMTKKAAELIDLRNHTGQHPRMGAADVIPLVPLYNTTMEECVEYSKILGRRIGEELGIPVYLYEKSATRPERQNLADIRRGEFEGFFEKIKDPLW-KPDFGPDRVHPTAGVTAVGAR 178
2 2.000e-69UniRef50_A0A1W9PP28 Glutamate formimidoyltransferase n=1 Tax=candidate division KSB1 bacterium 4484_219 TaxID=1968530 RepID=A0A1W9PP28_9BACT  ali  50  4IVECVPNFSEGRDQTVIKAISREIETTEGVKLLDVDPGADTNRTVITFIGTPEGVKEAAFRAIRKAAELIDMTKHHGEHPRIGAADVCPFVPVSGVTMADCVKLAHELGKRVGEELGVPVYLYEEAATKPERRNLADIRKGEYEGLAEKLKDP-AWQPDFGPAEFNPKFGAAIIGAR 179
3 4.000e-69UniRef50_B0KCB8 Glutamate formiminotransferase n=121 Tax=cellular organisms TaxID=131567 RepID=B0KCB8_THEP3  ali  49  4IIECVPNFSEGRDQEKIAQLVKEVVSTEGVKLLDYSSDKDHNRTVITFCGDAKGVKEAAFKLIKKASEIIDMRYHKGEHPRIGATDVVPFIPVKNATMEECIQIAREVGEKVGRELSIPVYLYEEAATTPERKNLENIRRGEYEGFFEKIKQPEW-KPDFGPQEMNPKSGATVIGAR 179
4 2.000e-68UniRef50_A0A1V6KJ32 Methenyltetrahydrofolate cyclohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V6KJ32_9SPIR  ali  45  5LVECVPNFSEGRDRAKIEAIADAIRSVQGVFLLDVDPGVDTNRTVYTFIGPPEAVKEAALEAARVAFKLIDMRTHRGAHPRIGALDVCPFVPVSGVSMEECIEISRDFGKKLSEELNVPVYLYEKSATRPERRSLADIRAGEYEGLENKLADP-AWQPDFGPTHFTPRWGATVTGAR 180
5 2.000e-68UniRef50_A0A1W9QP66 Glutamate formimidoyltransferase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1W9QP66_9BACT  ali  48  3IIECVPNFSEGRDRKILDAIAASIKAVKGVTLLDVDPGADTNRTVFTFVGEPDPVIEAAFQAIKKAAELIDMSKHKGAHPRMGATDVCPFVPVSEVTMEECVEYAHRLGKRVGEELEIPVYFYEYAATKPEWKNLAEVRKGEYEALPEKMKDP-YWKPDFGPQKFNAKAGATAISAR 178
6 4.000e-68UniRef50_A0A0S8I5Q6 Formiminotransferase-cyclodeaminase (Fragment) n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8I5Q6_9BACT  ali  48  5LVECVPNFSEGRNKDIIKQITDMIEAVDGVSLLDVDPGPDMNRTVVTFIGTPEGVKEAAFQAIKKASELIDMSTHHGSHPRMGATDVCPFVPVTGVTTDECIEFSKEVARRVGGELGIPVYLYEKSAQKPERENLAVIRQGEYEALPEKLKKPEW-KPDFGPAEFNAKAGATVIGVR 180
7 7.000e-68UniRef50_H1XW57 Glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase n=5 Tax=Bacteria TaxID=2 RepID=H1XW57_9BACT  ali  52  5LVECVPNFSEGRNMDVINQITSEIKSVEGVRLLDVDPGAEMNRTVVTFVGSPEGVKEAAFRAIKKAAELIDMRKHKGSHPRMGATDVCPFVPVSGITVEECVELSKEVARRVGEELGIPVYLYEKSATRPERQNLAIIRQGEYEGLAEKLKDPEW-KPDFGPAEFNPQAGATVIGVR 180
8 1.000e-67UniRef50_A0A2H6EXB8 Methenyltetrahydrofolate cyclohydrolase n=20 Tax=Bacteria TaxID=2 RepID=A0A2H6EXB8_9BACT  ali  46  4IVECVPNFSEGRDRSIIEAIAAEVSSTENILLLDVDPGKATNRTVFTFIGSPEGVKEAAFKAIKKASELIDMQKQTGEHPRIGAADVVPFVPVSGVTMEDCVQLAHDLGQRVGEELHIPVYLYEEAATQPERRNLADIRKGEYESLPEKLKDP-HWKPDYGPAEFNPRTGATVIGAR 179
9 2.000e-67UniRef50_A0A1Q9NZP4 Uncharacterized protein n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NZP4_9ARCH  ali  50  4LVECVPNISDGQNQEVIQAVLDAMTAIPGVTLLDHESDKDHNRSVITIIGKPDAVSNGAFECIKKASELIDLTKHKGEHPRMGATDVCPFIPIKDVTMEECVELAKALAKKVAEELKIPVYLYEEAATRPNRQNLAVVRKGQFEGIRDEIKTNPDRKPDFGPNDVHPTAGIMAIGAR 180
10 2.000e-67UniRef50_A0A1V4QGN2 Glutamate formimidoyltransferase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1V4QGN2_9BACT  ali  53  4IIECIPNFSEGRDQEKIEKIVAEIRSA-GVELLDQEMDPDHNRAVITFVGTPDAVLEAAFRGTKKAAELIDLTKHKGEHPRIGATDVIPFVPISNATTLECVELAKRLGKRIAEELKIPVYLYEAAATRPERQNLANIRKGEFEGLREEIETNPDRYPDFGEPKIHPTAGATVVGAR 179
11 8.000e-67UniRef50_A0A0S7YHG5 Uncharacterized protein n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0S7YHG5_9BACT  ali  50  4IVECIPNFSEGRDQSKIDQILDAIQSA-GVQLLDQEKDPDHNRAVVTFVGEPDAVLEAAFRGIKKASELIDLTKHKGEHPRMGATDVVPFVPITNVTTRECVEMARRLGKRVAEELKIPIYLYEAAATRPDRENLANIRKGEFEGLRDEIETNPVRQPDFGEPKIHPTAGATVIGAR 179
12 1.000e-66UniRef50_B0VF35 Formimidoyltransferase-cyclodeaminase (Formiminotransferase-cyclodeaminase) (FTCD) n=27 Tax=Bacteria TaxID=2 RepID=B0VF35_CLOAI  ali  47  3LMECVPNFSEGRDKTILDAIATAIKNVKGVALLDIDPGADTNRTVFTMAGEPEAVVEAAFQAIKKAAELIDMSKHKGAHPRMGATDVCPFIPISEMTMDECVEYAKQLGKRVGEELGIPVYLYEYAATKEEWRNLSNIRNGEYEALPEKAKDP-YWKPDFGPHTFNAKSGATAIGAR 178
13 1.000e-66UniRef50_A0A2H6EAR5 Methenyltetrahydrofolate cyclohydrolase n=20 Tax=Bacteria TaxID=2 RepID=A0A2H6EAR5_9BACT  ali  50  5LVECVPNFSEGRNKEVIKQITDEIEKVEGVKLLDVDPGSDMNRTVVTFIGAPEGVKEAAFNAIKKASELIDMHTHKGSHPRMGATDVCPFVPVSGITTEECIELSKDVARRVGEELGIPVYLYEKSAQMPERENLAIIRQGEYEALEEKLKKPEW-KPDFGPAEFNATAGATVIGVR 180
14 2.000e-66UniRef50_F8WWD2 Glutamate formiminotransferase n=7 Tax=Bacteria TaxID=2 RepID=F8WWD2_9BACT  ali  65  6IIECVPNFSEGRDLEKVEKIVNAFRAKEGVKLLDYSTDKDHNRMVVTVVGEPNALKKAVIEAIGIAVQVIDLNHHKGQHPRMGAVDVVPFIPIRNVSMEEAVNLSKEVGQEVAERYGLPVFLYEKAASAPHRENLATIRKGEFEGLKEKMTLPEW-KPDFGPDQPHPTAGGVVIGAR 181
15 2.000e-66UniRef50_A0A2H0XM26 Glutamate formimidoyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H0XM26_9BACT  ali  45  3LVECVPNFSEGRNRNVIKAITDEIESVEGATLLDVDPGKATNRTVVTFAGTPEAVVKAAFQAIKKAKELIDMSGHMGEHPRMGATDVCPLVPISGITIEECVELAHKLAKRVGEELKIPVYFYEYAATSPQRKSLADIRKGEYEGLKDKLKDPNWV-PDYGPASFDKKAGATVIGVR 178
16 3.000e-66UniRef50_UPI00055271B7 glutamate formimidoyltransferase n=1 Tax=Caldanaerobius polysaccharolyticus TaxID=44256 RepID=UPI00055271B7  ali  46  5VVECVPNFSEGRNKDVMDAIASAIKATDDVKLLDYSGDPDHNRSVYTFVGKPEAVVKAAFNACKVAVQLIDMSKHTGEHPRMGAADVVPFIPISNVSVQECVQLAKRLGELIGKELFVPVYLYGYAATRLERVDLSEIRKGQYEGFFDKIKSPQW-TPDFGPSEVNVKSGVTAVGVR 180
17 5.000e-66UniRef50_A0A2M7WFS3 Glutamate formimidoyltransferase n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID  ali  47  4IVECVPNFSEGRRPEILDKIIEAALTIDGVTLLDREMDADHNRAVVTFIGEPQSVKKAAYLAIEKAANLIDMEKHSGEHPRMGATDVCPFVPVSGVSMADCVLLAEELGAEVGSKLQIPVFLYEKAARRPDRENLADVRKGEYEGIKATIESDDSRIPDFGPRKVHPSAGAIAIGAR 180
18 7.000e-66UniRef50_A0A2G6K8X1 Glutamate formimidoyltransferase n=1 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6K8X1_9BACT  ali  52  4IVECVPNFSEGRRPEVIEAIVEEVQTSSDVFLLGKEMDADHNRAVITLAGEPEAVKGTVFRMIKKASELIDLTNHTGEHPRMGATDVVPFIPIENVTVEECIRLAQELGQRVGDELQIPVFLYEDAATRPERKNLAKVRKGQFEGLRDQIGVNPKKEPDYGPDHIHPTAGATAIGAR 180
19 8.000e-66UniRef50_A0A1V6E0X5 Methenyltetrahydrofolate cyclohydrolase n=1 Tax=Spirochaetes bacterium ADurb.Bin110 TaxID=1852908 RepID=A0A1V6E0X5_9SPIR  ali  46  5LLECVPNFSEGRDHAKIEAIANAIRSVQGVFLLDIDPGADTNRTVYTFIGPPEAVKEAALKAARVAYELIDMRTHHGAHPRIGALDVCPFIPVSGISMEECVSISKDFGKKLSEELNVPVYLYEKSATCPERQSLADIRAGEYEGLEAKLSDPVW-QPDFGPARFNARWGATVTGAR 180
20 1.000e-65UniRef50_B5IFL6 Glutamate formiminotransferase, putative n=28 Tax=root TaxID=1 RepID=B5IFL6_ACIB4  ali  48  4IVECVPNFSEGRNMKVIEEIVNAIKEVEDVYVLDVDPGEATNRTVVTFVGTPEAVKEAAFRGIKKAAELIDMRYHHGAHPRMGATDVCPFVPVKGVTMEDCVKIAEEVGKRVGEELGIPVYLYEYAAKEDYRRNLADIRAGEYEGLPEKLKD-EKWKPDFGPAKWNAKTGATVIGAR 182
21 1.000e-65UniRef50_A0A2I8AJU6 Glutamate formimidoyltransferase n=745 Tax=root TaxID=1 RepID=A0A2I8AJU6_9STRE  ali  51  4IVECIPNFSEGRNQDVIDGLVKTAKSVAGVTLLDYSSDASHNRSVFTLVGDEESIQEVAFRLIKFASKNIDMTKHQGEHPRMGATDVCPFVPIKEITTEECVEISKKVAQRVNSELNIPIFLYEESASRPERQNLAKVRKGQFEGMPEKLLE-EDWAPDFGERKIHPTAGVTAIGAR 179
22 6.000e-65UniRef50_A0A1V6DM47 Methenyltetrahydrofolate cyclohydrolase n=6 Tax=Bacteria TaxID=2 RepID=A0A1V6DM47_9BACT  ali  46  3LMECVPNFSEGRDKTVLEAIASAIRSVKNAVLLDVDPGADTNRTVFTLAGEPEAVVEAAFQAIKKASELIDMSKHHGEHPRMGATDVCPFIPISGMTMEECAEYARKLGKRVGEELGIPVYLYENAASKEEWRNLANVRSGEYEALPQK-AQDPAWKPDFGPHAFNPRSGATAISAR 178
23 9.000e-65UniRef50_A0A1F2RG61 Glutamate formimidoyltransferase n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 TaxID=1797186 RepID=A0A1F2RG61_9BACT :  ali  43  5.VECVPNFSEGRDRWKLEQIISAIRSVSGNWILDLHMDPDHNRSVITFAGNPDSVGEAALRAVGEAVRLIDLSQHKGEHPRIGAADVVPFVPLLGVSMEECIRIAHQTGMEIWNRYGVPVYFYEAAALRPEHRNLAEIRHGSLEELKNEVLDNPARQPDVGGPQLHSTAGATAVGAR 180
24 9.000e-65UniRef50_Q99XR4 Glutamate formimidoyltransferase n=80 Tax=Bacteria TaxID=2 RepID=GLFT_STRP1  ali  51  4IVECIPNFSEGQNQAVIDGLVATAKSIPGVTLLDYSSDASHNRSVFTLVGDDQSIQEAAFQLVKYASENIDMTKHHGEHPRMGATDVCPFVPIKDITTQECVEISKQVAERINRELGIPIFLYEDSATRPERQNLAKVRKGQFEGMPEKLLE-EDWAPDYGDRKIHPTAGVTAVGAR 179
25 1.000e-64UniRef50_A0A0A0B141 Formimidoyltransferase-cyclodeaminase (Fragment) n=5 Tax=Euteleostomi TaxID=117571 RepID=A0A0A0B141_CHAVO  ali  39  4LVECVPNFSEGNNKEVIDALGQAISRTPGCVLLDVDAGASTNRTVYTFVGSPEAVVEGALSAARTAGQLIDMSQHKGEHPRMGALDVCPFVPVMNISMEECVTCAHIFGQRLAAELGVPVYLYGEAAREDSRKALPTIRAGEYEALPEKLAKPEW-APDFGPPTFVPRWGATVTGAR 179
26 1.000e-64UniRef50_A0A1Y1RGZ3 Glutamate formimidoyltransferase n=5 Tax=FCB group TaxID=1783270 RepID=A0A1Y1RGZ3_9BACT  ali  46  4LVECVPNFSEGRDKVVIKKITDEIEKVEGVKLLDVDPGEATNRTVVTFIGEPGPVKEAAFRAIKKASEVIDMSKHQGEHARMGATDVCPFVPVSGVTMEDCVRYAHDLGKRVGEELEIPIYFYEHAATCPERQNLADVRAGEYEGLTKKLADPNW-KPDCGPAKFNPQIGATAISAR 179
27 2.000e-64UniRef50_A0A1V5VPN3 Thymidylate kinase n=1 Tax=Microgenomates group bacterium ADurb.Bin219 TaxID=1852933 RepID=A0A1V5VPN3_9BACT  ali  47  375LIECVPNFSEGKDKNIIAQIFLPAKNVPGVTLLDVESDPDHNRCLGTLVGEPEAVLAVVYEMIKIATGLIDMEKHHGEHPRIGATDVVPFVPVANMSLEDCVLLAKKLGEKVGRELKIPVYLYEAAATKPERVKLEDVRRGEYEGLKKVIESDPERKPDFGPAKMHPTAGAMVTGAR 551
28 2.000e-64UniRef50_D3BQY2 Formimidoyltransferase-cyclodeaminase n=4 Tax=Eukaryota TaxID=2759 RepID=D3BQY2_POLPP  ali  46  5LVECVPNFSEGRDPKIIEAITNAIKETPGCTLLDVDPGKSTNRTVVTFVGDTTAIVNGAFNATKVAFLLIDMTKHQGAHPRMGALDVCPFVPVRDVTMEDCIECAKQFGKRCADELGLPIFLYEEASNRDYRKQLKQIRNGEYEGLEEKLKDP-KWAPDFGPAKFIPSYGASVTGAR 180
29 2.000e-64UniRef50_O95954-3 Isoform D of Formimidoyltransferase-cyclodeaminase n=124 Tax=cellular organisms TaxID=131567 RepID=O95954-3  ali  40  4LVECVPNFSEGCNKEVIEALGRAISQTPGCTLLDVDAGASTNRTVYTFVGTPEAVVEGALSAARMAWELIDMSRHKGEHPRMGALDVCPFVPVMNISMEECVICAHVFGQRLSEELGVPVYLYGEAARQESRRTLPAIRAGEYEALPKKLEKPEWV-PDFGPPAFVPQWGATVTGAR 179
30 2.000e-64UniRef50_A0A1Q6YRB0 Glutamate formimidoyltransferase n=21 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q6YRB0_9BACT  ali  50  4LIECVPNFSEGRDAAKVDAIVTAMSSVPGVYVLDREMDADHNRSVVTLAGEPDAVAEAALLGTGKAMELIDLTKHTGAHPRVGATDVLPFIPIEGVTIEDCVALARRVGNEIWKRYRIPVFFYEAAATRPDRVNLENVRRGQFEGLREELKKNLERQPDVGEPKVHPTAGVTVVGAR 180
31 2.000e-64UniRef50_A0A2A3SZL1 Glutamate formimidoyltransferase (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2A3SZL1_9EURY  ali  44  4LVECVPNFSEGRDKDKIKQITDSIEKISGVELLDVDIGSDTNRTVVTFIGSPSRVEEAAFQAVKKASEIIDMRKHGGAHPRMGATDVCPFVPVSDVSMEDCVNIAKKVGKRIGEELEIPVYLYENAATTDDRQNLTNVRAGEYEGLKEKLGEQNWR-PDYGSTKFNARSGATAVGAR 179
32 3.000e-64UniRef50_A0A2N2M6L1 Glutamate formimidoyltransferase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2N2M6L1_9CHLR  ali  42  5LVECIPNFSEARRADVVDKIVASIQSVPGVQVLDKHSDLDHNRTVITLVGDPGAVEEAAFRSIETASLLINLDEHTGAHPRIGATDVVPFVPISGMTMSECIQMAQRLGQRVAEKLSIPVYLYEEAASRPDRQNLEAIRKGQYEGLKTDILVNGDRKPDFGPSRLG-TAGATVIGAR 180
33 4.000e-64UniRef50_U3JN26 Uncharacterized protein n=68 Tax=Bilateria TaxID=33213 RepID=U3JN26_FICAL  ali  39  4LVECVPNFSEGNNKEVIDAVAQAISRTPGCVLLDVDAGASTNRTVYTFVGSPEAVVEGALSAARVAGQLIDMSQHSGEHPRMGALDVCPFVPVRNVSMEDCVTCAHIFGQRLAAELGVPVYLYGAAARDESRKALPSIRAGEYEALPEKLAKPEW-APDFGPPTFVPRWGATVTGAR 179
34 5.000e-64UniRef50_H3IV85 Uncharacterized protein n=4 Tax=Bilateria TaxID=33213 RepID=H3IV85_STRPU  ali  44  8LVECVPNFSEGQTKEIIDAISSAVAQTPGCQLLDVDPGPSTNRTVYTFVGSPASVVEGALNMARVARSLIDMRIHEGEHPRMGALDVCPFIPISGVTMEECDLCAVEFGRRLGEELQVPVYLYAFSAREEKRQKLPSIRAGEYEGLEKKLADPEW-KPDFGPTEFVPTWGATATGAR 183
35 8.000e-64UniRef50_A0A2C9CFR0 Strongly similar to glutamate formimidoyltransferase n=21 Tax=root TaxID=1 RepID=A0A2C9CFR0_KUEST  ali  46  4IIECVPNFSEGKDPRKVAKIADAVQRVKGVKLLNVESDPDYNRTVITFAGEPEAVRDAAFSAIETAANVIDMTLQKGEHPRIGATDVCPFVPVANITMSECVKIAHLLGKDVGERIGIPVYLYAEAANVPRRYLLPDIRKGEYEGLSKKMNDAEWR-PDYGPSVFNKKTGATVIGAR 182
36 9.000e-64UniRef50_A0A2V9BW92 Glutamate formimidoyltransferase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9BW92_9BACT  ali  49  4LIECVPNFSEGRDSAKVDALVGAMSSVPGVYVLDREMDADHNRSVITLAGEPDAVAEAALLGVGKAMKLIDLTKHTGAHPRVGATDVVPFIPIDGVTIEDCVALARRVGNEIWTRYRIPVFFYEAAATRPERVNLENVRRGQFEGLREEMKKNLDRQPDVGEPKVHPTAGVTVVGAR 180
37 1.000e-63UniRef50_O88618 Formimidoyltransferase-cyclodeaminase n=138 Tax=cellular organisms TaxID=131567 RepID=FTCD_RAT  ali  41  4LVECVPNFSEGNNQEVIDAISQAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALSAARTASQLIDMRKHKGEHPRMGALDVCPFIPVRGVSMDECVLCAKAFGQRLAEELNVPVYLYGEAAQMPSRQTLPAIRAGEYEALPEKLKQAEWV-PDFGPSSFVPSWGATVTGAR 179
38 1.000e-63UniRef50_B0NTA3 Glutamate formimidoyltransferase n=36 Tax=cellular organisms TaxID=131567 RepID=B0NTA3_BACSE  ali  68  4IVECVPNFSEGRDLQKIDCIVAPFRGKQGVKLLDYSNDEDHNRLVVTVVGEPEPLRDAVLEAIGVAVQLIDLNKHQGQHPRMGAVDVVPFIPIKNVTMEEAIALSKEVGAEVAKRYNLPVFLYEKSASAPHRENLAAVRKGEFEGMAEKIKLPEW-QPDFGPAERHPTAGTVAVGAR 179
39 2.000e-63UniRef50_A0A1G0W5K5 Glutamate formimidoyltransferase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A1G0W5K5_9BACT  ali  42  3IIECVPNFSEGKNENTFAAIKLALEKTGGVKLLNLEPDADYNRVVVTMAGDENGILEGAVNACKAAAENIDMTTHKGEHPRLGAIDVVPFVPVKNSTMEDCIKIAEKFGERISKELGVPVYLYEEAARKPERKSLSDIRKGEYEGLEEKLKDPEW-APDYGEAKFNPKLGAIVTGAR 178
40 2.000e-63UniRef50_A0A1V5PQ42 Methenyltetrahydrofolate cyclohydrolase n=52 Tax=Bacteria TaxID=2 RepID=A0A1V5PQ42_9BACT  ali  46  3LVECVPNFSEGRNKSVIDAITKEIQHVPDITLLDVDPGADTNRTVVTFIGSPEQIKIAAFNAIKKAAELIDMAGHKGAHARIGATDVCPLIPVREVTMEECVKLANELGKKVGEELHIPVYLYEEAAKSPERKNLATIRQGEYEGLKEKLNDPLW-KPDYGEAIFNSRAGATVIGAR 178
41 3.000e-63UniRef50_A0A1W1HVJ6 Putative Formimidoyltransferase-cyclodeaminase n=2 Tax=Nitrospira TaxID=203693 RepID=A0A1W1HVJ6_9BACT  ali  44  4VVECVPNFSEGRNSEIVDALAGVVRSVPGVVLLDETKDPDHHRAVVTFAGRPYAVAEVAYQMARMASQLIDLRNHHGEHPRVGATDVMPFVPIRGVSMQDCVQLARMVGQRIGNELKIPVFLYEQAATRPERKQLEWIRKGGLKGLADRMANDPAWVPDFGPKLLHQTAGATVVGAR 180
42 3.000e-63UniRef50_A0A2N9N8E5 Glutamate formimidoyltransferase + methenyltetrahydrofolate cyclohydrolase n=13 Tax=Bacteria TaxID=2 RepID=A0A2N9N8E5_9BACT  ali  48  5LVECVPNFSEGRDPAKVDAIIEAMK-IPGVYLLDREMDSDHNRCVITLVGEREAIQEAAIRGVGKAAELIDLTKHQGAHPRMGAADVIPFIPIDGVTIEDCVAMARHVGAEIAKRFQIPVYLYEAAAATPERQNLENIRRGQFEGIRDDIATNPARQPDFGEPRVHPTAGATVVGAR 180
43 4.000e-63UniRef50_A0A135VNW4 Uncharacterized protein n=1 Tax=Candidatus Thorarchaeota archaeon SMTZ1-45 TaxID=1706444 RepID=A0A135VNW4_9ARCH  ali  49  3VVECVPNFSEGRNQSIIDALANAIKSVEGVRLLDVEFDPDHNRSVFTFIGGPQQVKNAALKAAELAVEKIDLTKHKGAHPRMGAVDVVPFIPLHGTTIGECIELSKEFAKEFSEKCNVPVFLYSKSATRRDRVDLPNIREGEFEGLREEIGTNPEKDPDYGPSKIHPTAGATATGAR 179
44 5.000e-63UniRef50_A0A1Q9P017 Methenyltetrahydrofolate cyclohydrolase n=1 Tax=Candidatus Thorarchaeota archaeon AB_25 TaxID=1837170 RepID=A0A1Q9P017_9ARCH  ali  49  6VIECVPNFSEGRDTKIIDALSEVIKSVEGVRLLDIEFDPDHNRSVFTFIGEPQQVKNAALKAAELAVEKIDLTKHEGAHPRMGAVDVVPFIPLHGTTIGECIELSKEFAEEFSKKCNVPVFLYSKSASRPDRVDLPNIREGEFEALRNEIGTNPEKKPDYGPNKIHPTAGATTTGAR 182
45 6.000e-63UniRef50_A0A2E0UXC1 Glutamate formimidoyltransferase n=2 Tax=Anaerolineae TaxID=292625 RepID=A0A2E0UXC1_9CHLR  ali  46  29LVECIPNFSEARRREVIETILESIRSVPNVHILDHHSDVDHNRTVVTYIGSPAEVEEAAFQAIQTAAKLINLDEHEGEHPRLGATDVVPFVPISEITMQECVEMARRLAKRVGSELNLPTFLYEEAATIPEKQNLESIRKGQYEALKEEIGSSPVRTPDFGPYQLGP-AGATVIGAR 204
46 7.000e-63UniRef50_E8N3Z1 Putative formiminotransferase-cyclodeaminase n=22 Tax=Bacteria TaxID=2 RepID=E8N3Z1_ANATU  ali  44  5LVECIPNFSEARRPEVVEAIRSAIASVAEVSILDQHSDMDHNRTVITLIGPPAAVEEAAYRGIEKAVELIDLNHHTGEHPRIGAADVVPFVPIRDITMEECVEMARRLGKRVGETLQIPVYLYEEAATRPSRKNLEDIRRGEYEALKQEMGRNPERTPDFGPEQVGP-AGATVIGAR 180
47 8.000e-63UniRef50_A0A2K5IJA6 Formimidoyltransferase cyclodeaminase n=4 Tax=Amniota TaxID=32524 RepID=A0A2K5IJA6_COLAP  ali  41  4LVECVPNFSEGKNQEVIEAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPDCVVEGALNAARAASQLIDMSRHQGEHPRMGALDVCPFIPVRGVSMDECVLCAQAFGQRLAEELDVPVYLYGEAARTDSRRTLPAIRAGEYEALPEKLQQAEW-APDFGPSSFVPSWGATATGAR 179
48 8.000e-63UniRef50_A0A1Q7ZIY5 Glutamate formimidoyltransferase (Fragment) n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1Q7ZIY5_9BACT  ali  47  4LVECVPNFSEGRDEGIIRQITDAIKSTDGVSLLDVDPGASTNRTVVTFVGNREAAVEAAFRAIKKAAELIDMRKHKGAHPRMGATDVCPFIPVSNVSWEEAIECANRLGKRVGEELKIPVYLYEKAAKDRLRSNLAVIRAGEYEGCFEKIKQSEW-KPDFGPAVFNEKSGATVIGVR 179
49 9.000e-63UniRef50_A0A1V6C0S2 Methenyltetrahydrofolate cyclohydrolase n=1 Tax=bacterium ADurb.Bin132 TaxID=1866923 RepID=A0A1V6C0S2_9BACT  ali  45  4LVECVPNFSEGRRKDVVDRIAQVAKDTPNVKLLDVQMDADHNRCVVTFVGEPEAAAEAAFGMCKVASELIDMNTHKGEHPRLGATDVIPFVPISEVTTEEAVKLAVSLGERIWKELKIPVYLYEDAARTPERQDLSNIRQGEYEGIKEEMGEKPERNPDIGEPAMHPTAGAVVVGAR 180
50 1.000e-62UniRef50_A0A1W9J4J0 Glutamate formimidoyltransferase n=1 Tax=Nitrospira sp. ST-bin5 TaxID=1978765 RepID=A0A1W9J4J0_9BACT  ali  42  4IIECIPNFSEGRNPATVQALIAAVDSVPGVRLLDRTSDPDHHRSVLTFAGNPDAVVEAAFQAIRIATERIDLRNHTGVHPRIGATDVVPFIPIQGTTMEDCVQLARRLGERVGAELQIPVFLYEQAASHPDQTRLETIRQGGLSGLGARMATDRNWRPDFGPDHPHETAGATVIGAR 180
51 2.000e-62UniRef50_A0A1V6H189 Uncharacterized protein n=1 Tax=Thermotogae bacterium ADurb.Bin062 TaxID=1852923 RepID=A0A1V6H189_9BACT  ali  49  4.IETVPNFSEGRRKEVVDAIVAQAKAYDHVWILDESLDYDHNRSVVTMVGEPESVLKALFDMTKKASELIDLRVHRGEHPRMGATDVIPLIPLRNVTVEECVTHAATLGKRIAEELEIPVYLYEKSATRDERKDLSNIRQGQFEGFAAKIQKPEW-CPDFGRREIHPSAGACAVGVR 178
52 2.000e-62UniRef50_A0A1W9SB06 Glutamate formimidoyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A1W9SB06_9BACT  ali  47  4IVECVPNFSEGRDIDKIERIMSVVKSDKFVKLVNYESDADYNRTVVTLIGEPKKMIDLILKLTEVCLEEIDLNHHTGEHARMGAIDVIPFIPISDVTMKECVDYANECAKRISEEYNIPTYLYAKAAKFEERISLPNIRKGEFEGMKTKILEPEW-KPDFGEAKIHPTFGCVAVGAR 179
53 2.000e-62UniRef50_P53603 Formimidoyltransferase-cyclodeaminase n=105 Tax=cellular organisms TaxID=131567 RepID=FTCD_PIG  ali  41  4LVECVPNFSEGKNQEVIDAISRAVAQTPGCVLLDVDSGPSTNRTVYTFVGRPEDVVEGALNAARAAYQLIDMSRHHGEHPRMGALDVCPFIPVRGVTMDECVRCAQAFGQRLAEELGVPVYLYGEAARTAGRQSLPALRAGEYEALPEKLKQAEW-APDFGPSAFVPSWGATVAGAR 179
54 2.000e-62UniRef50_A0A146UR19 Formimidoyltransferase-cyclodeaminase n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A146UR19_FUNHE  ali  40  14LVECVPNFSEGRDKQVIDAISAAISETPGCSLLDVDPGASTNRTVYTFVGPPEAVVEGALNAARRAFGLMDMSKHSGEHPRTGALDVCPFVPVQNVSMDDCVRCADEFGRKLAEMLRVPVYLYGEAARSDSRRSLPSLRSGEYEALPEKLKRAEW-APDFGPALFVPSWGATVTGAR 189
55 3.000e-62UniRef50_A0A1J5THR1 Glutamate formimidoyltransferase n=1 Tax=Marine Group III euryarchaeote CG-Bathy1 TaxID=1889001 RepID=A0A1J5THR1_9EURY  ali  47  4LVECVPNFSEGQNEAVIKEITDAIQRVEGVKLLDADMGGDTNRTVVTIIGSPKAIAEGAFQGIKKASEVIDMRKHTGAHPRMGATDVCPFVPVSGVDMDECVEISKQVAERVGSELGISVFLYENSATKKERRNLATIRSGEYEGMAEKLTSDEWR-PDYGPQELNESAGVTAIGAR 179
56 3.000e-62UniRef50_A0A0U1KZL5 Glutamate formiminotransferase @ Glutamate formyltransferase n=15 Tax=Bacteria TaxID=2 RepID=A0A0U1KZL5_9FIRM  ali  46  4LVECVPNFSEGRRPEVIAAIVNEVKKVQGVTLLNVNSDASHNRTVVTFVGDPQAAKLAAFTACAKAAELIDMEQHQGAHPRVGATDVIPFIPVSDISMEECVQLANELGQEIGEKLNIPVYLYEAAAKTPARVKLPDVRKGEYEGLKTAITTPE-RQPDYGPAHMHPAAGATVVGAR 179
57 3.000e-62UniRef50_A0A2P8ZL04 Formimidoyltransferase-cyclodeaminase n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8ZL04_BLAGE  ali  37  6IVECVPNFSEGRDHKIIDAIADAIRQSPGCTLLDVDPGPSTNRTVYTFVGAPDAVVQGALNGARTAFKLINMADHKGAHPRLGAMDVCPFVPVSNVTVEECCICARKLGVLLAQELNVPVYMYGAAAKQSYRKTVAQIRAGEYEALADRLKDPQW-EPDYGPAEFVPRWGACMVGVR 181
58 3.000e-62UniRef50_A0A2M7UD71 Glutamate formimidoyltransferase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7UD71_9BACT  ali  43  4IVLCVPNISEGKDCEKINLIASVVEM-PGSKLLDMSSDTNHNRSVITFGGEPEAVKQAAFNLIKKAAELIDMSKHKGEHPRMGAVDVCPFVPVAGMTMQECARLAWELGWAVGCDLGLSGYFYGYAAKKPERKKLSDIRAGEYEALPKKLEKPEWR-FDFGLPEFNPSFGATVIGAR 178
59 4.000e-62UniRef50_O95954 Formimidoyltransferase-cyclodeaminase n=99 Tax=Euteleostomi TaxID=117571 RepID=FTCD_HUMAN  ali  40  4LVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADW-APDFGPSSFVPSWGATATGAR 179
60 4.000e-62UniRef50_K0N5A7 FtcD: formimidoyltetrahydrofolate cyclodeaminase n=5 Tax=cellular organisms TaxID=131567 RepID=K0N5A7_DESTT  ali  42  4IVECVPNFSEGRNKKTINAIADAILQTKGCRLLDIDAGNSTNRTVYTFVGSPEAVVEGALSAAVVARQKIDMQTHQGEHHRLGALDVCPFVPVANVTMEECVDISKEFGRRLAENMGIPVYLYEESASLEYRKKLSQIRDGQYEGLKDKIITKEW-KPDFGPAKFIPGWGATVTGAR 179
61 4.000e-62UniRef50_A0A2H5W4R2 Glutamate formimidoyltransferase n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W4R2_9BACT  ali  51  4IIECVPNVSEGRRAEVLDAFIRLLQAQPGVLLLDYHADPDHNRTVFTLIGDGPALLSAMLALYEKAVELIDMRQHRGEHPRAGAVDVCPFVPIAGATMEDCVALARELGRQVAERFQIPVFLYAHAATREDRRELPNIRKGEFEGWFEKIKDPNW-KPDFGPDRVHPTAGITVIGAR 179
62 4.000e-62UniRef50_A0A1B7LDQ8 Glutamate formiminotransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A1B7LDQ8_9FIRM  ali  46  4LVECVPNFSEGRRFEVVAAIEAAGEK-CGVKMLDRTMDADHNRSVITFAGEPEAVLEAAYAMILEARERINMEGHHGAHPRLGAADVVPFIPVSGVEMAECVELARRLGERVGRELAIPVYLYEEAATRPERRNLADVRRGEYEGLKEEITRPE-RRPDFGPVRMHPTAGAVVIGAR 178
63 5.000e-62UniRef50_A0A2H6A017 Glutamate formimidoyltransferase n=38 Tax=Bacteria TaxID=2 RepID=A0A2H6A017_9BACT  ali  46  4IVECVPNFSEGRNPEVIAALKESILSVPGVKLLDVQSDASHHRSVFTFIGSPEAVSEAAFRAIRTAAERIDLNRHQGEHPRMGAADVVPFVPVSGVSMEDCIELAKKLGERVGRELEIPVYLYARAATRPERESLPKIRKGGFEALREQIGRDPEKDPDFGPKRIHPTAGCTAIGAR 180
64 5.000e-62UniRef50_C0H8W4 Formimidoyltransferase-cyclodeaminase n=18 Tax=cellular organisms TaxID=131567 RepID=C0H8W4_SALSA  ali  42  4LVECVPNFSEGRNKKVIDAIAEAISSTEGCSLLDVDPGSSTNRTVYTFVGSPQAVVEGALNAARTAFPLIDMTKHSGEHPRMGAMDVCPFIPVQNVTMEDCVNCANIFAQHLTDVLHVPVYLYGEAARKENRRSLPSVRAGEYEALSEKLKRTEW-APDYGPADFVPCWGATVAGAR 179
65 1.000e-61UniRef50_A0A0B7MPM6 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0B7MPM6_9FIRM  ali  47  58IVECVPNFSEGRRMDVVERILDAIRSLEGVKILDSSSDASHNRTVVTFVGEPQGVKEAAFRAAQMAAELIDMENHHGEHPRIGATDVIPFTPISDVTMDECVEMARELGQEIGGKLSIPVFLYEEAAVKPERKNLAKVRRGEYEGLKEVISQPE-RHPDFGPARMHPTAGATAVGAR 233
66 1.000e-61UniRef50_A0A2E7VXQ2 Glutamate formimidoyltransferase (Fragment) n=16 Tax=Bacteria TaxID=2 RepID=A0A2E7VXQ2_9BACT  ali  45  3LIECVPNFSEGXNNEVISSIARSIEDVEGISLLDVDPGRDTNRTVVTFVGSPDAVKEAAFQSIKIASELIDMSKHKGAHPRMGATDVFPLIPISGVSIEECXDLSHEIGQRVANELNISVYLYEKSATNSKRSNLXDIRAGEYEGLSKKLKDP-KWKPDYGPSELNHKXGATAIGVR 178
67 2.000e-61UniRef50_A0A0F9FNK7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9FNK7_9ZZZZ  ali  45  5LIQCVPNFSEGRRFEVIESIIGPFKQTKGCNLLDHRADGDHNRLVVTLVGSPGPIQDALIQAAKIAIDHIDLNTHQGGHPRVGAVDVIPFVPLRNITMDECVALAHTFGECYHKETGIPVYFYEAAAKRPDRSRLEVVRRGQYEVLKTEAAENPDRHPDVGGPGLHATAGATVVGAR 181
68 2.000e-61UniRef50_A0A2N9M684 Glutamate formimidoyltransferase + methenyltetrahydrofolate cyclohydrolase n=61 Tax=Bacteria TaxID=2 RepID=A0A2N9M684_9BACT  ali  48  5LIECVPNFSEGRDSAKVDAIVEAMKL-PGVYVLDREMDADHNRSVITLAGEREAIQEAAIRGVGKAAELIDLNQHQGAHPRLGAADVVPFIPIEGVTLEDCVAMARHVGAEIWKRYQVPVYLYEAAAATPERQNLENIRRGQFEGIRDEIATNPARKPDFGEARLHATAGATVVGAR 180
69 2.000e-61UniRef50_A0A2A4T2D3 Glutamate formimidoyltransferase n=1 Tax=SAR324 cluster bacterium TaxID=2024889 RepID=A0A2A4T2D3_9DELT  ali  40  5.IECVPNFSEGCDEQVLNEIARVIRAIPEVYLLEVDPGAGAHRTVFTFAGKKNAMAEAAFQAIRVASEKIDMTQHRGVHPRIGAIDVCPFIPLEGSTIDDCIELACQVGHRIGTELGLPGYFYGAAASRLERKNLTSCRSGQYEGISQKLKNPDWL-PDFGPAVFHAKSGMTIVGAR 179
70 2.000e-61UniRef50_A0A1F9UHK6 Glutamate formimidoyltransferase n=21 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9UHK6_9BACT  ali  47  4LVECVPNFSEGRDKNKVEAIVAAARAVPGVTILDVETDPDHNRCVLSFVAPPQAAVEACFRVAQKSRDLIDLNKHKGEHPRMGAVDVIPFIPVSGIEIRECCRLAEKLGERIGRDLEIPVYLYDHAARRPERKDLATVRKGQFEGLRDLIGKDPARRPDFGPNKIHPTAGATAVGAR 180
71 2.000e-61UniRef50_UPI0008DB826C formimidoyltransferase-cyclodeaminase n=1 Tax=Serinus canaria TaxID=9135 RepID=UPI0008DB826C  ali  39  4LVECVPNFSEGNNKEVIDAVAQAISRTLGCVLLDVDAGASTNCTVYTFVGPPEALVEGALSSVHVAGQLIDMSQHSGEHPRMGALDVCPFVPVRNVSMEECVTCAHIFRQRLAAELGVPVYVYGAAARHKSRKALPSICAGEYEALPEKLAKPEW-GPDFGPPSFVPRWGATVTGAR 179
72 2.000e-61UniRef50_A0A293MVR2 Formimidoyltransferase-cyclodeaminase (Fragment) n=2 Tax=Eumetazoa TaxID=6072 RepID=A0A293MVR2_ORNER  ali  39  5IVECVPNFSEGQSQDVIDAISSAIKATPGVSLLGVDPGPSTNRTVYTFVGSPDAVIQGALNAARAAYKLIDMSKHKGEHPRLGAMDVCPFIPVRGVEMEECVYCARKFGEKLALELKVPVYLYGFAAQHDYRRTVPQIRSGEYEGIAEKILKPEW-KPDYGPAEFVPNWGATMSGAR 180
73 2.000e-61UniRef50_A0A2N1P6J5 Glutamate formimidoyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A2N1P6J5_9BACT  ali  44  4LVECVPNFSEGRRKEVLDQIINEITSVETVVLLDREMDGDHNRAVVTFVCQPEFAVEACFRGIKKASEVLDMSTHKGEHPRMGATDVCPFIPISDFTEAEAVELANQLGKRVGEELAIPVYLYETAATSPNRENLADVRRGEYEGIRDSIETDPARKPDYGPSKMNLKAGAIAIGVR 180
74 2.000e-61UniRef50_C9M7N1 Glutamate formimidoyltransferase n=20 Tax=Bacteria TaxID=2 RepID=C9M7N1_9BACT  ali  46  5LIECVPNFSEGRRQDVIEAIVAPFKNRKGCYLFDYRADQDHNRLVVSLVGEPQAICDALLEASRVAVENIDLNTHQGAHPRLGAVDVIPFTPVKNITMDECVELAHSFAKRFNDALDVPVFFYEAASVRPDRTRLEQIRKGQYEALKELVKTDPSRQPDVGKDRLHPTAGGTVIGAR 182
75 7.000e-61UniRef50_A0A161JW91 Glutamate formiminotransferase @ Glutamate formyltransferase n=10 Tax=root TaxID=1 RepID=A0A161JW91_9ZZZZ  ali  47  4LVECVPNFSEGRDLAKISTITAHIEAIPGITLLDVDPGADTNRTVVTFVGPIEAVEDAAFQAIKSAGEVLDMRSHKGAHARMGATDVCPFIPVSGVSMDDCISLSKRVGKRVGEDLSIPVYLYENSAQTPKRKNLATIRSGEYEGLKDKLADP-AWGPDFGPTEFHEQAGATVIGAR 179
76 7.000e-61UniRef50_A0A075GHU2 Bifunctional glutamate formiminotransferase/formiminotetrahydrofolate cyclodeaminase (FTCD) n=37 Tax=cellular organisms TaxID=131  ali  48  5LVECVPNFSEGKDKGVIAKISAAIVAVEGVTLLDVDMGVDFHRTVVTMVGEPEPILKAALAATEVALDLIDMATHNGEHARMGAVDVVPFIPISGVSMEECIDLARRYGEIAGEQFGLPIYLYARAANSEQRVNLPDIRRGEYEGLREKILQPEWV-PDFGPAEFKHTMGATATGAR 180
77 1.000e-60UniRef50_A0A2E6JIF1 Glutamate formimidoyltransferase n=13 Tax=Bacteria TaxID=2 RepID=A0A2E6JIF1_9BACT  ali  44  3LVECVPNFSEGRNSDIISAITDSIKKVDGVSLLGVDPGKDTNRTVVTFVGSPEAVEKAAFNSIKTSADLIDMTKHSGTHARMGATDVCPLIPISGVTNKECIDLSRRLAKKVGDELSIPIYLYEKSASSPSRVNLADIRSGEYEGLSKKLKSDDW-KPDYGPIDFNPKSGATAIGVR 178
78 1.000e-60UniRef50_A0A0S4LIV2 Putative Formimidoyltransferase-cyclodeaminase n=5 Tax=Nitrospira TaxID=203693 RepID=A0A0S4LIV2_9BACT  ali  42  4IIECVPNFSEGRNRATVQALLNAVTSTPDVVHLDHSMDSDHHRAVLTFCGTPEAVVDAAFRAICTATNLIDLRNHAGVHPRVGATDVVPFIPIRGTTMEDCVRLAARLGERIGRELEIPVFLYERAATRADHAPLEAVRRGGLKGLAFRMASDPNWAPDFGPPRLHRSAGAIAIGAR 180
79 2.000e-60UniRef50_A0A256Z4L2 Glutamate formimidoyltransferase n=8 Tax=root TaxID=1 RepID=A0A256Z4L2_9ARCH  ali  46  4IIECVPNFSTS-DPKVVEAILNEIRRVENAYILDYTFDDYYNRLVVSFVGNRRSVLDAALNAARKAVELIDMTKHKGQHPRIGAVDVVPFIPIKGVTMQDCVEIAKKFGETLARELNVPVYLYAEAATKPERRDLDWIRKGEYEKLGEMIVQPD-RKPDFGPAEPHPTAGATITGAR 178
80 2.000e-60UniRef50_A0A0N8A7J5 Putative Formimidoyltransferase-cyclodeaminase n=8 Tax=Bilateria TaxID=33213 RepID=A0A0N8A7J5_9CRUS  ali  40  4IVECVPNFSEGRDPQIIEAISSAIRATANVTLLDVDPGTSTNRTVYTFVGSPSDVVEAALAASRVAYQLIDMARHKGEHPRMGALDVCPFIPVQGVDVDDCVQCAKEFGRRLADELSLPVYLYGMAAKGAHRISLPQIRAGEYEAIKDKINKDEW-KPDFGPCEFVSRWGATATGVR 180
81 2.000e-60UniRef50_A0A2J6WUQ2 Glutamate formimidoyltransferase n=1 Tax=Aciduliprofundum sp. TaxID=2060325 RepID=A0A2J6WUQ2_9EURY  ali  44  3LVECVPNFSEGRDRKVVNDIAKAIAYDESVKILDIEMDPDHNRSVITFVAPIDKVSEAAFRGIKRASELIDMDKHRGTHPRFGAADVVPFIPLYDTTMDECVEIARSLGKRVGDELNIPVYLYEKAAFLEWRRNLPDIRKFQYEQLKEHIME-EKWKPDFGP-QFVGKAGATIIGAR 179
82 3.000e-60UniRef50_A0A1F9BAY8 Glutamate formimidoyltransferase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9BAY8_9DELT  ali  44  3IIECVPNFSEGCNQKKIAAIAKVFKSHPRVRLIDFSGDADHNRSVFTFLGEPEDILEAALAACGKALELIDMRKQAGVHPRLGAVDVVPFIPLGKTKMKDAVDLAHVFGQQLYERFGVPVYFYGQAALVPGRDELANVRRGGYEALKSKMINPAD-APDVGKPVFNARAGATAVGAR 178
83 3.000e-60UniRef50_A0A2P2BNQ5 Formimidoyltransferase-cyclodeaminase n=74 Tax=Bacteria TaxID=2 RepID=A0A2P2BNQ5_9FIRM  ali  56  3VVQCVPNFSEGRDLDKIEKIVEPLRKKEGVKLLNYEADKNYNRLVVTVIGEPQQVKKAVFESIEVAKNIIDMNNHKGQHSRFGATDVCPFIPIKDMTMEDAVNLAKELGREVSDKLSIPVFLYEDAATKPDRQNLANVRKGEFEGLDEKLKDSNWI-PDFGEAKKHESAGAIAIGAR 178
84 4.000e-60UniRef50_A0A2V9I3P9 Glutamate formimidoyltransferase n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9I3P9_9BACT  ali  49  22IVECVPNFSEGRRREVVDALAAALTLQPGAVLLDREMDPAHNRCVLTVAGEPEAVARGVIEAVGKAVELIDLREHRGEHPRMGAADVIPFVPISGITMLECVELSVRVAQQIAELYSIPVFLYEQSARIPARQDLAYVRKGEFEGIREEIRTNPERKPDFGPCEVHPSAGATAVGAR 198
85 5.000e-60UniRef50_A0A2D6E9Y1 Glutamate formimidoyltransferase n=4 Tax=FCB group TaxID=1783270 RepID=A0A2D6E9Y1_9BACT  ali  44  4IVECVPNISEGRDRTVIDAVTAVVQNIPGVALLDVDPGEETNRTVITLVGNPDATVDAAFRLIAEAQRRIDMSAHSGAHPRMGATDVCPFVPVSGVTMDECAELARKLGTRVGEELGIPVYLYEHAASRPERQNLAAVRAGEYEGLAAREGKSEW-DPDFGPAKFNPRSGATAIGAR 179
86 5.000e-60UniRef50_E7GPH9 Glutamate formiminotransferase n=5 Tax=Clostridiales TaxID=186802 RepID=E7GPH9_CLOSY  ali  56  4IILTAPNFSEGRDQEKIQKILDCFRNREHVQILRWQRDPDHNRFGANVIGEPEAIYEAMLEAIGTALELIDMTKHHGQHPRMGAVDVIPLTPLRNCTIEDCSELAHKIASEAADKYHLPFFLYEKSANTPARTNLAEIRKGEFEGMAEKLKSPEW-KPDYGPDTIHPTGGVTAIGAR 179
87 6.000e-60UniRef50_A0A1V5W362 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin217 TaxID=1852809 RepID=A0A1V5W362_9BACT  ali  42  3LLECVPNISEGNNQEIIDGVAQVISAVPGVKLLHVDSGKAANRTVYTFVGFPDSVIDAAFALFEYVIQHVDMENHVGTHPRVGAVDVCPLIPIQGISMEQTKQYAEKLAKRVGEELHVPIYFYEHNAKYIHRTRLEQIRSGEYEGFKQKIL-LEGWEPDYGPQSFNPKTGVSVIGAR 178
88 6.000e-60UniRef50_A0A1I3Q989 Glutamate formiminotransferase n=2 Tax=Ruminococcaceae bacterium D5 TaxID=1520815 RepID=A0A1I3Q989_9FIRM  ali  68  6IIESVPNFSEGRDLKKIERIVDCFRAKKGVKLLDYSTDPDHNRCVVTVIGEPQNLGDAMVEAVGAAISVIDMTRHEGQHPRMGCVDVIPFIPVRNCGIEEADRLARRVAREAAERFGQPFFLYEKSASAPNRVNLADIREGQFEGMAEKMKDPRW-KPDFGPDTIHPTGGVTAIGAR 181
89 8.000e-60UniRef50_A0A1F9FYC2 Glutamate formimidoyltransferase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_44_16 TaxID=1797862 RepID=A0A1F9FYC2_  ali  41  8.IECVPNISEGKNQIILDTLSAEIKKFSGVKLLDVDSGKSTNRTVFTFVGDPKTLEKAIYQFVIKALKLIDMQTHTGLHPRLGAVDVLPFVPLFESTITECIELAHRVGKRIGDELQIPVYMYAKAATNDQRIRLHDIRKGEYEGLEQKLQDPLW-KPDYGLAKFVPQSGALVIGAR 182
90 8.000e-60UniRef50_A0A2A5VVH2 Glutamate formimidoyltransferase n=3 Tax=Marine Group II TaxID=133814 RepID=A0A2A5VVH2_9EURY  ali  46  2LIECVPNFSEGRDPTIIDAITDSISSIDGVSILDVDMGYDFNRTVVTMVGQPESVLEAAIRSTAVAMELIDMRKHHGEHARMGAVDVVPFIPLEGATIEACVSLSERYADAVSKQFDLPVYLYAESARSNQRIRLPDIRRGEYEGLEAKITSSEWI-PDYGKAEFKPRIGATATGAR 177
91 9.000e-60UniRef50_A0A1Q8BEJ0 Glutamate formimidoyltransferase n=14 Tax=Archaea TaxID=2157 RepID=A0A1Q8BEJ0_9CREN  ali  47  3LVECVPNFSEGQRREVIESITDAIRKTPGVMLLDVESNPDHNRSVISFVGEPGPVKDAALAASQKAIELIDLRHHKGEHPRMGAVDVVPFIPLSGVTMDDCVSLARSFGQEFAEKFHVPVFLYEEAAATPERRNLADVREGEFEGLRDKIGRDPAKKPDFGPEKIH........... 168
92 1.000e-59UniRef50_A0A2U9AUW6 Putative BCL-6 corepressor-like isoform 2 n=2 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9AUW6_SCOMX  ali  42  4LVECVPNFSEGRSREVIDAISAAISSTSGCSLLDVDPGASTNRTVYTFVGSPEAVVEAALSAARQAFSLIDMSRHSGEHPRTGALDVCPFIPVQNVTMEDCVHCANVFGQKLAEMLHVPVFLYGEAARRETRRSLPAVRAGEYEALAEKLTRDEW-APDFGPADFVPSWGATVTGAR 179
93 1.000e-59UniRef50_A0A1F3V372 Glutamate formimidoyltransferase n=2 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3V372_9PROT  ali  42  4IVECVPNISDGVHPEVYNTIAKSCEKIPGVKLLDVDPGVATNRTVITFAGPPEAVVDAAFEIIKLSKELIDMRSHKGEHPRMGATDVCPFVPISGVTLEECADLARRLGRRVGEELGIWVYLYEAAATKTEWKSLSNIRKGEYESLAAREGDPAWR-PDFGPEKFDPKFGGVVIGAR 179
94 1.000e-59UniRef50_A0A1Q9PET0 Uncharacterized protein n=1 Tax=Candidatus Heimdallarchaeota archaeon AB_125 TaxID=1841596 RepID=A0A1Q9PET0_9ARCH  ali  38  3LVECVPNFSEGRNQEIVDQIVDAIQKGGKIIMLDSRMDPDHNRAVISFIGEPEECVNAAFAGCKKAAELIDMNEHKGEHNRFGSTDVIPIIPVSDITLEECAELAHKLGGSIAKELKIPVYYYGAAAKDPSREILQKYRTKSFQFLKEEIATNDAYKPDAGSRKVHAKAGATNIGAR 181
95 1.000e-59UniRef50_F4L472 Glutamate formiminotransferase n=2 Tax=Saprospirales TaxID=1936988 RepID=F4L472_HALH1  ali  43  9LLECVPNFSEGRNPVVIESIAAAIRQIVGVKLLHVDPGYDANRTVMTFVGAPLAVVEAAFQSIKTASQLIDMRQQLGAHPRMGATDVCPLVPIAGMSIDEAVVLARTLGQRVGTELNIPVYLYEYAAQDPQRRNLATIRQGEYEGLAQKIRQPEW-TPDYGPDQGAFPAGATVIGAR 184
96 2.000e-59UniRef50_A0A1J5DBB2 Glutamate formimidoyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1J5DBB2_9BACT  ali  47  3IIDCIINISEGQRQPVVEYIVDAIRETPGCFLLDFSSDVDHNRTVITFIGNRRSLKSAIRELYKRAIEKIDLRTHKGEHPRMGAVDVVPFVPIRDCTMDDCIAFSKDVASMIWSEFKIPVYLYEESQPNSDRKNLAKIRKGEFESLPAKMTDPDW-KPDFGECAPHESAGASVVGAR 178
97 2.000e-59UniRef50_A0A0S4KTG6 Putative Formimidoyltransferase-cyclodeaminase n=2 Tax=Nitrospira TaxID=203693 RepID=A0A0S4KTG6_9BACT  ali  44  4LIECVPNFSEGRDQAVIQALVAAIISVPDVRFLHRTMDPDHHRSVLTFAGPPDAVGEAAWRVIVRATELIDLRRHEGVHPRIGATDVVPFVPLQDVAMDDCARLARMIGQEVGTRLKIPVFLYEEAAPTEARRRLEAIRKGGLTGLASRMEQDSAWSPDFGPSRLHETAGAIVIGAR 180
98 3.000e-59UniRef50_D4CXW2 Glutamate formimidoyltransferase n=73 Tax=Bacteria TaxID=2 RepID=D4CXW2_9FUSO  ali  56  4IVECIPNYSEGKDLAKIERIVAPYKNNPKVKLLGVEPDANYNRTVVTVLGDPEEVKKAVIESIGIATKEIDMNVHKGEHKRMGATDVVPFLPIQEMTTEECNEISREVAKAVWEQFQLPVFLYESTATAPNRVSLPDIRKGEYEGMAEKLKQPEW-APDFGERAPHPTAGVTAIGCR 179
99 3.000e-59UniRef50_A0A075FW54 Bifunctional glutamate formiminotransferase/formiminotetrahydrofolate cyclodeaminase (FTCD) n=44 Tax=cellular organisms TaxID=131  ali  47  31LVECVPNFSEGRDSSVIEEISEAIRGVEGVTLLDVAMGHDFNRTVVTMVGYPDSVLDAAIVSTEVAIDLIDMSKHHGEHARMGAVDVVPFIPIKGITMAECVELAERYAKAVSDGLDLPVYLYAEAARNEQRARLPDIRRGEYEGLESKVTSMDW-APDYGPAEFKPKMGATAAGAR 206
100 5.000e-59UniRef50_A0A2H0WYM7 Glutamate formimidoyltransferase n=3 Tax=Candidatus Portnoybacteria TaxID=1817913 RepID=A0A2H0WYM7_9BACT  ali  45  4IVLCVPNISEGRDWGKINQIASAAE-IPGCKLLDVAPDVDHNRTVITFAGGPRVVQFAALKLIIKAAELIDMSKHKGEHPRMGAVDVCPFVPFRGVSMEDCVKLARGLAK-SANRLDLAGYLYECAAISPEKTKLSNIRAGEYEGLEEKLKKLEWF-PDFGPAEFNPKFGVMAIGAR 177
101 5.000e-59UniRef50_A0A1Q7NHQ5 Glutamate formimidoyltransferase n=8 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7NHQ5_9BACT  ali  41  17LVECVPNFSEGRKPETVQRIERAIESIHGARVLDRHIDPDHNRSVITFVAPPEHAIEAALRAVATATELIDLRTHAGEHPRIGATDVLPFVPVRGVTMDECVALAHEAGRRIWQELSIPVYFYERAALRTDRIRLEKVRGKGIEQLRTEIETNPDRAPDVGEKRTHPTAGAIAVGAR 193
102 6.000e-59UniRef50_A0A2A4TW55 Glutamate formimidoyltransferase n=1 Tax=Elusimicrobia bacterium TaxID=2030800 RepID=A0A2A4TW55_9BACT  ali  44  3LIECVPNFSEGRDSRIIDAIAEAVRSVDGAMLLDVDPGKATNRTVYTFAGEPEAVLEAAYQAIKTAYMLIDMSKHSGEHARQGACDICPFIPISGASLKECITLSERLAERVGKELQLPVYLYAAAARRPERTRLPDIRIGEYEALAEKLKKKEW-KPDYGPAEFVPRFGVLTTGAR 178
103 1.000e-58UniRef50_A0A0K2GIX2 Putative Formimidoyltransferase-cyclodeaminase n=7 Tax=Nitrospirae TaxID=40117 RepID=A0A0K2GIX2_NITMO  ali  42  4IVKCVPNFSEGREPATVHAIVAAVTSVPDVWLLDHSMDADHHRSVVTFIGSPEAVAEAAWRAIQTATRLIDLRRHSGVHPRVGATDVVPFVPIEGVTMDECVQLARRLGRRVGDELRIPVFLYERAATTSTRVRLERIRQGGLPGLRARMESDPSWTPDYGPPTLHDTAGAIVIGAR 180
104 2.000e-58UniRef50_F9DH23 Formimidoyltetrahydrofolate cyclodeaminase n=528 Tax=root TaxID=1 RepID=F9DH23_9BACT  ali  45  7IIECVPNISEGRNKAIIKQVTDEIERVKGVKLLDVDPGEATNRTVITFVGSPDAVLEAAFQCVKKAAQLIDMRQHHGAHPRMGATDVCPLIPVAGITLEECAKLAHKLAERIANELKVPCYCYEAAARTPERRNLAICRKGEYEGLAERM-TVEAEAPDFGARAWVARTGCTAVGAR 185
105 2.000e-58UniRef50_A0A2E7CMZ4 Glutamate formimidoyltransferase n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E7CMZ4_9PROT  ali  43  4LIECVPNFSEGRNPETISQIEQAILSVPGVTILDIKPGIADNRTVFTFVGSPEAVCEAAFQSIKTAQQLIDMRHHRGAHLRMGATDVCPLVPVKGISLKDCAVLARELGERVAEECTIPVFLYEASARTPQRQRLPDLRKGEYEALPEKLQDPLW-GPDFGPTDFNARSGGTVIGAR 182
106 2.000e-58UniRef50_A0A1F5F565 Glutamate formimidoyltransferase n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5F565_9BACT :_  ali  52  4LIEWVPNISEGRRGDVVKACVEPLKSIEGVKLLDSSSDPDHNRSVITCVGGPKGLKEATLALYARAVELIDMNQHSGEHSRIGAVDVSPYVPVRDVKMSDCDDLAKECALAVAEKFDLPVYLYRESATAPHRQSQSDIRKGEYEGLAEKMRDP-MWKPDFGPDSPHPTAGATIMGAR 179
107 3.000e-58UniRef50_A0A1Q7AGK8 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Nitrospirae bacterium 13_2_20CM_2_61_4 TaxID=1805271 RepID=A0A1Q7AGK8_9BACT :  ali  45  4LVECVPNISEGRKPETIDALVHAIQAVPGVVVLDRQSDADHNRSVLTFVGPPESVAEAAFCAAEEALRRIDLTTHRGEHPRVGATDVIPFVPIRGVTMDDCVHLARLVGHRLADELHIPVFLYEHAAKASFRTRIEDIRRGSLEGLSERMRMNPEWTPDFGDAKLHRTAGATIVGAR 180
108 3.000e-58UniRef50_Q2LUX1 Glutamate formiminotransferase n=35 Tax=root TaxID=1 RepID=Q2LUX1_SYNAS  ali  46  41IIECVPNFSEGRNREVVESIVAVLTAVSGIRLLDYSLDADHHRSVVTFIGSPDTVVAGALAACNRAVEQIDMRKHRGVHPRIGAVDVVPFIPLDDAEMKDAIAAAHSFGAIFGDQNQIPVYFYGAAALTSERRELPAVRRGGYESLEERLKDPSW-KPDAGPAVFNAKSGATAVGAR 217
109 4.000e-58UniRef50_A0A088T0E5 Uncharacterized protein n=2 Tax=Candidatus Izimaplasma TaxID=1912503 RepID=A0A088T0E5_9BACT  ali  47  3IVQCVPNFSEGRDLEKVEEIVSVLKNKEGFKLVSYEPDKDYNRTVVTLLGNPNDIIEALIPFTKKCLDLIDMNHQTGEHSRMGAIDVIPFIPIQDTTMDECVEYANTVAKKINEEFSIPIFMYAEAANIKARVKLPNIRKGEFEGMKEKIK-LEKWYPDYGNAEIHPTFGVIGVGAR 178
110 4.000e-58UniRef50_A0A0F8VHV8 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A0F8VHV8_9ARCH  ali  44  8IVESIPNYSEGQSSKKIELIVSEIKNTPDTRIVDVQYDTDYNRAVITFVGTPEAVLSANIDAAKKAIELIDMNIHKGQHPRIGAIDVVPFVPAQNVTMEECIKLSIKFAEAMAKE-GVPVYLYEESAQKMERKNIDYIRKGEFEKLKEVIKTDPERKPDYGPSELHPTAGAIITGAR 183
111 4.000e-58UniRef50_T0N264 Uncharacterized protein (Fragment) n=1 Tax=Thermoplasmatales archaeon A-plasma TaxID=667135 RepID=T0N264_9EURY  ali  45  3LVECVPNFSEGRDRKIVDEIVAAIAAVPTVRILDSEMDENHNRSVVTFLSDGSRAVEAAFQGIKRAAELIDLNHHSGEHPRFGASDVIPFIPVSGVTMKECIEMARELGKKVGEELKIPVYLYGEAAAVESRRSLENIRSKQYEQLREAIRED-KWKPDFGPAKVG-SAGASIIGAR 179
112 4.000e-58UniRef50_A0A2E1MWF2 Glutamate formimidoyltransferase n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1MWF2_9BACT  ali  46  5IVECVPNFSEGRRQSIIAKISKQIDLIDGVKLLDVDMGYDTNRTVITFAGTPNEVVLAAFNAIKRASELIDMSKHKGEHLRMGATDVCPIIPVSNISMEECIELSKKLGKKIAKELSIPVFLYEKSASNKSRINLANIRSGEYEGMSQKIKEV-GWCPDFGESEINKSAGVTAVGAR 180
113 5.000e-58UniRef50_A0A2E5FLY8 Glutamate formimidoyltransferase n=1 Tax=Solibacterales bacterium TaxID=2026791 RepID=A0A2E5FLY8_9BACT  ali  42  4LIECVPNFSEGRNIDTIQAIEREIKSVEGVFLVDQSSDIDHNRSVFTLIGEDVAVGEAILRAATTVVKRVDMSFHQGVHPRIGAVDVVPFIPLRGANHEDCIRLAARTAERLWNELEVPSYLYGLAAQKVSHCRLENLRRGGLEELIEVLPDAIERRPDVGSLVPHPTAGVCAVGVR 180
114 5.000e-58UniRef50_V1CGP1 Glutamate formimidoyltransferase n=2 Tax=Bacteria TaxID=2 RepID=V1CGP1_9FIRM  ali  43  10IVESIPNISEGRNREIVESIVDEVRNTEGCILMNYSSDKDHNRSVISYIGSPKAVEEASFRLMKKALKLIDLRKHKGEHPRMGAVDVMPIVPIKNISMEECIEISKRIGEKVARELAVPVYLYEKSSKTPERARLEVIRRGEFENLDEKLKD-EKWYPDFGKNIKHESAGALILGAR 185
115 8.000e-58UniRef50_A0A2V5JUK4 Glutamate formimidoyltransferase (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2V5JUK4_9BACT  ali  49  4LIECVPNFSEGRDLDLIRQITGAIESVDGVALLDVDPGATTNRTVVTFVGSPEGAVEAAFRAIQKAAELIDMRKHKGAHPRMGATDVCPFVPVSNVSWEEAIACAQELAKRVGDELNIPVYLYERAAKDKSRSNLSVIRTGEYEGFFEKIKQPEW-KPDFGPAVFNEK......... 170
116 1.000e-57UniRef50_A0A2V4CZV3 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2V4CZV3_9EURY  ali  41  5LVECVPNFSEGRDAEVIKAILDSVSGISGCHLLSAESDADYNRTVVTMAGEPEAVGKAAFRLISAAKEHIDMRNHSGEHPRLGAVDVCPFIPLRGITMEECANLAISLGQRVSHELGLPIYHYGAAASDESRLMLSTLRKGEYEGLQARLTEDEERWPDQGPRVWNARFGAVVIGAR 196
117 2.000e-57UniRef50_A0A0G0A2A2 Glutamate formiminotransferase n=6 Tax=root TaxID=1 RepID=A0A0G0A2A2_9BACT  ali  42  4IVECVPNFSEGKNKKIINAIFDASAQGKPVKVFELEYNASHNRMLFTIVGSPEDVLNSVFESIKVASKLIDMNSHVGEHPRIGAVDVVPFVPVSGVSMEECVKLSNKLAKKVADELKIPVFMYEASAKKEEYRNLADVRVGEYEGIKKVM-----RKPDYGPDKPHPTAGAVVIGAR 178
118 2.000e-57UniRef50_A0A2M8FZ00 Glutamate formimidoyltransferase n=1 Tax=Deltaproteobacteria bacterium CG_4_9_14_0_2_um_filter_42_21 TaxID=1973964 RepID=A0A2M8FZ  ali  44  5LIECVPNISEGKDFQKLERFADCLKNVPTLQLLHLDADPIANRTVMSFVVSPHNLEKAATALYSSVLETIDMRQHHGLHPRMGAIDVFPLVPFKNISLEECIAFSLKMAKKIGEEFSIPVFMYAYSTQNSLRQKLHHIRKGEFENLAQKLSQSEW-KPDYGPITPHPTFGATAIGAR 180
119 2.000e-57UniRef50_A0A1I8FZI7 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8FZI7_9PLAT  ali  43 1230LIECVPNFSEGRCKDTIDRIAAAISVTKSVKLLDVDPGASTNRTVYTFVGGPEDVVEAAFNAARVAQQLIDMRNHSGEHPRLGAMDVCPFVPVRNATTEDCVDCARRLGERLGRELDVPIFLYGFAASADYRRSVPQIRSGEYEGLAARLDQPEWR-PDFGPAESRPAWGASMVGAR 1405
120 2.000e-57UniRef50_A0A151EDK1 Uncharacterized protein n=8 Tax=Euryarchaeota TaxID=28890 RepID=A0A151EDK1_9EURY  ali  43  4IVECVPNFSEGRDKSIIYAISAAIESVDNVKLLDVDAGADFNRTVYTFVGEPEPILEAALKAAKVGISLIDMTKHKGEHARMGALDVCPFIPIKGVTDKECVKLSKEFGEKMAKELGVPVFLYAKSATKPDRVRLPDIRKGEYEALEEKFKDPS-FKPDYGKPIFIPKSGATATGCR 179
121 2.000e-57UniRef50_A0A1F6GGB4 Glutamate formimidoyltransferase n=2 Tax=Candidatus Lambdaproteobacteria TaxID=1817794 RepID=A0A1F6GGB4_9PROT  ali  44  3LIEAVPNFSEGRDNQTIQLIAQALASVPKVTLLHLDAGMDANRTVYTLIGPPDLVLDALLKASKIAFERIDMRQHQGNHPRIGALDVCPLIPLSKITLDETIRLSQQLGKSLAETHQLPVYLYAQSASSPKRKDLASIRKGGYEALGDKLSLPEW-APDFGPILPNPRLGASVVGVR 178
122 3.000e-57UniRef50_A0A256ZHZ2 Glutamate formimidoyltransferase n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_135 TaxID=2012509 RepID=A0A256ZHZ2_9ARCH  ali  46  13LVCCTPNFSTS-DPEVVEAILEALRSVEGVFVLDHTYDEHYNRLVVVFAGEGEVVLEAMLKAAKVAVERIDMRYHRGQHPRIGAVDVVPFVPLAGTDMEYCVELAREFGRRFAEECGVPVYFYAEAATRPERRSLDWIREGEFEKLEEMMAKP-GREPDFGPRKPHSTAGATAVGAR 187
123 4.000e-57UniRef50_A0A075GWY2 Glutamate formiminotransferase (FTCD) n=56 Tax=cellular organisms TaxID=131567 RepID=A0A075GWY2_9EURY  ali  44  30LVECVPNFSEGRDDTVIDDIVKSASGIDGCRVLSSEPDADYNRTVVTIAGNPEAVSEAAFRLISRAKELIDMRQHQGEHPRIGAVDVCPFIPLRDSTFAECATLANSLATRVAGELNVPVFLYGHAASIPERRVLSDLRRGQYEGLQERLSDGETRYPDLGPQEWVARFGAVVIGAR 215
124 4.000e-57UniRef50_A0A0M8K737 Glutamate formiminotransferase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0M8K737_9CHLR  ali  48  7LFECVPNFSEGRRAEVVQAIWNAIAAVPGVRVLNLHMDADHNRSVITFIGTPEAVEEAALQAAKTAAALIDLRQHQGEHPRIGATDVIPFIPLEAATLDDAVHLARRVARRLAEEVGIPTYLYGAAAQRPERRRLADIRRGGYEALVDAIQHDPARAPDFGPAALGP-AGATAVGAR 182
125 5.000e-57UniRef50_A0A1V5M036 Methenyltetrahydrofolate cyclohydrolase n=22 Tax=root TaxID=1 RepID=A0A1V5M036_9BACT  ali  44  14LVECVPNFSEGRDRKIIDAIADAIAAVSGVRLLDVDPGASTNRTVMTFVAPPELIVEAAFQAISKAAQLIDMRKHRGEHPRMGATDVCPFVPVTGVSMEDCVKLAEELGKRVGAQLGIPVYLYAEAARKDSRRSLADIRQGEYEALCEKMKSPD-FQPDFGPNQFNAVSGATVIGAR 189
126 5.000e-57UniRef50_A0A2M8Q3L9 Glutamate formimidoyltransferase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8Q3L9_9CHLR  ali  43  5LVECIPNFSEGRRPEVIQAIVQSIRRAGAVYMLDVSSDADHNRTVVTFAGPPEEVEKAAFVGIKTAAELINMNEHQGVHPRFGAADVIPFVPLRDVKMAECVRIAQRLGERVGNELKIPVYLYEFAATRADRRNLAQIRSPQYEQLKDAIQTDPNLTPDFGPAIVGD-AGACIIGAR 182
127 8.000e-57UniRef50_A0A0S7BMX6 Glutamate formiminotransferase n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A0S7BMX6_9CHLR  ali  40  4LIECVPNFSEGTNPNIIKTIADAINADDSVKMINIHSDKDHNRSVFTLIGSPQSIQAAAFRGIEKAAACINLNNHIGTHPRIGAADVIPFIPLRNTSMEDCIKVARDVGKRVGEELNIPVFLYGQAAICQDHSNLSDIRRGEYEKLRLLIGTDRAHTPDYGPLYIGQ-AGASAIGAR 180
128 1.000e-56UniRef50_E1GXU7 Glutamate formimidoyltransferase n=4 Tax=Prevotella amnii TaxID=419005 RepID=E1GXU7_9BACT  ali  41  7IVECVPNISEGRDEEIIKEIATEIEKVKGIKLLNIDSGKAANRTVMTFVGSPEDVVEAAFCCVQKSSQLIDMRQQHGAHPRIGVTDVCPLIPISGITLEECASLACTLAERIATELKVPCYCYEAAAKIPERRNLAVCRKGEYEGLKERMMIPKEF-PDFGARPWDARTGCTAVGAR 185
129 2.000e-56UniRef50_A0A0T5ZHR2 Putative glutamate formiminotransferase, glutamate formiminotransferase n=11 Tax=cellular organisms TaxID=131567 RepID=A0A0T5ZHR2  ali  46  4LVECVPNFSEGRRPEVVDAIAAAVAAVPRVHLLDRTSDADHNRSVLTFAGEPDAVAEAMEDAVAVALQLIDMEKHEGQHPRIGAVDVVPFVPLGDSTMEECVELARRFGARIAARFELPVYLYAQAATRAERLVLADIRKPQFEGLKTQIGHV-GREPDYGPSRLHPTGGAVAVGAR 179
130 3.000e-56UniRef50_A0A146US56 Formimidoyltransferase-cyclodeaminase (Fragment) n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146US56_FUNHE  ali  39  20.....PNFSEGRDKQVIDAISAAISETPGCSLLDVDPGASTNRTVYTFVGPPEAVVEGALNAARRAFGLMDMSKHSGEHPRTGALDVCPFVPVQNVSMDDCVRCADEFGRKLAEMLRVPVYLYGEAARSDSRRNLPSLRSGEYEALPEKVRLFAEWAPDFGPALFVPSWGATVTGAR 215
131 3.000e-56UniRef50_A0A1I7NHH4 Glutamate formiminotransferase n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A1I7NHH4_9BACT  ali  46  10IIEAVPNFSEGRDQAIIRQITDAMRLREGMRILHVDSGIAANRTVVTLAGSPDAVTEALFEGIRKATELIDMRRQQGVHPRLGATDVCPLIPLQHVSMQQTVQLARKLARRVGEDLQIPVFLYEAARLREERKRLATIRKGEFEGLAQKIQDV-AWQPDYGPAIPHPTAGAIVIGAR 191
132 4.000e-56UniRef50_A0A0F9RUV0 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9RUV0_9ZZZZ  ali  42  4IVLCVPNISQGRDQAVISRIAGAVKAVPDAAVLDVDSGEDTNRTVITFAGPPDAVADAAFGLIAAAVELIDMAAHTGSHARMGAADVCPFIPVADVTIERCVGLAKDVGRRVAAELVVPVYLYGYAATRPERVKLSDIRRGEYEGLAARLADP-AFKPDFGPAQFIPKSGATAIGVR 179
133 7.000e-56UniRef50_A0A2N1QMA6 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Synergistetes bacterium HGW-Synergistetes-2 TaxID=2013843 RepID=A0A2N1QMA6_9B  ali  45  7.VHAVPNFSNGKDPEVFEAVVDQIRKAPGVKLIDYFPDADFNRTVIECLGEPKPLKAALLAMAGKSYELIDMEKQHGKHPRIGAQDTIPVFPLRNISLEECAALAEEIGTEVWERYKVPVYFSGENARTPERKELSFIRKGQYEGLK-EVAHLPERAPDLGPAKLHPTAGATIVSA. 180
134 7.000e-56UniRef50_A0A2A5A460 Glutamate formimidoyltransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5A460_9BACT  ali  44  10IVECVPNISEGRDRQKIDLIVAAAAAVENVDVLDVDPGSETNRTVITLVGPPDPIAEAAFRLVEKAAELIDMSSHQGAHPRHGATDVCPFIPVSEISMEQCIEIARAVGKRIGEELEIPVYMYDRAALREDRMSLADVRRGEYEALPEKM-TDEQWKPDFGPARFLPGPGVVTVGAR 185
135 9.000e-56UniRef50_A0A2M8PHJ0 Glutamate formimidoyltransferase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PHJ0_9CHLR  ali  46  14LVECVPNFSDGRRPQVLEAIVSAIQRAAPVSVLDYSSDHDHNRSVVTFVGAPDDVLEAAFAAIQIAAQLIDMEVHRGQHPRIGATDVVPFVPLRGITLEQCAELARRLGERVGTELGIPVYLYEAAARRPERQNLEAVRRGEYEGLKSAIQSDPERAPDFGPSQLG-KAGAVAIGAR 189
136 1.000e-55UniRef50_A0A2N1V044 Glutamate formimidoyltransferase n=1 Tax=Candidatus Melainabacteria bacterium HGW-Melainabacteria-1 TaxID=2013813 RepID=A0A2N1V04  ali  42  50LLECVPNLSEGRDLAAIDRLWRQLGAIHGLRCLHRTSDPDHHRTVLTLAGSPESLRAAAHTLFEWALGQIDLRQHQGVHPRIGAIDVLPIVPLRGIDWGEAISFSRDPGAELASRWQLPIYLYEYSASQAQRVALPDIRRGGFEGLGEKMTKPDW-APDFGPDQPHLSLGATVLGVR 225
137 1.000e-55UniRef50_A0A2V9JLN7 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JLN7_9BACT  ali  47  4VVECVPNFSEGRRKEVVDA-LAAALTGAGAALLDSEMDAAHNRSVLSIAGEPEAVARGVLEAVGKAAELIDLRTHRGEHPRIGATDVVPFIPIAGVSIEECVALSQRVAQAITQRYGIPVYLYEQSARVPARQDLAYIRKGEFEGLREEVRTNPERRPDFGPPELHPSAGATVVGAR 179
138 1.000e-55UniRef50_A0A2E2NWQ0 Glutamate formimidoyltransferase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2NWQ0_9FLAO  ali  40  4LVECVPNFSEGRDQITIAAIERAIKAVNGVYLLHTDSGVAANRTVYTFVGSAEAVIEAAFQGAKVAAEMIDMEYHGGEHPRMGALDVCPFVPISGISKKQLIPMVEKFGKRLNEELGIPVFFYEDSAKKKERRNLANHRSGGYEQLEERMKK--SWKADIG-KEFNPTTGGTVCGVR 177
139 1.000e-55UniRef50_A0A2M7G3D3 Glutamate formimidoyltransferase n=1 Tax=bacterium (Candidatus Blackallbacteria) CG17_big_fil_post_rev_8_21_14_2_50_48_46 TaxID=2  ali  46  5LLECVPNLSEGRNLPALNGLTQELNQIKGLYLLDFSADADHHRSVFTLAGSPEAIEAGLNQIYTWSLKHIDLRRHQGAHPRIGAVDVAPLIPLQGISTEEAVQFSLGLAQNLAQRFQIPIFLYESSALLKQRTNLAVIRKGQFEGLAEKMKQPEW-QPDFGPSAPHPRLGATALGVR 180
140 1.000e-55UniRef50_A0A2E3RLM1 Glutamate formimidoyltransferase n=9 Tax=Bacteria TaxID=2 RepID=A0A2E3RLM1_9BACT  ali  47  3LIECVPNFSEGQNKEIIDQIVMQITSVKGVKLLDVDPGKDTNRTVVTFAGHPDDVINAAFLAISKASQLIDMKHHKGAHARMGATDVXPXIPISGVTEKECIEYSXKLAKKVGEKLKIPVFMYEXSAKAKNRQNLAIIRQGEYEGMGEKLKLKEW-TPDYGPNKLNVKSGVTAIGVR 178
141 1.000e-55UniRef50_A0A2N2P147 Glutamate formimidoyltransferase n=15 Tax=Chloroflexi TaxID=200795 RepID=A0A2N2P147_9CHLR  ali  42  5LVECIPNFSDARRPEVIKQILDSIQAVPGVHVLDHHSDMDHNRTVVTYVGTPAAVEEAAYQAIAKAAQLINLDDHQGEHPRMGASDVVPFVPISDVSMQECIEMARRLGKRVGESLQIPVFLYEDAASIPEKQNLENIRRGQYEAIKSEIGSSPVRTPDFGPCLVGP-AGATVIGAR 180
142 2.000e-55UniRef50_A0A2E1X0J7 Glutamate formimidoyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2E1X0J7_9BACT  ali  45  10LVECVPNISEGRDRQKIDLIVAAASAVDDVDVLDVDAGADTNRTVITLVGPPDPIAEAAFRLVEKAAELIDMSTHQGAHARHGATDVCPFIPVSGISMEQCIEIARAVGKRIGEELEIPVYMYDRAALREDRMSLADVRRGEYEALAEKM-TDEQWKPDFGPAHFLPGPGVVTVGAR 185
143 2.000e-55UniRef50_A0A1F5REB4 Glutamate formimidoyltransferase n=1 Tax=Candidatus Eisenbacteria bacterium RBG_16_71_46 TaxID=1817856 RepID=A0A1F5REB4_9BACT  ali  48  4LIECVPNVSEGRRREVVDRLVQEAATVGGVTLLDSEMDADHNRSVITFAGEPEPVMEAAFRLARRAAELIDLNRHSGQHPRMGATDVIPLVPVEGVTLEDCAEWARQLGRRIGEELSIPVFLYEAAAARPERVSLADVRRGEFEGLRAAIGRDPARRPDFGPERIHPTAGAVAVGAR 180
144 2.000e-55UniRef50_A0A1Q9NPI3 Methenyltetrahydrofolate cyclohydrolase n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_2 TaxID=1841597 RepID=A0A1Q9NPI3_9ARCH :  ali  40  4IVECVPNFSTA-DAIVIKEISKAIKSVNGVKLLNVEPDGDYNRVVVTFVGTPNKVGEAAFQALAKATELIDMQLHKGEHPRLSACDVTPFIPVKDVSIEDCVQIAKTLAERVASELKVPTYLYGDAATSEDRKLLSNIRKGQYEGLAEKILLPEW-KPDFGEVKFVAKSGAYVIGVR 178
145 2.000e-55UniRef50_T1C061 Glutamate formiminotransferase n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1C061_9ZZZZ  ali  48  4.FECVPNFSEGRDESKIRRIADAARTVPGVAVLDVEWNADHNRCVITLVGEGESLVNAVMGMMTVATEVIDLTHHTGEHPRMGATDVVPFVPLGGATVEEAVRLAERLGERVWKELGIPVYLYGSAARRPERVDLPAVRKGGFEGIREEIGKNPDRAPDVGEPRVHPTAGAVAIGAR 179
146 3.000e-55UniRef50_A0A2E8GAB1 Glutamate formimidoyltransferase n=1 Tax=Nitrospiraceae bacterium TaxID=2026770 RepID=A0A2E8GAB1_9BACT  ali  43  4LIECVPNFSEGRVIATIDALADVIRSNPELSLLDRQSDVDHNRSVFTFVGRSNAIETTAFELAKTAKALIDLRQHQGVHPRIGSTDVMPFVPLKLADTHECVALAKAVGSRIASELNIPVFLYEQATTTMSRV-LEDLRRGSVEGLRKRMRNDPKWEPDFGALYPHPTAGVMAIGVR 179
147 3.000e-55UniRef50_A0A0S7ZNL2 Uncharacterized protein (Fragment) n=4 Tax=cellular organisms TaxID=131567 RepID=A0A0S7ZNL2_9SPIR  ali  38  3IVECVPNFSEGRNREVIGRIADAIRCVQGAILLDVSSGFDTNRTVYTFAGTSDDVLAAAYSAVETGLQLIDMSTHRGAHPRLGACDVCPFVPVTGVNMDDCIALAHALGERVGHTLNIPVYLYAEAARVPERKALESIRAGEYEGLEAKLRDPGWR-PDYGTAQYTKRSGALITGAR 181
148 3.000e-55UniRef50_A0A2M7UP42 Glutamate formimidoyltransferase n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_38_24 TaxID=1974774 RepI  ali  44  4LIKCVPNFSEGRDKAKIKLIEDSIKKVKGILFLNSESDIDHNRTVITFAGEPIKVIEAAFNAIKTAAKIIDLNVHKGVHPRIGATDVVPLIPLKGITIKETVKYSIALAKRVGEKVKIPVYLYENSAIRKDRKNLALIRKGQYERLKKEITLPEK-TPDFGLQKMGP-AGATVIGVR 178
149 3.000e-55UniRef50_A0A2N1VDP6 Glutamate formimidoyltransferase n=21 Tax=Bacteria TaxID=2 RepID=A0A2N1VDP6_9BACT  ali  43  3VIECVPNFSEGNNPELFEAIKESISKINGVKLLSLEPDADYNRVVVTLAGNEKGILDGTVSACKIAAQYIDMRRHKGEHPRLGAIDVVPFVPVANVTTEECVKISKDFAGIISKELNVPVYLYESAALKDDRKNLSSIRQGEYEGLEEKLKDPNW-APDYGEAVFNPKLGAIVTGSR 178
150 5.000e-55UniRef50_A0A090HW18 Glutamate formiminotransferase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A090HW18_9FIRM  ali  44  4IIECVPNFSEGRDQKVIDQISDEIKKVEGVEIWDILTDKDHNRTVITFVGDGDSVKKAAVNSAIKAAELIDMRKHKGAHPRIGAVDVVPFIPLVNCDIEKCVDIANEVGKTLADKLDIPVYMYGKAAKRKYLENLGHVQNIQYENLFEKIKE-EEYAPDYGKATLSERTGGSIVGAR 179
151 5.000e-55UniRef50_R5J747 Glutamate formiminotransferase n=1 Tax=Bacteroides sp. CAG:189 TaxID=1262737 RepID=R5J747_9BACE  ali  66  6IIECVPNFSEGRDLKKIDKIVSPFRARSGVKLLDYSNDEDHNRLVVTLVGEPAALCDAVIEAIGIAVELIDLNHHTGQHPRMGAVDVVPFIPIKNVTMEEAIALSKEVGAKVAELYHLPVFLYEKSASAPHRENLAVVRKGEFEGMAEKIKLPEW-TPDFGPAERHP.......... 171
152 8.000e-55UniRef50_A0A0F9Z5Y1 Uncharacterized protein n=1 Tax=Candidatus Peregrinibacteria bacterium GW2011_GWC2_33_13 TaxID=1619061 RepID=A0A0F9Z5Y1_9BACT  ali  41  4IIECVPNFSCARDVKVLEQILTAIKSVKNVSVLNVHKDDDHNRSVVTFVGEVEDVFNAAFEAVKTASKLINLNDHKGMHPRIGATDVVPFIPIKNVSMSECVKLALELGEKIGEELKIPVYLYEKAAKIKDRENLANIRNHQYEKIKKEIAKNDFFKPDFGPRKMG-NAGAICVGVR 179
153 9.000e-55UniRef50_A0A1F4TQX6 Glutamate formimidoyltransferase n=7 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A1F4TQX6_9BACT  ali  40  4LIECVPNFSEGKDLELVADIVSAIKT---AKVLNVHSDPDHNRTVVTIVGEPDAVQLAAFDLTQRAMQLLDINKHEGEHPYIGVVDVVPFIPIKDISVAETVDVAREFGEKVATKFALPVYFYGAAAKIAEHKELPNVRRGGYKVLKEEF-TNARRKPDLGD-KLHPHAGALAVGVR 175
154 1.000e-54UniRef50_F4PYZ7 Uncharacterized protein n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4PYZ7_CAVFA  ali  44  18IIECVPNFSEGRDQKIIDSIAKSISSIQGCQLLNVDPGVSANRTVYTFVGTPDQVVDAAVAAARTAYNLIDMAKHVGEHPRIGSLDVCPFIPVRNATIQDCIDCSIRFSERVATELNVPLYLYEFSSTKPHRKQLRQIRSGQYEGLAEKIVS-EGWEPDYGPREFVPRYGATVTGAR 194
155 1.000e-54UniRef50_B2KCG2 Glutamate formiminotransferase n=1 Tax=Elusimicrobium minutum (strain Pei191) TaxID=445932 RepID=B2KCG2_ELUMP  ali  43  3MIECVPNISEGKNEAVIYQITEAVKKH-NVKILSVEPGEDANRTVITFAGLKENIGAAAYACIEKAYELIDMSKHKGRHPRQGVVDVCPFIPLSGATMQDCVDISKSTAKKVACNLGLPVYLYENSAADESRRNLAVIRKGGYETLEEKLKNLP---PDFGPHEITPKVGAITIGAR 178
156 1.000e-54UniRef50_A0A0B6WWY6 Glutamate formiminotransferase n=1 Tax=Pyrinomonas methylaliphatogenes TaxID=454194 RepID=A0A0B6WWY6_9BACT  ali  45  4IVECVPNFSEGRRRDRIERIVAAIESVPEVAVLDVHADADHNRSVVTFIASPERVVEAAVRAVACAKELIDLRQHTGLHPRIGAADVVPFVPLRNVSMEECVELAHEAGERIWNELNIPVYFYERAALRPDRVNLEDVRRGGFERLREAVQKDAARAPDIGEARLHETAGACIVGAR 180
157 2.000e-54UniRef50_A0A1Q7YHK7 Glutamate formimidoyltransferase n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7YHK7_9BACT  ali  40  4LVECVPNFSEGRTEETIARLVDVIESVKGAVVLDTHMDADHNRSVITFVAGAETVVEASVRAAALAAELIDLRSHTGEHPRVGAMDVLPFVPVRGVTMEDCIGLAHAAGERIARELQIPVYFYERAARRPDRVNLEDVRRKGFEELRDEIEIIDARAPDIGDRRVHESAGAIVVGAR 180
158 2.000e-54UniRef50_A0A2E1SP88 Glutamate formimidoyltransferase n=15 Tax=cellular organisms TaxID=131567 RepID=A0A2E1SP88_9EURY  ali  40  5IVECVPNISEGRDIDKIERIVDAARM-EGVKILGVEPDPDYNRTVITFAGSQDXVERAALGXIKKAIEEIDMRTHTGEHPRMGCVDVCPFIPIRGVTMHDCVAMAQRVARQVA-EQNVPVFLYGFASSSDMRRSLSALRKGEYEGLKDRVHTDDTRMPDFGSDEWNQKSGGITIGAR 188
159 2.000e-54UniRef50_A0A2E1MGH9 Glutamate formimidoyltransferase n=13 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1MGH9_9BACT  ali  42  4IIECVPNISEGRNQSIINNIVSSSNNIEKAKIVDVDSGYDTNRTVITIVGEPNAVLKCAYNIIKKSLELINLNKHTGTHARMGSTDVCPIIPIENISMDDCIELSKQLGKDVAEKLNLPVYLYEKSALLNERINLANIRKGEFELMGAKIKEK-KWQPDYGKASIHPTGGVIAIGAR 179
160 6.000e-54UniRef50_A0A1B3WS62 Glutamate formimidoyltransferase n=1 Tax=Anaerolineaceae bacterium oral taxon 439 TaxID=1889813 RepID=A0A1B3WS62_9CHLR  ali  43  9LIEAVPNFSDGRNPETIEALRNAVRLTPSVRLVNVHQDADHNRSVFTLIGEGEPLRECALNLVGVAAERIDLETQRGVHPRIGATDVVPFVPLRNASMDDCVRLAREAARQISERYPIPTYLYALASIRPDRTKLSELRRGNYERLKTAIGNDPYFEPDFGPKRL-ASAGATAVGAR 184
161 7.000e-54UniRef50_E3CWQ6 Glutamate formiminotransferase n=51 Tax=Bacteria TaxID=2 RepID=E3CWQ6_9BACT  ali  45  4ILLCELNMSEGTDVAAIEKVTAALRGTPGVTVMDVDSDKDHNRTVYTWIGEPEDVLAGAQNLTEKALEIIDMSRHHGSHPRMGAVDVVPFVPVRGVEKEEALEIARRYGAFLGSK-GVPVYYYEEAATKPSRQNLVDLRKGQYEALEKKMKD-EAWRPDEGPFAFVPRWGATVTGVR 178
162 8.000e-54UniRef50_A0A180ESR7 Glutamate formiminotransferase n=3 Tax=Lewinella TaxID=70994 RepID=A0A180ESR7_9BACT  ali  42  7LIECVANVSEGRSLDVLDQLSAAIDAVPGCQLLHRDANVSAHRTVFTFAGTPEGVTEAAFQLYATAQRLIDMQQHSGEHPRIGAVDVCPLVNIKDVSQAELVALSQVLGMRVGEELQIPVFLYEQSATAEHRRNLATIRKGEYEGLEQKTKSPDW-KPDFGPD-YDAKFGATVLGAR 181
163 8.000e-54UniRef50_A0A2E1W266 Glutamate formimidoyltransferase n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E1W266_9BACT  ali  42  17LIEAIPNISEGKRTSVIEAFKVAVCGAADVELLNQSSDAAHNRTVFTLVGTPAGLTNALIALYDVAVRNIDLRTHRGEHPRIGAVDVVPLVPLAPTDMPLCVATATTLAETIASQFDLPVYLYADTATHQNRRRLEQIRSGEFEGLSSKMSQPTWR-PDFGPTRPHPSAGASVIGAR 192
164 9.000e-54UniRef50_A0A239RIQ0 Glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase n=4 Tax=FCB group TaxID=1783270 RepID=A0A239RIQ0_9BACT  ali  42  7IIECVPNFSEGRNEETIRTIGNAIAACPGVKLLDVDPGEATNRTVITFVGEPEAVCEAAFKAVEQAARLIDMRRHHGAHPRMGATDVLPLVPVSGVSLAECAELARRLARRIADELRIPTYCYEAAALKPERRNLAVCRAGEYEALPDKLAD-AGKAPDFGARPYDARTGCTVVGAR 185
165 1.000e-53UniRef50_A0A2T2XER1 Glutamate formimidoyltransferase n=1 Tax=Sulfobacillus benefaciens TaxID=453960 RepID=A0A2T2XER1_9FIRM  ali  43  3.VESIPNFSEGQNLGTLDQILQAA-SIDGVKVLGFEGDGDHNRSVLTIAGEGDRVVEALFRAIEVAVSTIDLTQQQGTHPRLGAVDVVPFVPLGQTPMSYAVDLAQQLGEQVATQLKVPVYLYEHAATKPEHKNLADVRRGQFEGLTERMKHDP---PDFGEAIPHPTAGATVIGAR 174
166 1.000e-53UniRef50_A0A2D8SNI0 Glutamate formimidoyltransferase n=2 Tax=Owenweeksia TaxID=267986 RepID=A0A2D8SNI0_9FLAO  ali  41  3LLECVPNLSEGRDERKMQLFADAIRSVKGVRLLHQDSGYAANRTVYTFAGDPESVIEAAYRLYSLAWNEIYMPLHQGTHPRQGAVDVCPLVPLQDMDLSEAKEWASLLAARIEKELGTPGYFYEANATAPERSNLAVLRKGEYEALPDKFHLLP---PDFGDPNQWKRNGVTVLGAR 176
167 2.000e-53UniRef50_A0A2G0CDH5 Glutamate formimidoyltransferase n=2 Tax=Lewinella TaxID=70994 RepID=A0A2G0CDH5_9BACT  ali  42  7LIECVVNVSEGRNAATLEAIATAISAVEDCYLLHRDVGPGAHRTVFTFAGPPEAVFAGALAVYEVAAARIDMREHRGTHPRSGAVDVCPFVPISGISLEEVAARTRVLGQLLAERFDLPVFLYAASATSPDRFGLEQVRRGEYEGLAAKLQLPEW-QPDFGPSIPHPRLGATVMGAR 182
168 2.000e-53UniRef50_G8TXX6 Uncharacterized protein n=2 Tax=Sulfobacillus acidophilus TaxID=53633 RepID=G8TXX6_SULAD  ali  46  3.IESIPNFSEGRDAETLEALKRSVEGIPGVYRLGFEADPDHHRSVMTLAGEPTALVEALVRVSRVAVERIDLRRHQGTHPRIGAVDVIPFVPLSGASLPDAVSVSRRLGERLAAELQLPVFYYEASALKPERKNLAAVRRGQFEGLADRMAKDP---PDVGPIRPHPSAGAVAVGAR 175
169 4.000e-53UniRef50_A0A1V5HPW0 Uncharacterized protein n=1 Tax=Tenericutes bacterium ADurb.BinA124 TaxID=1852921 RepID=A0A1V5HPW0_9BACT  ali  45  4IIEIVPNYSEGKNADIMQKIIAPFQNNPLISLVDLEMDASYHRSVVTIIGEAQTVLRQMVESAKIAASLIDMRRHSGEHPRMGAIDVCPLIPIQNITEQECIDLSRKLAQNINEASQIPIYLYAKSASNEQRSLLPNIRQGEFEGLATKMTNPEW-APDFGEAKPHPSAGALAIGCR 179
170 5.000e-53UniRef50_A0A1G6K8W6 Glutamate formiminotransferase n=1 Tax=Geotoga petraea TaxID=28234 RepID=A0A1G6K8W6_9BACT  ali  38  3LLGAVPNISEGRNKELIDEIVKLAEKYDNIWILSTNMDEYYNRTMLSIAGKPICVENFLFDLTEFCSNNIDLNKHKGEHPRIGAVDVIPLIPIMDVSEKEASEIADRLSKRISNDLNIPIYSYEKSTNKNIRKHISYIRKGGFESLKEKMKD-ENWKPDYGPDKPHPKSGATIVGVR 178
171 5.000e-53UniRef50_A0A2N6LR31 Glutamate formimidoyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2N6LR31_9CYAN  ali  39  7LVECVPNVSEGRNKKVIQEIADVISSVPEVMLLNVDSGISANRTVYTFIGQVDAVFEAAYLMYQKAYELIDMSKHQGSHPRIGAVDVCPFVAWKDISEQELIDKVAKFAQKVADTLGVSGYFYEKNARSNMRSNLANIRKGEYEGLMEKLKE-RAWRPDFGEVNPDRKFGVTVIGTR 184
172 5.000e-53UniRef50_A0A2D5NI00 Glutamate formimidoyltransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5NI00_9BACT  ali  42  4LLEFVPNFSEGKDQAVVDAVVSQMTAVAGVTCLSAELDGSHNRAVVTLAGEKAAVAEAAFVGAKAAMERIDLRGHVGEHKRMGAMDVCPFVPLGGATMAAAVSTARAVGERIGAELGLPVFLYAEACTREDRRKLGNIRNKQFEGLQELVGSDEDYAPDFGPARMHESAGAVGVGAR 180
173 6.000e-53UniRef50_Q9HI69 Glutamate formimidoyltransferase n=16 Tax=root TaxID=1 RepID=GLFT_THEAC  ali  43  3LVECVPNFSEGRDRDRVNRIRDAIASVDTVKILDVEMDPNHNRSVITFVCDSSKAVDAAFAGIKAAAEIIDMDAHRGEHPRFGAADVIPFVPLQDTKMETCVRLARDLGKRVGEELGIPVYLYAEAAQRPDRSDLAAIRNKNFQYEQLKEAIKEEWKPDFGPSVVG-KAGASIIGAR 179
174 8.000e-53UniRef50_A0A2V7Z7S2 Glutamate formimidoyltransferase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7Z7S2_9BACT  ali  48  26LLESVPNVSEGRRPEVVARLAAAASSGSGVRLLDLSSDPDHNRSVLTLAGEPEGLHQGLTALYETALAEIDLTRHQGVHPRIGAVDVVPFVPLGDTPMEVAVAAANRLAPGVARRFGLPVYLNERAARVPERTVLANIRRGGFEGLTARLADP-AWAPDFGPPYPHPTAGATVIGAR 205
175 8.000e-53UniRef50_A0A0X8FB73 Glutamate formimidoyltransferase n=5 Tax=Aerococcus TaxID=1375 RepID=A0A0X8FB73_9LACT  ali  44  4LFEAVPNFSEGRDQEVVEALAQEARSVAGVVLLDYSADVDHHRSVFTLMGTGPQLIEALIKMTTVAVEKIDLNQHQGEHPRMGALDVCPFIPLGQTSMDQACRMAEALAERLAADFDLPVMLYGEAASQPSRNRVADIRRGGFEGLADKLADPAWQV-DYGPQAPHPSAGMTAVGAR 179
176 1.000e-52UniRef50_A0A1W1I278 Putative Formimidoyltransferase-cyclodeaminase n=5 Tax=Nitrospirae TaxID=40117 RepID=A0A1W1I278_9BACT  ali  45  4LVTCVPNFSEGRNRTTVHALIRAVQSVPGVMLLDWTMDPDHHRSVLTFVGEPDAAADAAFRAIRVATRLIDIRKHRGVHPRIGATDVVPFVPAKGVTAHDCVRLARRLGERVGRQLEIPVFLYEQAAAGPDRAPLESVRRGGLEGLARRMRSDRRWRPDFGPATLHRTAGAVVIGAR 180
177 1.000e-52UniRef50_A0A0C7NT02 Glutamate formimidoyltransferase n=15 Tax=Petrotogaceae TaxID=1643949 RepID=A0A0C7NT02_9BACT  ali  38  6LIETLPNISEGRNSELIRQIKNLADNFDKVWFISCKSDEYFNRSFISIVGDISEIDSFLYETVKICIEKIDLTKHSGHHPRIGAVDVVPIVPLIGVNFEEANYLVEKLSQKISNDFNLPVYLYEKSARYKERQNINNIRKGEFEFLEKKMKLPEW-KPDYGPSKPHPTAGATIIGVR 181
178 2.000e-52UniRef50_A0A0F9Z3R0 Glutamate formiminotransferase, glutamate formiminotransferase n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 Re  ali  38  4IIECVPNFSTS-DPKILNQILDEIKKIPEIKILDFSSDVDHNRSVVTFTGNEKNILNGAYNAIKKASEIIDLNKHSGVHPFIGATDVVPFVPLRNSSMDECCQIAEKLGKKVGKNLKIPVYLFEYSAKRPERKNLSHIRNQGFLKLENEIKTNEDLNPDFGPKKIG-SAGGICIGAR 178
179 2.000e-52UniRef50_A0A1Q7SBG9 Glutamate formimidoyltransferase n=4 Tax=root TaxID=1 RepID=A0A1Q7SBG9_9CHLR  ali  42  4LVECVPNFSEGRRSDVITAIGDAIRAA-GARVIDVQADAAHNRMVVTFVAEPDLAVEAAIAGAAVATERIDLRRHLGEHPRMGATDVVPFVPFADLPMSVCVDLARRFGSRLWTELRVPVYYYGEAATRPDRRELERVRRGGFEDLLAHLGDPD-RAPDEGPPTVHPSAGATAVGAR 178
180 2.000e-52UniRef50_C1F119 Glutamate formimidoyltransferase n=27 Tax=Bacteria TaxID=2 RepID=C1F119_ACIC5  ali  47  13LIECVPNFSEGRDEQAIHKIIAAM-AVEGVQLLDYSLDHDHNRSVVTIAGHPAAVQEAAIRAAGAAAELIDLTRQQGVHPRIGAADVIPFVPIRGISLEQCALIARQAGREVWRRYGVPVYFYEAAAARPDRAQLEEVRRGQFEGLREAVRNEPARRPDVGGPELHPTAGAVAIGAR 188
181 2.000e-52UniRef50_A0A2E4N1L4 Glutamate formimidoyltransferase n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E4N1L4_9BACT  ali  39  49LVECVPNFSEGREQKTVDAIVGAIDRESGVRVLHVDSGKAANRMVVTFVGEADAVERAAFYGIETASELINMRTHRGAHPRLGATDVCPFVPIGEKPIQDCIDIAERLGERVGSQLGIPVYLYAEAARAGTRQSLSVIRQGEYEGLEVKLADPAN-APDFGDPVFNAQSGATSIGAR 224
182 4.000e-52UniRef50_T0LAV0 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon I-plasma TaxID=667138 RepID=T0LAV0_9EURY  ali  43  4.VECVPNFSEGKDRAKVESIIDSMKKYP-VDVIDVEMNADHNRSVVTVVGDGDSMVNAMFKSIKRASELIDLDAHKGEHPRFGATDVVPFVPILGTTMEYCIELSRRLAERVGNELGIPVFLYANAANTPSRKELPDIRKFQYEQLKEAIATNEKYFPDFGPKRLG-KAGATIIGAR 179
183 6.000e-52UniRef50_V5SDD3 Glutamate formiminotransferase n=3 Tax=Hyphomicrobiaceae TaxID=45401 RepID=V5SDD3_9RHIZ  ali  45  9.....PNFSDGTRKEVIEQIVAPFRDKKGVKLIGYEPDADFDRLPVEVLGRPEAVREAILASAAKAYELIDMEKQHGRHPRIGAVDTIEIYPAKDITIEECVAFAEDLGKELFKRHGVPIFFTGKNARRPDREGLTAIRKGNYEGLRDVIEKDPDRAPDLGPAKMHPTAGATIVGA. 179
184 6.000e-52UniRef50_A0A2H0XUS0 Glutamate formimidoyltransferase n=1 Tax=Candidatus Saganbacteria bacterium CG08_land_8_20_14_0_20_45_16 TaxID=2014293 RepID=A0A2  ali  38  11LVECVPNFSEGRDLALVDEIVAAVKT---AKVFNVHSDPDHNRTVVTMVGGPQEVKQAAFDLTLRAMQLLNIREHEGEHPYIGVVDVIPFVPVS-CPLPEVLCLVRELGEELWQKLALPVYYYGESALKPERKELPFVRRGGYHLLCQEINIPE-RQPDVGHD-LHFSAGVVAVGVR 181
185 7.000e-52UniRef50_UPI0008F7E8D3 glutamate formimidoyltransferase n=1 Tax=Traorella massiliensis TaxID=1903263 RepID=UPI0008F7E8D3  ali  52  4IVECVPNYSISSDIEGLNEILRPFRENDNVSLVNVEPDTSYNRTVVTLIGEPEALKKAMVESCKAAVRIIDMNHHHGEHKRMGAIDVIPFIPIQNMTIEETIALSEACAKEIYEATRIPIFLYNLSAKRKQCENLPDIRKGEFEGMAEKLKDP-YWKPDFGD-EVHPTAGVTAVGCR 178
186 1.000e-51UniRef50_A0A2E2BU21 Glutamate formimidoyltransferase n=35 Tax=root TaxID=1 RepID=A0A2E2BU21_9EURY  ali  40  47LIECVPNFSEGRDIDIVNRIVDSARGIEGCSVLSAEPDADYNRTVVTXAGSPXAVSEGAFRIIXSSMXLIDMRNHSGEHPRLGAVDVCPFIPLRDSSYESCAELAVQLGKRVSTELDLPVFYYGHAATDPGRTVLSTLRKGEYEGLKERFEDDLTRWPDDGPRKWTSKFGAVVXGSR 232
187 4.000e-51UniRef50_A0A2P8CYK2 Glutamate formiminotransferase/formiminotetrahydrofolate cyclodeaminase n=3 Tax=Taibaiella TaxID=1434702 RepID=A0A2P8CYK2_9BACT :  ali  42  8LMECVANFSEGRDTTVIAAIARAIQDVPGQQLLHQDISPSANRTVMTFAGRPEAVTEAAFEAIKTAAERIDMAVQTGAHPRIGATDVCPLIPLAQLSIEEAVVYAEALGRRVGTELGIPVYLYEHAAKAGYRRTLPAIRKGQYEGLQYKMQQ-EGWQPDYGPGSIVAHTGATVIGVR 186
188 1.000e-50UniRef50_UPI000946612B glutamate formimidoyltransferase n=1 Tax=Gemmatimonas phototrophica TaxID=1379270 RepID=UPI000946612B  ali  49  3LVECVPNFSEGRDPVVIAAIREAIATTAGAHVLDVSSDPSHHRXXXXXXXXXXXXXXXXXXXXRVARDRIDLTAHQGEHPRIGATDVVPFIPLDGATMDDCIALARELGERAHRELGIPVYLYERAAATPARENLADVRRGEFEGLREEVRSNPARHPDFGGAELHPTAGATAIGAR 179
189 1.000e-50UniRef50_K4LH66 Formimidoyltransferase-cyclodeaminase Ftcd n=39 Tax=Bacteria TaxID=2 RepID=K4LH66_THEPS  ali  48  2................VEQILDVIRGVAGVKLLDYSSDPSHNRTVVTFVGGPEQVKTAAFLAAQKAAELIDMERHRGEHPRIGATDVIPLIPISGVTMEDCVRLARELGREIGEKLQIPVYLYEEAALRPERKSLPKVRQGEYEGLKEAIGRPE-RRPDFGPARLHPTAGATAVGAR 161
190 2.000e-50UniRef50_M7AX19 Lanosterol synthase n=1 Tax=Chelonia mydas TaxID=8469 RepID=M7AX19_CHEMY  ali  39  819....VPGYS--RDKQVIDAIGEAVSQTPGCVLLDVDAGPSTNRTVYTFVGSPDAVVEGALRAARVAFQLIDMGRHRGEHPRMGALDVCPFIPVRNVTMEECIRCANLFGQQLSVELGVPVYLYGEAARKESRKSLPAIRAGEYEALPEKLTKAEWV-PDFGSASFVPRWGATVTGAR 992
191 3.000e-50UniRef50_B7Q6E5 Formiminotransferase-cyclodeaminase, putative n=9 Tax=Bilateria TaxID=33213 RepID=B7Q6E5_IXOSC  ali  37  2.............TQVIEEISKAIRETSGVSLLGVDPGPSTNRTVYTFVGSPDAVIQGALNAARVAHNRIDMTKHKGEHARLGALDVCPFIPVQGVEMEECVYCARKFGEKLSAELGVPVYLYGFAAQQDHRRSVPQIRSGEYEGLADKIGKPEW-KPDYGPAEFVPRWGATMSGAR 164
192 4.000e-50UniRef50_D1CFA5 Glutamate formiminotransferase n=1 Tax=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) TaxID=525904 RepID=D1CFA5_THET1  ali  46  19.LECVPNFSEGRDRAKIESIASAARAL-GAYVLNIHSDPDHNRSVVTLAAPADQIVEAVMSMIRRAVELLDIRYHVGVHPRIGVVDVVPFVPLGAATQEDSVKAAIEVASRVGNELEVPVYLYEWAARHPEYRALPDVRRLYSQA----ILAGNFLEPDFGPFMPHPTAGACVVGAR 189
193 5.000e-50UniRef50_A0A0S4PKI0 Glutamate formiminotransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A0S4PKI0_9BACT  ali  40  6.VLCVPNFSEGRNPGTIQAIADAAREA-GVIIHHLSWDYDHHRMVLAFSGTPAQVKRAVLRAGAEAIARIDLRTHQGVHPRIGAVDVVPFVPLSGLTLEQAVAFSHQVARAFARRLGVPVYMYEYSAGEGRIRDLPTLRKGQFESWVGRPLEGV-RRPDYGPAQLHPTAGATVMGVR 179
194 5.000e-50UniRef50_A0A2V8SAC8 Glutamate formimidoyltransferase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8SAC8_9BACT  ali  39  7IVECVPNFSEGRRPEVVARLVAEIESVAGAVVLDTHSDADHNRSVITFVAEPEAAVAAAVRVAALACELIDLREHAGAHPRVGALDVLPFVPVRGVNLADCVQFAHEAGKRIARELDVPVYFYEAAALRPDRVNLEDVRRKGFEQLRAEIGVNPERAPDVGTARVHESAGACIVGAR 183
195 5.000e-50UniRef50_A0A2V4D7M7 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2V4D7M7_9EURY  ali  43  5LVECVPNFSEGRDAEVIKAILDSVSGISGCHLLSAESDADYNRTVVTMAGEPEAVGKAAFRLISAAKEHIDMRNHSGEHPRLGAVDVCPFIPLRGITMEECANLAISLGQRVSHELGLPIYHYGAAASDEARLMLSTLRKGEYEGLQARL........................... 154
196 1.000e-49UniRef50_A0A2A5VK53 Glutamate formimidoyltransferase n=2 Tax=unclassified Euryarchaeota TaxID=33867 RepID=A0A2A5VK53_9EURY  ali  40  6.IECVPNISEGRDQSIIDKIVSYVSTSSNVAILGCEPDPDYNRTVITIAGEYKDVAEAAIKLIEKSADLIDMRKHEGNHPRIGAVDVCPFVPISPDTDDDCIKASKMVIEHFSN--TIPIFLYGSIASHPSRIALSALRKGQYEGLKSRFMNGEWRMPDYWSGSWSARFGAVAIGVR 187
197 1.000e-49UniRef50_A0A1V5SIV2 Uncharacterized protein n=1 Tax=Candidatus Atribacteria bacterium ADurb.Bin276 TaxID=1852833 RepID=A0A1V5SIV2_9BACT  ali  36  5IIQSAINIS-SSDEKIINKMTESIGQIPGCLVADYSSDIDHNRSVISILGDEKSLSKAVFVIFEIAYETIDISHHHGEHPRIGAVDVIPFTPWGITTMEDCIVLAQSVGREIAKKYLMPVYLYGEAALIPEHENLSLIRRGGYESLLQEIHRVADRKPDYGLTRLHPTLGAVAIGAR 180
198 4.000e-49UniRef50_A0A2E9NMU8 Glutamate formimidoyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A2E9NMU8_9BACT  ali  48  40.IECIPNVSEGRRADVIAIVVAAIRAVPGIRLLDQSADADHHRSVFTMVGDATALKAAVLELFAAAIPMIDLRRHRGAHPRIGAVDVVPFVPLGDTPLAACAALAREVGRAVADRFGVPVYLYEAAADDPDRRRLEELRRGQFERLSERM-DDAAGRPDFGPSAPHPSAGACAVGAR 214
199 4.000e-49UniRef50_A0A2D5KEN1 Glutamate formimidoyltransferase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5KEN1_9FLAO  ali  42  4IIECVPNFSEGQDETTIAAIAAAVKSVEGVQLLHQDSGKAANRTVYTFAGEVQAVFEAAYRAIAVAVEKIDMRKQKGEHPRIGACDVCPFIPISGISLKELVPLTRSFAEKVSRDFRIPIFFYEESATSKKRKNLASHRIGQYEALRERLKNG-KWKSDFG--EYNPSFGGCVMGVR 177
200 4.000e-49UniRef50_A0A1M4YWV2 Glutamate formiminotransferase n=7 Tax=Firmicutes TaxID=1239 RepID=A0A1M4YWV2_9FIRM  ali  36  6.ILAVPNFSEGRRQEVIDAISCTIKNREGVKLVTCEPEHDFNRTVLTIIGEPAPLKEALLEMAAKSYELIDMREQQGTHPRIGGQDTIPLFPLANISLEECKELAEEIGKELFEKHQVPIYFSGENARTEDKKSISFIRKGQYEGLKALLPDYESRKPDLSDGKLSPQYGATIVSA. 186
201 8.000e-49UniRef50_UPI000BA828B5 formimidoyltransferase-cyclodeaminase-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA828B5  ali  37  1...............IIQEIAQSIQNTDGVDLLDTDCSPSTNRTVYTFVGSPDDVIEGALNAARTAYKHIDMTKHKGEHPRIGALDVCPFIPVQGVEMEECIYCARKFGEKLAAELNVPVFLYGFAAQHEHRKTVSQIRVGEYEGINEKITKPEW-KPDYGPAEFISRWGATICGAR 161
202 9.000e-49UniRef50_UPI000B837EC2 glutamate formimidoyltransferase n=1 Tax=Aliicoccus persicus TaxID=930138 RepID=UPI000B837EC2  ali  37  8.IQVIANFSEGRNKEIYNGLKQIAQNGQGYKLIGSLAEPDYNRSGFYLLGEKSGILDTVVEMLEYAISHIDMTKQEGPHPWIGAGDVIAVIPVKNITMEECVEYAEQLGQVIGETLKLPVYLYGEAAKNEERKDLSKIIKGEFEGFPQKIKQPEW-QPDYGPNTVHPTAGVTAIGV. 181
203 4.000e-48UniRef50_A0A1F2YA81 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Actinobacteria bacterium RBG_19FT_COMBO_70_19 TaxID=1797208 RepID=A0A1F2YA81_  ali  47  7LVVCVPNFSEGRRAEVIDAICDALASVPGARLVYRQADAEHNRLDTTVIGSPEAVRASALAGAAKAVELIDMEQHHGGHPRMGAADVIPFVPLRGLSMDDCVELARSFAKELAETLDLPVYLYDRAALVPERASLAEVRKGELEGLREAVARGERL-PDFGPHRIG-RAGATAVGAR 181
204 7.000e-48UniRef50_A0A1E4GG03 Glutamate formimidoyltransferase n=1 Tax=bacterium SCN 62-11 TaxID=1660156 RepID=A0A1E4GG03_9BACT  ali  39  5LFQCAPNLSEGRNPQLFSAVQQAMQGMPGVAMTDLSMDHDHHRMVVSLLGQADGLREAVLRLFEIASQNIDLSKHAGVHPRIGAVDVVPFVPLGSTPMEAAQAVALSTAQEVAARFELPVLLYEYSARNPAHRNLPDLRRQGLQ------ERLLENAPDFGPVQLHPRLGATVMGAR 175
205 9.000e-48UniRef50_A0A2P1G5H2 Glutamate formimidoyltransferase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A2P1G5H2_9FIRM  ali  37  8.....INVSEGRNMDTIEAIKEAVLKDNKVTMVDLNYDSDHNRSVFTFKGSVEDTLEAAKRLVDVAFERVDMTTQHGSHPRQGAVDVAAWVPVKDMSTDEMNEVVHAFGKYVGSK-GVPVFYYEDSATREDRKSLVKLRKGEYESLEERLKDAENWTPDEGERKFNPKSGATVTGTR 178
206 9.000e-48UniRef50_C1A6T1 Formiminotransferase-cyclodeaminase n=17 Tax=Gemmatimonadetes TaxID=219685 RepID=C1A6T1_GEMAT  ali  44  3LVECVPNFSEGRDPLVIAAIRDAIANTPGAHVLDVSSDASHHRTVITFVASLEAAVPAAFAAMAVARDRIDLTKHQGEHPRIGATDVVPFIPLDGATMDDCVALARELGARVAGELGIPVYLYERAASTPARENLADVRRGEFEGLRDDVRTNPARRPDFGPAELH........... 168
207 2.000e-47UniRef50_A0A2V7LFR6 Glutamate formimidoyltransferase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7LFR6_9BACT  ali  44  279.........EG-DDATLEALRRAITGVPGARLLDVQADVAHNRSVYTFVAPPHVAIEAALAAMRVATERIDLTRHRGEHPRMGATDVVPFVPVRDVTLDDCVTLARRLGERAGAELGLPIYLYARAATRPERERLPDVRKGEFEGLRERIGKDPGADPDFGPKRIHPTAGATAVGAR 445
208 2.000e-47UniRef50_G2LHJ2 Glutamate formiminotransferase n=2 Tax=Chloracidobacterium thermophilum TaxID=458033 RepID=G2LHJ2_CHLTF  ali  45  5LVECVPNFSEGRRPEVVASIVAAIEHALGQPILDQHLDPDHHRSVITFAGSPEAVRAAAIAGLARAVECLDLSRHQGVHPRIGVVDVVPFIPVRGVTMTDCVALAHQVSQQVSARHGLPVFCYGEAAHQAVYRDLAAIRRAV-------RTAPTFPTPDYGPPRPHPTAGAVAIGAR 174
209 2.000e-47UniRef50_A0A1Q7Y1R1 Glutamate formimidoyltransferase n=36 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q7Y1R1_9BACT  ali  41  13VVECVPNVSEGRDRARIDALASAIRAVPGVTLANVHADPDHHRSVITFLGTPDAVEGAALALAARVVTLVDMRHHRGVHPRVGALDVLPFTPLVGVTLEQTVALARRVGRAIGERHSLPVYYYGQAATRPGRETPRRLRRGEYEGLPARLASPDG-APDDGPARFDARSGAVLVGAR 188
210 3.000e-47UniRef50_A0A075GS59 Glutamate formimidoyltransferase (FTCD) n=8 Tax=cellular organisms TaxID=131567 RepID=A0A075GS59_9EURY  ali  45  4LVECVPNFSEGRDRKVIDAIAAAIGAVEGAEVLDIDMGGETNRTVVTFVAPPASVGDAAFAGVARAAELIDMRAHAGAHPRMGATDVLPFVPVSGVSMEECVAIAHATGERIGAELGIPVWFYEEAARSPDFRNLARVRTGEYEGLAERL---EGGAPDAGPAKFNARSGATAVGAR 177
211 3.000e-47UniRef50_A0A2N5KIQ6 Glutamate formimidoyltransferase (Fragment) n=16 Tax=Bacteria TaxID=2 RepID=A0A2N5KIQ6_9CHLR  ali  46  1....MPNFSEGRRTEXXXXXXXXXXXXPDVLVLDVEADADHNRAVVTFVGPPTVMVAAAFAGIATAQRHINLDHHQGVHPRLGAADVVPFIPLRDTTMAECVALAQQLGARVGAELGIPVYLYEEAATRPERRNLADIRRGEYEGLKQSLGHDPLREPDFGPTTIGP-AGATVIGAR 172
212 7.000e-47UniRef50_S7TDS4 Glutamate formiminotransferase n=1 Tax=Desulfococcus multivorans DSM 2059 TaxID=1121405 RepID=S7TDS4_DESML  ali  35  5LIECTPCFSEGRRHDVIDAILNPFRTTPGCHLLDHRSDGEENHLTISLAGRPGPVQEALMAAARIALETIDMNAYTGLHLGIGAVDMIPFAPVTNISMEACTTLARDFGRRLFHETEIPVYFFGEAAIRHERRCPADLRRGGYDLLKIE-ASAPKRRPDIGEPRLHPTAGATAVGV. 179
213 1.000e-46UniRef50_A0A1F4QI36 Glutamate formimidoyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A1F4QI36_9BACT  ali  42  3ILQCVPNFSEGRDPDFLRE-VKAILAQHPVKVLDVSMNKEHNRTDATFLGVPAAVEAAAMAVASRALELIDIRTHRGSHPRMGAVDVVPFVPLRGMTMAEAVEIARRFGRAFAEKHQVPVFFYEEASRTEARRSLADIRRGEYEGMRRKLQDPAWTV-DAGPQTLNENSGVTAVGAR 177
214 3.000e-46UniRef50_A0A1V5QSL2 Uncharacterized protein n=1 Tax=Acidobacteria bacterium ADurb.Bin340 TaxID=1852787 RepID=A0A1V5QSL2_9BACT  ali  38  4IISVVPNISEGLDAAFIEGLRARLEAVPELMVLDVAMDQVRNRTIFSFTGPREAVFQGGFLVYEAALGRIDMRHHEGEYPRIGAVDAFPFVALKNATVEEAAEWAQAFAQEVGQRFQVPVYLFGEAARTPMRRDIEAIREGEYEGFAQKMADP-AWKPDFGPDTFPADKGATMIGAR 179
215 5.000e-46UniRef50_S0EWM6 Glutamate formiminotransferase n=4 Tax=Chthonomonas TaxID=1077265 RepID=S0EWM6_CHTCT  ali  44  6VFQCVPNFSEGRRREVVEAIANAAQRA-GAVVADWSLDPDHNRSVVSLLGDAQQIEAGALAAAAEAVKHIDMRRHQGLHPRTGAVDVLPVVPVRKVGREEAVALAHTIGKQLAEQLKIPVLFYEWAARPGRETALPKLRQGGWEHIAQSVLD-----PDFGPSHPHPTAGVAIVGAR 176
216 9.000e-46UniRef50_A0A2H0S897 Glutamate formimidoyltransferase n=1 Tax=Candidatus Peregrinibacteria bacterium CG10_big_fil_rev_8_21_14_0_10_36_19 TaxID=1974784  ali  40  3IVECVPNFSEGKDQKVIDQIVSSISSVPEVEVLHRTSDTDHNRSVITFIGPAKNVCEAAFQATKKASELIDITNQKGVHPRLGATDVIPLIPLKNITQKDLIPHAEALAKRITSELKIPTHLYEKAAQTELKKNLANIR-------------LQKPSPDFNCNSPLKEAGETTVGVR 166
217 2.000e-45UniRef50_A0A2D5B255 Glutamate formimidoyltransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5B255_9BACT  ali  37  15LVECVPNFSFSEDPELLEALAQLVKDGGGA-VLDGSSDRDHNRCVLTWVARPQTVVAIAFRLIALASERIDLTHHRGVHPRIGACDVCPLVPLEGFPRTDCVELAHALGRRVGEELAIPVHFYGDAARSPEGRELPRLRRSGFA---------RTRTPDEGPARLHPTAGAIAIGVR 181
218 3.000e-45UniRef50_A0A0K2SGA7 Glutamate formiminotransferase n=2 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SGA7_9FIRM  ali  48  4MIQCVPNFSEGRRQEVIDALVAACRA-PGVALLDHHADRDHNRLVVTFVGDRAAVRDAALRAARAAMELIDVESHQGSHPRMGALDVLPFVPVRGVTMADCVALAEEVG-RVLGEMGLPVYLYEEAARTPERRSLADVRRGEYEGLRADVAEGRRL-PDFGPPALG-RAGATAVGAR 176
219 5.000e-45UniRef50_R7K7T2 Glutamate formimidoyltransferase n=1 Tax=Subdoligranulum sp. CAG:314 TaxID=1262970 RepID=R7K7T2_9FIRM  ali  45  3LVEVVPNFSTG-DPVKAKLIADCFRNRKNVALLNCTADADHNRCVVTAAGAPQEIRSALIDSARVAAEEIDLNAHRGVHPRIGALDVLPVVPLEETPESVADELVRQVGQDLFDKLGLPVYFYEKSASAPFRRNLADVRRGGFEGLAKKTSEPLWR-FDIGE-KPHPTAGAVAVGVR 176
220 1.000e-44UniRef50_A0A2W5XAT9 Glutamate formimidoyltransferase n=1 Tax=candidate division WPS-2 bacterium TaxID=2052317 RepID=A0A2W5XAT9_9BACT  ali  41  10IFEIVPNISEGGRAEVVDACVRSVENA-GARVIHRTSDVVHNRSVITAVGSAAAVCDAGVALAGAALENIDLRAHRGVHPRIGALDVLPFVPLSEATMQQAVDLARECARRIWETHHIPSFFYAEAAATALRRSLAHVRSGQFEGLDTRFERPEWR-PDVGDPRAHSSAGAIAIGAR 184
221 3.000e-44UniRef50_A0A2V6P1K3 Glutamate formimidoyltransferase n=3 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6P1K3_9BACT  ali  42  5LLECVPNVSEGRDRAIIASLGDAIESA-GARVLDVHADVDHNRSVFTFIGTLATAEAAALALCRLAVERLDLRTHRGVHPRIGAVDVIPFVPMRGARMADAVRAAHRIGAMLGRDLQVPVFYYGEAALVPERRELPALRRGQFE-GLAAGMRAAGGAPDAGPRSPHPTAGATAIGAR 179
222 3.000e-44UniRef50_A0A1M4MA24 Glutamate formiminotransferase n=22 Tax=Bacteria TaxID=2 RepID=A0A1M4MA24_9FIRM  ali  43  8.ILAVPNFSDGRRKEVIEAVVDEVRKVEGVKLVSYEPEHDFNRTVVTVIGEPAPLKTALLNMAAKSIELINMEEQKGTHPRIGAQDTIPLFPFKNITVEECVKLAEEIGKELHERTGVPIFFAAENARTEERRALAFIRKGQYEGXXXXXXXXXXXKPDLSDGLLSSTAGATIVSA. 193
223 3.000e-44UniRef50_A0A2E7U1C8 Glutamate formimidoyltransferase n=3 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E7U1C8_9BACT  ali  44  4VLEAVPNFSEGRDLEKVEALVDAITK-KGVDILDWSADPDHHRSVVTYIGDPRSVISASLAAAEFAVREFDLSRHRGLHPRIGALDVLPFVPLRGLHMSDAIAAAHEVGQAISS-LGVPVFFYGEASDPPGR-GLAELRRGGIESLLDGFR--EGRKPDLPSSAPHPTAGATCVGAR 177
224 8.000e-44UniRef50_A0A1V6FZ41 Uncharacterized protein n=1 Tax=Planctomycetes bacterium ADurb.Bin069 TaxID=1852902 RepID=A0A1V6FZ41_9BACT  ali  42  2LLECVPNVSEGRDPAVIAALAAAITAGEEAFLLDTHSDPDHNRTVFTFAGSTGGVLEGAWRLIRAAAERLDITRHEGVHPRMGAVDVCPFVPLGATPMSAAVAAARALAERAGRELALPVYLYGEAALKPERRELPRVRLSSFAALARALAEDPGRAPDFGPAAPHPTLGAIAIGAR 178
225 1.000e-43UniRef50_X1FWW5 Uncharacterized protein (Fragment) n=3 Tax=marine sediment metagenome TaxID=412755 RepID=X1FWW5_9ZZZZ  ali  48  3.....................................DSDYNRAVITFVGTPEAVLNANIAAAKKAIELIDMNKHKGQHPRIGAVDVCPFVPAQNVTIEECKDLAIKFAEALTKE-GVPVYLYEESATKPERRNIDNIRIGEFEGLKETIKTNPEHKPDYGPSEFHPTAGATIIGAR 141
226 1.000e-43UniRef50_R5FRX8 Glutamate formiminotransferase n=1 Tax=Coprobacillus sp. CAG:698 TaxID=1262856 RepID=R5FRX8_9FIRM  ali  41  4IIEFIPNISTC-DEKIIKVFIELVNNKRNVKLLNYSSDVCHNRSVFTIIGTREGIKEIAFDFAKIAILEIDITKHKGVHPRIGSIDVMPFVPLKNISMDECVVLSKEVALDIYSKLGLPVYLYEFSQEREYRKNLADVRNCGFESLDEKMKDKNWL-PDYG-TKKHMTAGATCIGAR 177
227 2.000e-43UniRef50_A0A1S3E9G0 QWRF motif-containing protein 4-like isoform X2 n=2 Tax=Cicer arietinum TaxID=3827 RepID=A0A1S3E9G0_CICAR  ali  32  498LGCCKVYISESRNKSALESIERAAKLFPLAPIINKFEDVAYNRVGYTLVSEPCHLTNAVLAMVKAAFENIDFELHSGTHPRVGVVDHICFHPLVDASLDQAARTARCLATDMGSSLQVPTFLYG--AAHEEGRTLDSIRRTENQWIGVPKSNTLPLKPDSGPCQVTPTKGVVVIGA. 688
228 5.000e-43UniRef50_A0A2V6U7B9 Glutamate formimidoyltransferase (Fragment) n=2 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6U7B9_9BACT  ali  42  5LLECVPNVSDGRDRALIEA-LAAAVEAAGARLLDVHADVDHNRSLFTFVGPAATVEAAALALARIAVERLDLRTHQGVHPRIGAVDVIPFVPLRGALMADAVRAAHALGPALAGELGVPVFYYGEAALRPERRELAALRRGQFEELAPRMRAPGG-EPDAGPSVPHPRAGATAIGAR 179
229 5.000e-43UniRef50_A0A0D8DKP1 Uncharacterized protein n=3 Tax=Acidiplasma TaxID=507753 RepID=A0A0D8DKP1_9EURY  ali  38  3IFESVPNFSTS-DENIIE-ILKGIITSGGGTFLDSTSDRDHNRSVITLIADNDRIVQILFDLAKSAKELIDMEKHRGLHPRIGALDVLPIVPMGNSTMNEAIEISNKLGYRIGSELGIPVYMYGESAKIPERRDISYIRNMQYEELKQHILE-EKYKPDYGPAVLG-SAGAMMVGAR 177
230 6.000e-43UniRef50_K0AYC9 Bifunctional glutamate formiminotransferase/formimidoyltetrahydrofolate cyclodeaminase FtcD n=28 Tax=Bacteria TaxID=2 RepID=K0AYC9_CL  ali  39  8.ILAVPNFSDGRREDVIEAVTGELKGIEGVKLVSVEPEHDFNRTVVTVIGEPAPLKEALIKMASKSIELIDMREQSGTHPRIGAQDTIPLFPLMNATVEECVKLADEIGKELHEKTGVPIFYAADNATTEDRKALAFIRKGQYEGLRDRKDEYESRKPDLSDGLLSDKSGATICSA. 193
231 6.000e-43UniRef50_K7M2R7 Uncharacterized protein n=68 Tax=Spermatophyta TaxID=58024 RepID=K7M2R7_SOYBN  ali  30  8..CCKVYISESRNRTALESIERASKLFPLAPIINKFEDVTYNRVGYTLVSEPCHLANSVLAMVKAAFDTIDFEVHSGTHPRLGVVDHICFHPLLDASLDQAANAARCLATDMGSTLQVPTYLYG--AAHEEGRTLDSIRRSENQWIGGLKSDTLPLNPDSGPSQVTPAKGVVVIGA. 193
232 7.000e-43UniRef50_A0A2D6A7P1 Glutamate formimidoyltransferase n=15 Tax=Bacteria TaxID=2 RepID=A0A2D6A7P1_9BACT  ali  42  5.LECVPNFSEGRRPKVVAAIADAMR-VPGVQVLDASSDVDHNRSVITLAGEPDGLIEAMLAAAAVAKRAIDLAHHEGVHPRIGALDVCPFVPLAGTPMALAVETAERFAERLAGDHDIPAYLYAEAARRPERVVLADLRRGVLA------------NPDFGSAPAHVSAGATAVGAR 167
233 8.000e-43UniRef50_C6Q2K7 Formiminotransferase domain protein n=2 Tax=root TaxID=1 RepID=C6Q2K7_9CLOT  ali  57  4LVECVPNFSEGRDKEIIEKIVDEVRKTEGVKLLDYCSDKDHNRSVVTFIGGPEETKEAAFKLIKKASELIDMSKHSGAHPRMGATDVVPFIPIRDITTEECVEIAKDLGKRLEK............................................................... 117
234 1.000e-42UniRef50_A0A0B0EC28 Glutamate formimidoyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A0B0EC28_9BACT  ali  42  1................................MNVEPDKDYNRTVITFAGEPLCVKEAAFKAIATASELIDMSRQKGEHPRIGATDVCPLIPVANVTKDECVRLSNELGKDVGEKLGIPVYLYEDSAMSAERRNLENIRKGEYEGLEQKLKD---WIPDYGPTEYNRKSGATVIGSR 145
235 2.000e-42UniRef50_F6PS96 Uncharacterized protein n=5 Tax=Euteleostomi TaxID=117571 RepID=F6PS96_MONDO  ali  29  10LAVCLLNISEARRKNLVEKIAKAAKEYSEVTVLNIFSDHDYNRSVITIAATIEKLGSAVLATCVEAFQVIDMEVQEGIHPCLGAVDLIPIYPLSEVGVEECGMVARSLAEKLTIQVPGCSVFLFGEADQPEKRSLVQRRKELGWFSR---REFSSLKPDIG-TTPNKRCGLTGIGA. 187
236 2.000e-42UniRef50_A0A0D9RG36 Formiminotransferase cyclodeaminase N-terminal like n=2 Tax=Chlorocebus sabaeus TaxID=60711 RepID=A0A0D9RG36_CHLSB  ali  30  10LAACLLNISEARRKYIVENIAKAAKKHPQVSVLNIFSDQDYNRSVITIAASVDKLGSSVLAACLEAFQAIDMEVQEGIHPCLGAVDLVPIYPLSGITVEECGVVARSLAEDLVRHVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTR---RDFSALQPDLG-AAPARRCGLTGVGA. 187
237 2.000e-42UniRef50_A0A151SQ55 Formimidoyltransferase-cyclodeaminase n=2 Tax=Cajanus cajan TaxID=3821 RepID=A0A151SQ55_CAJCA  ali  29  8..CCKVYISESRNRSALESIERASKLYPLAPIINKFQDVAYNRVGYTLVSQPCHLANAVLAMVKAAFDTIDFEVHSGTHPRLGVVDHICFHPLLGASLDQAATIARCLATDMGSSLQVPIYLYG--AAHEEGRTLDSIRRSENQWIGGLKSDCLPLSPDSGPSQVTSAKGVVVIGA. 193
238 2.000e-42UniRef50_A0A2P6S2Z7 Putative glutamate formimidoyltransferase, Formimidoyltetrahydrofolate cyclodeaminase n=54 Tax=Mesangiospermae TaxID=1437183 RepI  ali  32  23LGCCKVYISESRNRLALESIERAAKRFSEAPIVNKFEDETYNRVGYTLVGNPCPLRMAVLAMVKAAFETIDLESHCGSHPRLGVVDHICFHPLLGASLEQMAGVANSLAADVGSSLQVPTFLYG--AAHEERRALDSIRREGEQWVGGPKSEYLALKPDKGPPKVTQEKGVIVIGA. 213
239 3.000e-42UniRef50_A0A2G6F7J4 Glutamate formimidoyltransferase (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A2G6F7J4_9FLAO  ali  42  1................................MEIDPGKGANRTVITFVGEPEKVVDAAYLLIEKAARLLDMRKHQGEHPRFGVVDVCPLVPLKNISLAETVRYAHRLSEKVGKTLGIPVYCYEAAAKNETRKNLANCRKGQYEGLAKKMQHPDW-KPDYGPSHFTAKTGAIAIGAR 147
240 5.000e-42UniRef50_F7AY55 Uncharacterized protein n=10 Tax=Eutheria TaxID=9347 RepID=F7AY55_MACMU  ali  30  10LAACLLNISEARRKYIVENIAKAAKKHPQVSVLNIFSDQDYNRSVITIAASVDKLGSSVLAACLEAFQAIDMEVQEGIHPCLGAVDLVPIYPLSGVTVEECGVVARSLAEDLVRHVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTR---RDVSALQPDLG-AAPARRCGLTGVGA. 187
241 6.000e-42UniRef50_A0A2P4KGE2 Glutamate formimidoyltransferase n=23 Tax=Pentapetalae TaxID=1437201 RepID=A0A2P4KGE2_QUESU  ali  30  43LLCCKLFISESRNRAALDAIEQAARLNPETVIVNKFEDRAYNRIRYTLVSYVSPLQKAVLAMVEAAFGAINLELHSGTFPRLGVVDEILFHPLARASLDEAAWLAKAVATDIANQFQVPVFLYAAAALDTIRRELGYYRSMGNQWAGRTLPDMLLEKPDEGPSEVSGARGITMIGAR 236
242 9.000e-42UniRef50_A0A2G9GQ90 Formimidoyltetrahydrofolate cyclodeaminase n=35 Tax=eudicotyledons TaxID=71240 RepID=A0A2G9GQ90_9LAMI  ali  28  21LLCCKVYISETRNKQALDSIERAARQDPETLIVNKFTDHDYNRAGYSLVSYVTPLHQTVVAMAEAAYEAINLETHCGSHPRLGVIDDIVCHPLARASLDEAAWLAKTIASDIGSRFQVPVYLFGAAHPTRNRRELGYYRPNGNLWAGWAQPEILPEKPDEGPEMVSRSRGVTMIGAR 214
243 1.000e-41UniRef50_A0A2N1TD86 Glutamate formimidoyltransferase n=1 Tax=Candidatus Peregrinibacteria bacterium HGW-Peregrinibacteria-1 TaxID=2013826 RepID=A0A2N  ali  39  17IIECVPNISEGKNKTKIQKLLTAINNTPNTKLLHHTSDPDHNRTVITFIGKEESVFHAAYNLAKTATEILDLSQHHGIHPRFGVVDVIPFIPLRNITAKELVPLVHQFGDKIS-QLNIAPYFYEQAATNNQHKNLATLRKHLSETTIIKH---------------NPQFGASCIAVR 177
244 2.000e-41UniRef50_E6PJ36 Uncharacterized protein n=2 Tax=mine drainage metagenome TaxID=410659 RepID=E6PJ36_9ZZZZ  ali  43  3LFELVPNLSEGRNDETIDRAVAAVEAT-GARVLDRSSDAAHNRSVLTIVGDADRLVEAALALARVARERIDLRAHRGLHPRIGALDVLPFVPLGDAPMAAAVELARNAARKIWEREGIPSFLYGEAALLPERRLLANARRDGFEGLAARFARSD--RPDIGDIAAHESAGAIAIGAR 176
245 3.000e-41UniRef50_A0A2X1WK06 Glutamate formiminotransferase n=1 Tax=Peptoniphilus harei TaxID=54005 RepID=A0A2X1WK06_9FIRM  ali  53  4.VMCIPNYSEGRDLEKVEKITECFRAKENVKLIDYQPDADHNRLVVEVIGEPEAVIDAVLESVKVASEIIDMSKHEGAHPRMGAVDVIPFVPVTEVTTEDCVGYANKVGKAIG-EMGIPVYLYEDAATTLKERTLLRLERDNTKHSSTKLRK......................... 153
246 4.000e-41UniRef50_A0A0S8GYK5 Formiminotransferase-cyclodeaminase (Fragment) n=5 Tax=root TaxID=1 RepID=A0A0S8GYK5_9BACT  ali  53  5LIECVPNFSEGKDMGVIRQITRAIEAVEGVKLLYVDPGADMNRAVVTFIGPPAGIKEAAYQSIKKAAELIDMSKHKGAHPRMGATDVFPFIPVAGVTVAECVALSKEVAQRVGEELGIPVYLYEKSAQTP............................................... 134
247 6.000e-41UniRef50_K4CFY8 Uncharacterized protein n=10 Tax=Pentapetalae TaxID=1437201 RepID=K4CFY8_SOLLC  ali  29  19LLCCKLYISESRNREALEPIERAAKLDPETVIINKFQDRDYNRVNYTLVSYVSPLHQTVVAMVAAAYDAINLEQHSGAHPRLGVVDDILIHPLARASLDEASWLAKKIAADIGNRFQVPVYLYAAAALDTIRRELGYYRPNGIQWAGWAQPEQVSVKPDEGPEVVSRARGVVMIGA. 211
248 6.000e-41UniRef50_UPI000BE199EE formimidoyltransferase-cyclodeaminase-like isoform X2 n=2 Tax=Varroa destructor TaxID=109461 RepID=UPI000BE199EE  ali  36  7IVECVPNFSEGQRPDVIKAISAAISTTQGCTVLNVDPGASTNRTVYTFVGSPDAVIEGALAAAKAAFSLIDMSRHRGEHARLGALDVCPFIPVRGVEMEECVYCARKFGEKLAAELKGL-------AAKLER---------------------PEWRPDFGPAEFVPQWGATMAGAR 155
249 1.000e-40UniRef50_A0A257AZ86 Glutamate formimidoyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A257AZ86_9BACT  ali  43  11LIECVPNFSEGRRPAAVAAIARAIEQALGGPVLDQHLDPDHHRSVITFAGRPEAVEAAALAGIAEAVARLDLSTHRGVHPRIGVADVVPFVPVRGATMADCVALARRVAARVATDCGVPAFCYGEAARHDAYRDLAALRR-------AIRASPAFPAPDYGPTRPHPTAGAVAVGAR 180
250 1.000e-40UniRef50_O95954-4 Isoform E of Formimidoyltransferase-cyclodeaminase n=2 Tax=Boreoeutheria TaxID=1437010 RepID=O95954-4  ali  33  4LVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPGLTAGLSCSLPVRRGSQDGQSPDPAGHPGRGVRGPP...................... 158
251 2.000e-40UniRef50_A0A0L0W6C3 Glutamate formiminotransferase (Fragment) n=1 Tax=Clostridium purinilyticum TaxID=1503 RepID=A0A0L0W6C3_CLOPU  ali  43  8.ILAVPNFSEGRREDVIEAVVAEVKKVEGVKLVSYEPEHDFNRTVVTIIGEPKPLKEALINMAAKSIELIDMTQQSGSHPRIGAQDTIPLFPFKNITVEECIELANEIGKELHEKTEVPVFYAAENARSEERKALAFIRK..................................... 146
252 2.000e-40UniRef50_A0A2E5ZTP2 Glutamate formimidoyltransferase (Fragment) n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2E5ZTP2_9EURY  ali  47  1............................................VITFIAESEFVGSAAYKAIEKAAELIDMNKHSGTHPRMGATDVCPLIPVSNVTMEECIEIAQKLGEKVGTELNIPIYLYEAAATNKERQNLANIRSGEYEGLSKKLKD-LNWKPDFGPNKPNLKSGATAIGAR 132
253 3.000e-40UniRef50_A0A2H5WWE5 Glutamate formimidoyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5WWE5_9BACT  ali  39  8.LLCVPNFSEGRNEATIHAIADAACSA-GVTMHHLSWDYDHHRMVMAFSGTPTQVGRAVLRAAAVAIEQIDLRVHEGAHPRIGAVDVVPLVILRDISREQAVAFSHRLARRFARQLQVPVYLYEHSAFAGRPKDLPTIRKRVSAGI-------EAFPPDFGRVRMHPTAGATVIGVR 175
254 3.000e-40UniRef50_A0A1F7LRZ2 Glutamate formimidoyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A1F7LRZ2_9BACT  ali  38  12VVACVPNVSEGRDRAVLDALAAAVRATPGVTLADVHADPDHHRAVLTLLGAPAAVEAGALALAAGIVARVDMRRHQGLHPRVGALDVLPFVPLAGVGMAEVVALARRAGRAIAERWALPVWYYGAAATRPGRETPRALRRGEYEGLAARLATPEG-APDDGPARFDPRTGAVLVGAR 187
255 4.000e-40UniRef50_A9JTX0 LOC100127872 protein n=35 Tax=Gnathostomata TaxID=35060 RepID=A9JTX0_XENTR  ali  27  10LAACLLNVSEARKKYVVEKIARAAKMHPNTAVLNIFSDYDYNRSVITIAATAEQIGKSVLSACIEGFASIDLAEHDGIHPCLGAIDLVPIYPLSGVTLEKCGEVARDIAEGMATSIPGCSIFLFGYADLQDQKSLAEKRRDLGWFKNKTGIDLNKLKADVG-AQPSRRYGITGVGA. 190
256 4.000e-40UniRef50_A0A2E8QWT8 Glutamate formimidoyltransferase n=8 Tax=Bacteria TaxID=2 RepID=A0A2E8QWT8_9BACT  ali  39  9VLEAVPNISEGRDLGLIREMVDLISGYD-VEVLDWSTDPDHHRALITFIGPPPAVEDAAVSLADFAREHIDLRKHRGVHPRIGALDVLPLVPLNDMSMIDAVYSARRVAEAISD-LGVPVYHYGYASSPPGR-DLATLRRGGFEELIGGWPLDRFPDQMAGRSSAHPTAGVTCVGAR 182
257 2.000e-39UniRef50_A0A2V8UKQ2 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8UKQ2_9BACT  ali  39  57IVECVPNFSEGRDATVVARIAQAIAQVPGAAVLGQTSDCDHNRSVITFAGAPAAVAEAAFRGIESAVALIDMNRHDGVHPRVGAADVVPLVPISGVTMEDCVRLAEQLGERVCRELRVPVYLYEAAARRPERVNLANVRRERFEKLR.............................. 203
258 2.000e-39UniRef50_I1GQK8 Uncharacterized protein n=46 Tax=Mesangiospermae TaxID=1437183 RepID=I1GQK8_BRADI  ali  30  22VICCKLYISESQNAMVVDAISRIGQKDPEVVLLSKFEDEYYNRVRYTLVSYISPIRKVLLAMIEAAFSNINLEVHCGTHPRIGVVDDMSFHPLSAATMEDAAQLAKLLASDIGNGLQVPVFLYAAAHPTGKRRELGYYRPNGIKWAGQVLPDTLPMKPDEGPTQVPRERGATMVGA. 216
259 2.000e-39UniRef50_A0A2H4A028 glutamate formimidoyltransferase n=12 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2H4A028_PHODC  ali  28  156LACCKLYISESRNSLALESIELAAKLYPEAVVINKFKDEAYNRVGYTLVSDVAPLKNAVLSMVKAAFETINLELHSGTHPRLGVVDHICFHPLVHGSLDKAAGIAKSVAADIGRKLRVPTFLYGAAHEDSIRRELGYFKPNGNLWAGGLRSEVLCLKPDAGPLQSAPAKGVVAIGA. 346
260 2.000e-39UniRef50_A0A1U8ALX7 formimidoyltransferase-cyclodeaminase isoform X2 n=36 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1U8ALX7_NELNU  ali  29  142LACCKVYISESRNRAALESIEQAALLYREASIVNKFQDETYNRVGYTLVSKLAPLRGAVLSMVNAAFEAINLESHSGSHPRLGVVDHICFHPLAQTSLEQVALLAKTVAADIGSKLQVPTFLYGAATLDSIRRQLGYFKPNGNQWSGGPVSESLTLQPDEGPARVTRAKGVMVIGA. 332
261 2.000e-39UniRef50_A7RUE4 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RUE4_NEMVE  ali  30  6LVACLLNVSEARSKPIVESIAHSASLKCSSTVLNIFSDLDYNRSVITIAAPVDSIEESVFRACKTAYEEIDLSKHRGGHPRLGAVDLVPLHPITPSTLEECGKIAINIGRRITDTIKGSSVFFFGHADLPLKRGLVTRRKAVSWYEGKGDMTFDGIGWDIGPA-PTPRYGCTGVGA. 191
262 5.000e-39UniRef50_A0A251Q7N7 Uncharacterized protein n=1 Tax=Prunus persica TaxID=3760 RepID=A0A251Q7N7_PRUPE  ali  28  33LGCCKVYISESRNRAALEAIERAAKLFSEAPIVNKFEDETYNRVGYTLVSDPCPLRMAVLAMVKAAFETIDLEMHCGSHPRLGVVDHICFHPLLGASLDQVAGVANSLGADVGSNLQVPTFLYGAAHEDSIRRELGYFRPTGEQWVGGPKSEYLALKPDKGPPQVTQ.......... 214
263 5.000e-39UniRef50_F1SI74 Uncharacterized protein n=24 Tax=Euteleostomi TaxID=117571 RepID=F1SI74_PIG  ali  29  10LAACLLNISEARRKYIVENVAKAAQKHPNVSVLNIFSDHEYNRSVITIAGSVDELGDSVLAACLEAFRSIDMEVQDGIHPCLGAVDLIPFYPLCGVGVEECGAVARSLAENLLLRVPGCSVFLFGEADLPEKRPLVQRRKQLGWFTR---RDFSALEPDLG-VAPARKCGLTGIGA. 187
264 5.000e-39UniRef50_A0A078FLI7 BnaA09g43590D protein n=28 Tax=rosids TaxID=71275 RepID=A0A078FLI7_BRANA  ali  26  133LGCCKVYISEARNKTALEAIERSAKTFPPAAIVNKFEDAAYGRVGYTLVSASSPLKSAVFAMVKTALDAINLELHCGSHPRLGVVDHICFHPLYETSIDQVSSVATSLARDIGSILRVPTYLYGAAHEDSIRRKLGYFKREGHEWAGGLELEVVPVKPDAGPQEVSKAKGVVAVGA. 323
265 7.000e-39UniRef50_UPI000D6AD29D hypothetical protein n=1 Tax=Oceanotoga teriensis TaxID=515440 RepID=UPI000D6AD29D  ali  34  3LLGAVPNISEGKDEKLIKKIIDMANEYEKMWVISYKMDEYYNRTLLTVIGKPECVMNYLFKMTEICINEIDMKNHSGAHPAIGSVDVIPIIPITEITNDEAQKMALDLSEKISSKFNIPIFSYENSTDISNKKHINYIRKDGFESLKWRMKTG-KLTSDFGPNEPNENAGGCIIGVR 178
266 7.000e-39UniRef50_A0A2E3XML1 Uncharacterized protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E3XML1_9BACT  ali  44  5LIECVPNISEGRNLDIINSIVDSARQVEGVKVLGCEPDSDYNRTVITIAGDPVSVTKGAYAIILKSLELIDMSKHSGNHPRMGAVDVCPFVPLSDNSMKHCVSSAKXLSKLIGEKIP............................................................ 121
267 9.000e-39UniRef50_V9LDB5 Formimidoyltransferase-cyclodeaminase-like protein (Fragment) n=7 Tax=Gnathostomata TaxID=35060 RepID=V9LDB5_CALMI  ali  30  16......NISEARNQCIVEKVAQAAQMETQATVLNIFSDYDYNRSVLTIVAPIETLGCAIVAACTEAYKLIDMEKHSGIHPCLGAVDLVPIYPLSESGLGECAKVAHGVAERLTHAVPECSMFYFGYADQPLKRSLVQRRKESGWF-RKSSSNMDGIKPDVG-TVISPRYGLTGIGA. 190
268 1.000e-38UniRef50_A0A2E2Y828 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2E2Y828_9FLAO  ali  34  5.IECIPNVSTA-DPAILERIAAAIEATEGVTLHFVDPGKSANRTVFTYLGPAVQVFKATETLFEIALAHIDMREHKGVHPRMGAVDVCPFVLLDDHKFEELIGRTRAFAKRISTKHNLAIYGYEQLADRPEHTNLAAVRKGEYEGLVARFNTGDL--PDFGPQSFDRSVGATALSVR 181
269 1.000e-38UniRef50_UPI000A2B2CED QWRF motif-containing protein 3-like isoform X3 n=1 Tax=Arachis ipaensis TaxID=130454 RepID=UPI000A2B2CED  ali  28  545LGCCKVYISESRNKTALESIEKAASLFPKAPIINKFEDVDYNRVGYTLVSEFCQLTCAVLAMVKAAFDAIDFGLHSGTHPRLGVVDHICFHPLAGASLDQAATAARSLATKTGSTLQVPTFLYGAAHEDSIRRTLGYFKPNANQWIGGPTSHTLPLNPNSGPAQVTPAKGVLIIGA. 739
270 1.000e-38UniRef50_A0A1Y0H5U4 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium Uphvl-Ar2 TaxID=2004468 RepID=A0A1Y0H5U4_9BACT  ali  37  3.VLTVPNWSFGRDRRLLADVRELLEARP-VTVHFADSDVDHNRTVTAFSGEPEQVREALFALADRILPAIDLQRHRGVHPRIGALDVCPFVPLRASDSTDLIVFVQDTARQLAERYEVPVFLYEQSERGKHAAALPKLRKGGFGGL-----VDRDIEPDFGPHRVHPHLGATVMGVR 176
271 2.000e-38UniRef50_A0A2B4SJY8 Formiminotransferase N-terminal subdomain-containing protein n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SJY8_STYPI  ali  25  10LVACLLNISEARNKGIVESVANAALNFPSSTVLNIFSDRDYNRSVITIAAPVENIEESVLRACQVAYKEIDLEKHEGGHPRLGSVDLVPIHTISPESLAECGQIALKLGTRIANSIKGTSVFLFGHADQPLVRGLVERRKAVNWYQGVHGMDFSRVGWDLGSP-PSQRYGCTGIGA. 193
272 2.000e-38UniRef50_A0A287DB23 Formiminotransferase cyclodeaminase N-terminal like n=11 Tax=Boreoeutheria TaxID=1437010 RepID=A0A287DB23_ICTTR  ali  29  10LAVCLLNISEARRKYIVENIAKAARKHPEVSVLNIFSDQDYNRSVITIAASVDKLGSCVLAACLEAFRAIDMEVQEGVHPCLGAVDLIPIYPLSDVGVDECGAVARSLAKDLVLHVPGCSVFLFGEADLPKKRSLVQRRKQLGWFTR---RDFSALEPDLG-AAPARRCGLTG.... 183
273 2.000e-38UniRef50_A0A094P901 Uncharacterized protein n=1 Tax=actinobacterium acAcidi TaxID=1504320 RepID=A0A094P901_9ACTN  ali  44  1MLECVINISEGRDLEVIAALSAGL----GDNLLDVHSDPDHNRSVFTLIGE-----EAPRTLTSSAFQLLDMTVHDGVHPRLGVVDVVPFVPLEGSTMDDAVRARHDFATWVTTSLHIPVFFYGP------ERTLPFVRAHAWKDL----------QPDVGPLAPHQSAGAMCVGVR 152
274 2.000e-38UniRef50_H2MKN1 Zgc:153901 n=27 Tax=Gnathostomata TaxID=35060 RepID=H2MKN1_ORYLA  ali  29  10LVACLLNISEARRKDLVETVARAALKREGTTVLNIFNDYDYNRSVITIVASIGSIREAVLSACVKACGLINMCTHTGVHPCLGAVDLIPIYPLGEEGIEDCAQEARAVAQGLTESVQGTSAFLFGWADSLLQRGLAQRRKEMGWF--KKTPDMQAVRPDVGP-QPQRRYGLTGVGA. 189
275 2.000e-38UniRef50_K4ADG7 Uncharacterized protein n=2 Tax=Mesangiospermae TaxID=1437183 RepID=K4ADG7_SETIT  ali  30  7.ICCKLYISESLNAMAIDAIDCAARSDLQVAVLSKFEDCLYNRVRYTLVSYISPIRKVLFAMMEAAFSAINLNLHSGAHPRMGVNDDLSFHPLGQSTMEDAVSLAKQVASDTGNDFRVPVLLYAAAHPAGKRRELGYYRPMGSQWSGSMLPDVLPISPDEGPNNVSSERGATTVGA. 199
276 3.000e-38UniRef50_A0A2I0AAP8 Pentatricopeptide repeat-containing protein n=1 Tax=Apostasia shenzhenica TaxID=1088818 RepID=A0A2I0AAP8_9ASPA  ali  29  85LACCKLYISESRNALALESIERAARLCPEVVIINKFEDKEYNRVGYTLVSDSSALMKAVFSMVEAAFKYVDLKRHFGTHPRLGIVDHICFHPLAQVSLDHAAGLAKSLAADIGRRLKVPTYLYGAAALHSIRRELGYFKPGSKWAGGLQPNLFYAKKPDEGPCEANPARGVVVVGA. 279
277 3.000e-38UniRef50_A0A1Q3NEP7 Uncharacterized protein n=1 Tax=Solirubrobacterales bacterium 67-14 TaxID=1895832 RepID=A0A1Q3NEP7_9ACTN  ali  38  3.LLAVPNVSEGRDFARLDRLEVALGK--EITLLDRHADLDHHRAVFTLAGPAESLAEALSGLAGAATVEIDMTAWQGLHPAIGALDVCPVVWLSEKRRKMAGEVAKEVGAAIGA-MGVPVFLYGDLASGPDRRERAYFRAGGIDALWQRMTSG-ALKPDFGPGQPHPTAGATLVTAR 174
278 4.000e-38UniRef50_E1BL83 Uncharacterized protein n=24 Tax=Amniota TaxID=32524 RepID=E1BL83_BOVIN  ali  29  10LAACLLNISEARKKSIVENIAKAAQRHPEVSVLNVFSDPEYNRSVITIAASIDELGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEECGAVARSLAENLVLSVPGCSVFLFGEADLPEKRPLVQRRKQLGWFTR---RDFSTLKSDLG-AAPARRCGLTGIGA. 187
279 5.000e-38UniRef50_UPI000C051334 uncharacterized protein LOC111322831 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C051334  ali  25  34LVACLLNISEARNKGIVESVANAALNFPSSTVLNIFSDRDYNRSVITIAAPVENIEESVLRACQVAYKEIDLEKHEGGHPRLGSVDLVPIHTISPESLAECGQIALKLGTRIANSIKGTSVFLFGHADQPLVRGLVERRKAVNWYQGVHGMDFSRVGWDLGSP-PSQRYGCTGIGA. 217
280 7.000e-38UniRef50_A0A1Q7DH69 Uncharacterized protein n=1 Tax=Nitrospirae bacterium 13_1_40CM_62_7 TaxID=1805270 RepID=A0A1Q7DH69_9BACT  ali  46  4LVECVPNFSEGRNADTVRALVSVIRAVKGVFLLDEEMDQDHHRAVLTFVGAPEAVGEAAFQAAHAAAGLIDLGRHQGGHPRVGATDVVPFVPIRGVTMEDCVALARREGERIGRELNIPVFLYAQAASHPDRANLE......................................... 139
281 1.000e-37UniRef50_A0A068NSA9 Glutamate formiminotransferase n=1 Tax=Fimbriimonas ginsengisoli Gsoil 348 TaxID=661478 RepID=A0A068NSA9_9BACT  ali  37  3.VLTVPNWSFGRGPSLLGSFQEEL-STADVRVHYTVSDVDHNRTVTAFSGDVAAVESTLLRLCDLAFGWIDMRDHVGVHPRVGALDVCPFVPLGDHAVRESLALAERVAARIGGGYGVPVFLYEKSERGRHEADLPALRRGGFEALRDR-----ELRPDFGPSHAHPKLGVTVLGVR 174
282 1.000e-37UniRef50_K1T4A5 Glutamate formiminotransferase (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1T4A5_9ZZZZ  ali  44  12..................................HDPGEATNRTVVTFVGSPEAVVEAAFAGVRRAAELIDMRHHKGAHPRMGATDVLPLIPISGITLEECAELARTLARRIADELRIPTYCYEASALRPERRNLAVCRAGEYEALPEKLAHADT-APDFGARPFVARTGATTVGAR 156
283 1.000e-37UniRef50_S9YS10 Uncharacterized protein n=1 Tax=Camelus ferus TaxID=419612 RepID=S9YS10_CAMFR  ali  41  369LVECVPNFSEGNNQEVIEAISRAVAQTPGCTLLDVDAGPSTNRTVYTFVGRPEDVVEGALNAARAASQLIDMSRHRGEHPRMGALDVCPFVPVRGVTMDECVLCAQAFGRRLAEELGVPVISY...................................................... 491
284 2.000e-37UniRef50_UPI000C1D3BE4 formimidoyltransferase-cyclodeaminase-like n=3 Tax=Pentapetalae TaxID=1437201 RepID=UPI000C1D3BE4  ali  28  21LLCCKLYISESRNKEALDLIERAVKRDPETVIVNKFEDREYNRVRYTLVSYVSPLHQSVMAMAEAAYEAINLELHSGAHPRLGVVDDIVFHPLGRASLDEAAWLAKAVSADIGNRFQVPVYLYGAAALDTIRRELGYYRPMGNQWAGWTQPEILPEGPNEGPNTVTRARGIAMIGAR 214
285 2.000e-37UniRef50_A0A0L9UMW6 Uncharacterized protein n=2 Tax=Phaseolus angularis TaxID=3914 RepID=A0A0L9UMW6_PHAAN  ali  29  450.....VYISESRNRIALESIERASTLFPLAPIINKFEDVAYNRVGYTLVSEPSHLANAVLAMVKAAFDTIDFDVHSGTHPRLGVVDHICFHPLLDASLDQAATTARCLATDMGSNLQVPTYLYG--AAHEEGRTLDSIRRSENQWIGGLKSDSLPLKPDRGPSQVTSAKGVAVIGA. 632
286 2.000e-37UniRef50_UPI0009E31DCA uncharacterized protein LOC110044482 n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E31DCA  ali  24  10LVACLLNISEARNKGIVESVANAAINFPSKTVLNIFSDYDYNRSVITIAAPVENIEESVFRACQVAYREIDLGKHTGGHPRLGSVDLIPIHTITSVSLADCGNIALNLGRRLVSNIKGTSVFLFGHADQPLVRGLVERRKAVNWYYGQHGMDFSRVGWDLGTP-PSQRYGCTGVGA. 193
287 2.000e-37UniRef50_A0A2P4T7X9 Uncharacterized protein n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4T7X9_BAMTH  ali  40  45LVECVPNFSEGCNKEVIKALGQAISQTPGCTLLDVDAGASTNRTVYTFVGTPEDVVEGALSAARMAWELIDMSRHKGEHPRMGALDVCPFVPVMNISMEECVICAHIFGQRLSEELGVPA......................................................... 164
288 3.000e-37UniRef50_A0A1S3JDM6 uncharacterized protein LOC106172384 n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3JDM6_LINUN  ali  29  5LCACLLNVSEARNVHIIEKIAYAALEVNNAAVLNVFSDYDYNRTVITIAASISHIGQSVFAACEKAFDLIDLRQHEGVHPCLGSVDLVPIHPLSDITLEECGKEAKDLAEKLSSKIPGTSFFLFGW-SHQACRGLVQRRKDVRWFAGHKTLVGNSGIQDVG-AKPGARYGLTGIGA. 186
289 5.000e-37UniRef50_A0A0R2S810 Uncharacterized protein n=1 Tax=Cryomorphaceae bacterium BACL18 MAG-120924-bin36 TaxID=1655591 RepID=A0A0R2S810_9FLAO  ali  36  8.LECVANVSEGRDPAVLDALSSALLALPEVQLWHRDAGWDAHRTVYTFAGPADAVVDGCIALVAAAAQHIDMRQHHGAHPRIGAVDVCPLVALRPEEPALADQAAERVASGLSA-LPAGGWFYSRNARRPEFRLLANVRKGQYEGLEVRQNDF-----DFG--TYHPEFGAMALGAR 175
290 5.000e-37UniRef50_A0A1E3YP98 Glutamate formimidoyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1E3YP98_9BACT  ali  43  3LVESVPNISNARRADVVETGARAVRSA-GARLLDLHRDRDHDRTVYTIAGDPDHVVAALDALADTAITALDLRRQTGVHPRVGVVDVVPFVPIGDVPLETCVALARHFGAGLAARHDLPVFLYDAAATAAPRRRLEAIRRGGLEALAARMQDDPAWRPDFGPAVPHPSAGVTIVGAR 178
291 1.000e-36UniRef50_A0A2D5BBP6 Glutamate formimidoyltransferase n=2 Tax=Cryomorphaceae TaxID=246874 RepID=A0A2D5BBP6_9FLAO  ali  34  1MLECVANVSEGRRSSIIRELGDTIKNTPGVNLIHIDSGFDANRTVFTFLGNETTLSDAIIRLLKSCLLLIDMRNHEGNHPRIGALDVCPIIPIKPXTIXSAKNCIQNIVKRIQNENQVGGWLYRESAIDPKNYELSHVRRDQYETL-----SSSERKFDFG--LFNPKFGALAMGAR 171
292 1.000e-36UniRef50_A0A2E9X0Q6 Glutamate formimidoyltransferase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E9X0Q6_9BACT  ali  42  118ILEAVPNFSEGRDLGWIGELLQVIER-ESVEVLDWTADREHHRSVVTYIGDLESVETASIAAALFAMDGIDLRTHQGLHPRIGALDVLPFVPLHDLTMDLAVESARRVAGRLAEE-GIPVYLYGEAASRPDR-SLASIRRGGFEALQGGF--PAGREPDLAAPQPHPTAGVTCVGAR 298
293 2.000e-36UniRef50_UPI0007607D5B formiminotransferase N-terminal subdomain-containing protein isoform X2 n=3 Tax=Amniota TaxID=32524 RepID=UPI0007607D5B  ali  28  10LAACLLNISEARKKSIVENIAKAAQRHPEVSVLNVFSDPEYNRSVITIAASIDELGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEECGAVARSLAENLVLSVPGCSVFLFGEADLPEKRPLVQRRKQLGWFTR---RDFSTLKSDLG-AAPARRCGLTVT... 185
294 2.000e-36UniRef50_A0A1S3GK14 formimidoyltransferase-cyclodeaminase n=5 Tax=Amniota TaxID=32524 RepID=A0A1S3GK14_DIPOR  ali  40  4LVECVPNFSEGNNQEV--------------RVWRRRGAPSM--SLPCAHGEHPPCPSSV---------------PTGEHPRMGALDVCPFIPVRGVSMDECVLCAQAFGRRLAEELHVPVYLYGQAARTAGRRTLPAIRAGEYEGLPEKLKQAEW-APDFGPSSFVPSWGATVTGAR 148
295 2.000e-36UniRef50_A0A2Y9MVJ5 formiminotransferase N-terminal subdomain-containing protein-like isoform X4 n=1 Tax=Delphinapterus leucas TaxID=9749 RepID=A0A2Y  ali  27  10LAVCLLNISEARRKYIVENVAKAAQKHPEVSVLNVFSDQGYNRSVITIAASVAELGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEECGAVARNLAENLVQRVPGCSVFLFGEADLPEKRTLVQRRKQLGWFTR---RDFSALKPDLG-VAPARRCGLTG.... 184
296 3.000e-36UniRef50_UPI0007B40D08 formimidoyltransferase-cyclodeaminase n=1 Tax=Monodelphis domestica TaxID=13616 RepID=UPI0007B40D08  ali  41  4LVECVPNFSEGNDREAIDAIGRAISQTAGCALLDVDAGPSTNRTVYTFVGPPDAVVEGALAAARVAFQLLDMSKHRGEHPRMGALDVCPKIPRTPAPPRPASCDLC---------------------------------------LLSPQLKKAEWAPDFGPSTFVPSWGATVTGAR 141
297 4.000e-36UniRef50_A0A075FS26 Bifunctional glutamate formiminotransferase/formiminotetrahydrofolate cyclodeaminase (FTCD) n=1 Tax=uncultured marine group II/II  ali  44  1.............................................MTMVGEPESVLRAAIECTTIAVDLIDMRNHSGEHARMGAVDVVPFIPIRAVSMTDCVELSHRYAKSVSQDLSLPVYMYAHSASSHERVRLPDIRKGEYEGLRSKIVT-EEWTPDYGPSEFMPTMGATATGAR 131
298 4.000e-36UniRef50_I3KJ69 Zgc:153901 n=22 Tax=Bilateria TaxID=33213 RepID=I3KJ69_ORENI  ali  30  10LVACLLNVSEARRKDLVETVAKAALRHEGTTVLNIFNDYDYNRSVITIVASIDSIREAILCACEKACGLIDMQTHTGVHPCMGAVDLIPIYPLGEEVREDCTKEALAVAQGLTERVQGTSAFLFGWADFPLQRGLAHRRKEMGWF--KKTPDLRAIRADVGP-QPQKRFGLTGVGA. 189
299 5.000e-36UniRef50_A0A2R6WIX5 Uncharacterized protein n=1 Tax=Marchantia polymorpha TaxID=3197 RepID=A0A2R6WIX5_MARPO  ali  31  164LACCKLYISDSKNVKALETIERAARSQRLAPLLHIFEDKEYNRVGYTLAGPIPPIRSAVMAMVKAAVDSIDLQEHVGSHPRLGVVDHLCFHAIGSASLEQAASLARTVAADIASDLQVPTFVYGAAHEDRRRRELGYFRCNSLGHWEGTPELPSELSPDFGPSIASPKTGVVVVGA. 361
300 5.000e-36UniRef50_UPI000A2A64E2 protein scribble homolog n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A64E2  ali  27  8LVACLLNISEGRSKQVTELVAQSAVGICPSXVLNVFSDSDYNRSVITIAAPVENIEESVYNACKTAFEYIDLSKHSGGHPRLGSVDLIPIHPIHPSTLRECGEIAQRIGKRIVESISGTSVFFFGHADVPQCRGLVNRRKAVQWYQGKSGMSYSNIGYDIG-MSPSQRYGCTGVGA. 195
301 5.000e-36UniRef50_UPI000947E8F6 uncharacterized protein LOC109483963 isoform X1 n=2 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947E8F6  ali  31  5LVACLLNISEGRSKETLEAIAMSALRVCRASVLNIFSDHEYNRSSMTITATVEHIGEAVVHACTSAYQLIDMSRHEGGHPRLGSVDLVPFHPLSGVTLQECGDIAIDVAHKLASTVKGSASFLFGHADRPLCRPLAQRRREVGWFS--TGCPFEELSQDIGE-KPSSRYGITAIGA. 187
302 1.000e-35UniRef50_A0A1Q7WKP0 Glutamate formimidoyltransferase n=5 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1Q7WKP0_9ACTN  ali  40  5.LESVPNFSEGRDRATLDAVAGALSA--RARLLDVHADADHNRSVFTLVADEHALVEALVATIACARERIDLRRHEGAHPRVGAADVVPVVPLRPGDMERAKRAALALAERVGGELDLPVFVYGELAP---GRGPAFFRAEGLEGLSRRVESGE-LAPEFGPARIEDRSGAVLVGAR 174
303 3.000e-35UniRef50_A0A2G9H8Y0 5-formyltetrahydrofolate cyclo-ligase n=33 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2G9H8Y0_9LAMI  ali  28  6LACCKVYISESRNRVALEAIESAAKLFPEAPIINKFEDATYNRVGYTLVSESCPLKNAVLETVKVAFQAIDLERHCGSHPRLGVVDHICFHPLAGISLDHVAGTAKSLAADVGSRLQVATFLYG--AAHHEGRSLDSIRREGHQWVGGPQSEILQVNPDEGPPR............. 182
304 5.000e-35UniRef50_UPI000A2B64D1 uncharacterized protein LOC100522040 isoform X4 n=3 Tax=Sus scrofa TaxID=9823 RepID=UPI000A2B64D1  ali  29  63LAACLLNISEARRKYIVENVAKAAQKHPNVSVLNIFSDHEYNRSVITIAGSVDELGDSVLAACLEAFRSIDMEVQDGIHPCLGAVDLIPFYPLCGVGVEECGAVARSLAENLLLRVPGCSVFLFGEADLPEKRPLVQRRKQLGWFTR---RDFSALEPDLG-VAPARKCGLT..... 236
305 7.000e-35UniRef50_A0A0G3V4B9 Glutamate formiminotransferase n=1 Tax=Actinobacteria bacterium IMCC26256 TaxID=1650658 RepID=A0A0G3V4B9_9ACTN  ali  40  3MLECVVNISEGQDAAVLASLDEA----CGDALLDRHTDVDHHRSVFTLANDSSACIDAARALTDAASSRIDIRTHFGVHPRLGVIDVVPFVALHSTPSSEATIAAIDYAKWVVEAHRVPVFLYGDA--DSENRSLPDARRTAFK----------TRAPDLGPDEPHPTLGAIAVGAR 164
306 9.000e-35UniRef50_A0A2G4FEU2 Glutamate formiminotransferase n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2G4FEU2_9ACTN  ali  37  7VLECVVNISEGRDRSTLVELAE----VCGPTLLDQNSDYDHNRSVFTLAGPPADAIAATVDLARAVASRLDLTNHHGVHPRLGALDVVPFCEIEG-PMAIAVEAARAFGYWAGAELDLPVFFYDEA--DPEQRSLPVLRAQAF----------SSRAPDAGPNQPNPRLGAVAVGAR 167
307 1.000e-34UniRef50_A0A1E5VDA4 Chaperone protein dnaJ GFA2, mitochondrial n=2 Tax=Poaceae TaxID=4479 RepID=A0A1E5VDA4_9POAL  ali  28  488LACCKLYISEARNAPALRAIERAAGLRPAAVLVNAFSDDAYNRVGYTLVSRQPPLHRAAFGVVEAALEAVDFGAHAGAHPRLGVVDHIAFHPLAGAHLDDVAALTRAVAADIGDKLQVPTYLYGAAHSQGRRRQLGYFNSPGEQWQGAPDASSLPVAPDAGPMTPSRSKGVVAIGA. 684
308 1.000e-34UniRef50_A0A1Q3MIK6 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MIK6_9BACT  ali  34  3....VPNWSFGREAGLLRRF-REILSSDLITLHYCEADIDHNRTVTAFSAEEDVVVDTVIRLAMEAFETIDLNRHIGVHPRIGALDVCPIVRPTDIQLMNALAAAEKLAGLLASTFQLPVFLYEKSERGRHEADLPSLRKGGFGALLTK-----DLRPDFGPPRAHPQLGVTVLGVR 175
309 2.000e-34UniRef50_A0A1F7WHJ9 Glutamate formimidoyltransferase n=1 Tax=Candidatus Woesebacteria bacterium GWA1_41_8 TaxID=1802471 RepID=A0A1F7WHJ9_9BACT  ali  45  1.......................................................................MRKHKGEHPRIGATDVVPFVPVSGVSLKECVVLSNKLARTVSSKLKIPVYMYEASAKRNDRINLADVRKGEYEGLKIEIESNPSRKPDYGPSKMHPTAGAIVIGAR 106
310 2.000e-34UniRef50_A0A2N9ISC6 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9ISC6_FAGSY  ali  27  75LLCCKVFISESRNLTALDEIEQAARLNPETVIVSKLEDKVYNRVRFTLVSYVQPLQQTVLAMVEAAFGAINLELHTGDYPRLGVVDDILIHPLAQASLDEAVWLARAMAADIGNQFQVPIFLYNEAHPTKKALPTIRHELGYYKNTNKTMPDMRLHKPDEGPFEVSRARGIATIGA. 260
311 2.000e-34UniRef50_A0A1W5AEH7 formimidoyltransferase-cyclodeaminase-like isoform X1 n=51 Tax=Osteoglossocephalai TaxID=1489341 RepID=A0A1W5AEH7_9TELE  ali  31  30LVACLLNISEARNRDAVEKVARAAARKEGTSVLNIFSDRDYNRSVITISASVESVGEAVLSACEEACRLVDVRNHIGVHPCLGAVDLIPLYPLGDVGLEECGIEARVLAARLTELVPGTAAFYFGSADMPLHRGLAQRRKEIGWF--RKTTDLSCTQPDVG-GRPQSRYGLTGVGA. 216
312 2.000e-34UniRef50_A0A1H6FUK1 Glutamate formiminotransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A1H6FUK1_THEAL  ali  38  1MLLAVPNVSEGRDRRLLGELAGAFEPW---LLLDLHADPDHNRSVLSLASQKQPAVEGLLAGVRRCLAAIDLASHEGVHPRVGAVDVLPIVYPREQERSRAIALALTVAARIGDELTLPVFLYGELATDPAHRERAELRRGGPEELGRRLASGE-LRPDFGPAVLDPRAGALLVTAR 175
313 2.000e-34UniRef50_A0A094RH04 Uncharacterized protein n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A094RH04_9ACTN  ali  42  54VLECVINISEGRDVDRLTQLAEICATD----LLDVHFDPEHNRSVFTLMG-----ITAPRRLTELAVQLLQLDMHQGVHPRLGVVDVVPFIPLDESTMREAILARDEFAHWASSELSIPCFLYG------DERSLPDIRRQAWINL----------QPQCGPDVPHSTAGAVCVGAR 205
314 3.000e-34UniRef50_A0A0G0WMU4 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A0G0WMU4_9BACT  ali  43  4IVECVPNFSEGRTLKVINSIFDAAK-IKGVKVFELEYNRDHNRMLFTIVGEPEAVLASVFESIKTATKLIDMNKHVGEHPRIGATDVVPFVPVSGVTMKECVEISNQLAKKVAD............................................................... 116
315 5.000e-34UniRef50_A0A2P4MEW0 Glutamate formimidoyltransferase n=1 Tax=Quercus suber TaxID=58331 RepID=A0A2P4MEW0_QUESU  ali  29  151LLCCKLFISESRNRAVLDAIEQAARLNPETVIVSKFEDQAYNRTWYTLVSYVSPLQQAVLAMVEAAFGAISLELHSGTYPRLGVVDEILFHPLARASLDDAAWLAKAVAADIANQFQVPVFLYDAAALDTIRRELGYFRSMGNQWAGRTLPDMLLENPDDGPSEVSARGG....... 337
316 1.000e-33UniRef50_T1AMQ4 Glutamate formiminotransferase (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1AMQ4_9ZZZZ  ali  49  3.............................................................MMTVATEVIDLTHHTGEHPRMGATDVVPFVPLGGATVEEAVRLAERLGERVWKELGIPVYLYGSAARRPERVDLPAVRKGGFEGIREEIGKNPDRAPDVGESRVHPTAGAVAIGAR 118
317 1.000e-33UniRef50_V8P718 Formimidoyltransferase-cyclodeaminase (Fragment) n=1 Tax=Ophiophagus hannah TaxID=8665 RepID=V8P718_OPHHA  ali  40  1...............VIDEISKAISQTKGCLLLDVDAGSSTNRTVYTFVGSPEDVVVGALNAAKIAFQFIDMAKHKGEHPRMGALDVCPFIPVRNVTMEECVYSANLFGKCLADELHL---------------------------------KKAEWTPDFGPATFVPRWGATVTGAR 129
318 2.000e-33UniRef50_L1JP83 Uncharacterized protein n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1JP83_GUITH  ali  31  11...CMANVQEGRDAKKLRAMAEAASSIPRAWLLRVFSDRTFHRSGFCLAGAPDAVGNAAIALSRRAAEYIDLGSHVGEHHHVGAVDLLPFHPIGAATMEDAAEVARRVSKTLGEEMGLSVLTYGHAHPTRRRKQTSFFKRGPHALHASSHAVSSEVKPDFGPEVPDQRRGITVCGA. 203
319 4.000e-33UniRef50_A8HWL3 Predicted protein (Fragment) n=2 Tax=Chlamydomonadales TaxID=3042 RepID=A8HWL3_CHLRE  ali  31  1...CNVYISEGRDKALIGKLEAAAQATPGVALVNVFQDEPYHRTGFTLVGQPDRLTEAVVRLSRAALQLLDLRRHDASHPRLGVVDHIALHPLGGLAPA-AATHSRGVATTVAEVPALPVYFYGHAHPSRRRRKLGYFRRSPEGGWRGGLEDLSAFPPDLGPATASARWGVVTIGA. 191
320 6.000e-33UniRef50_A0A2M8Q8H3 Glutamate formiminotransferase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2M8Q8H3_9CHLR  ali  44  3IIESVPNFSEGRRPEVIAALAEAIQA-PGVLLLDVSSDPDHNRTVITVAGEPDAVLEGLFRAVATAAQRINLFEHRGEHPRLGAADVVPLVPIEGITLEACVELAHRLGRRIGE............................................................... 115
321 7.000e-33UniRef50_B4F7V5 Glutamate formiminotransferase 1 n=52 Tax=Mesangiospermae TaxID=1437183 RepID=B4F7V5_MAIZE  ali  28  22.ISCKLYISESRNATAVDAVERASKSDPQVVVVSQFGDHHYNRFRYTLVSYHSPIRKVLLAMIEAAFSSIDLESQSGAHPRIGVVDDLSFHPVGQATIEDAASLARQVASDIACIAAVPVFLYAAAHPAGKRRELGYYRPNGNQWSGSVLPNVLPVKPDVGPAHVSHKRGATTVGV. 222
322 8.000e-33UniRef50_A0A2I0HQ05 Uncharacterized protein n=2 Tax=rosids TaxID=71275 RepID=A0A2I0HQ05_PUNGR  ali  26  5MLACKVYISESRNRVALESIERAARLSKGAAIVNKFEDAIYNRVGYTVVSDSCPLKAAVLAMVKAAFDAVDLELHLGSHPRLGVVDHICFHPLAQTSVDQVVLTARSLAMDIGSGLQVPAFLYGAAHEDSIRRALGYFKPNGNLWAGGLNSNPLPLKPDEGPSQ............. 184
323 9.000e-33UniRef50_A0A0S7LR46 FTCD (Fragment) n=6 Tax=cellular organisms TaxID=131567 RepID=A0A0S7LR46_9TELE  ali  41  4LVECVPNFSEGRDQKVIDAIAAAISDTAGCSLLDVDPGASTNRTVYTFRRAPRRWCEGALSAARRAFGLIDMSKHSGEHPRTGALDVCPFIPVQNVSMDDCVHCANEFG.................................................................... 113
324 1.000e-32UniRef50_A0A2E6EKC3 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E6EKC3_9RICK  ali  34  7LVEAVPNFSEGRDQRVIDAIAAALDGA-GSRVLHVDPNVDANRTVVTLAGPLSAVMAALHRGVGVALNEIDMRKQQGAHLRIGAADVLPVVCLGEAVRAACRFAVDQLAEQLVDDYQLSLFLYESSARRPDFAALPRCRKGGYEALPDRFVRPDD-GPDLGPGLNSSRLGASVLGLR 186
325 1.000e-32UniRef50_A0A1Q7EMY2 Uncharacterized protein (Fragment) n=1 Tax=Actinobacteria bacterium 13_1_40CM_66_12 TaxID=1803491 RepID=A0A1Q7EMY2_9ACTN  ali  35  6LYESVPNFSEGTRTEV---IAELAGAAAHAHVIDVDADADHNRVVISLVGHEPHVVKALLACAQVAMERIDLREHRGVHPRVGTADVLPIVPLEGASLADAHEVARALGERIWTELNVPVYFYG----HGEVNTLADIRAGR-------------ARPALGGPEPHTSAGAVCVGAR 162
326 2.000e-32UniRef50_A0A151EMZ2 Glutamate formiminotransferase (Fragment) n=1 Tax=Theionarchaea archaeon DG-70-1 TaxID=1803814 RepID=A0A151EMZ2_9EURY  ali  50  1..................................................................IKVIDMRKHKGAHPRMGAVDVVPFVPLKNITLEECIELSKRFARVLSERHNLPVFLYDESATSIERRDIDYLRKGEFEGLEDHIK---EVKPDFGPETPHLTAGATITGAR 108
327 3.000e-32UniRef50_A0A2U4BMJ3 formimidoyltransferase-cyclodeaminase-like n=2 Tax=Cetartiodactyla TaxID=91561 RepID=A0A2U4BMJ3_TURTR  ali  28  135LAVCLLNISEARRKYIVENVAKAAQKHPEVSVLNVFSDQGYNRSVITIAASVAELGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEECGAVARNLAENLVQHVPGCSVFFFGEADLPEKRTLVQRRKQLGWFTR---RDFSALKPDLG-VAPARRCGLTGIGA. 347
328 4.000e-32UniRef50_A0A0C1X231 Formimidoyltransferase-cyclodeaminase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A0C1X231_9CYAN  ali  46  1..............................................TFVGAPEPVIEAAFQAMKKASEVIDMSKHSGEHPRMGATDVCPLIPIAHITMEEVAEWAHKLAKRAGEELGIPIYMYESAATKPAWRNLATVRSGEYEALPDKLGQPEW-KPDYGPAKFN........... 119
329 1.000e-31UniRef50_A0A072VB96 Formiminotransferase-cyclodeaminase-like protein n=2 Tax=rosids TaxID=71275 RepID=A0A072VB96_MEDTR  ali  28  7LLCCKFFVSEGRNIATLDAVERAVRMNPEIVIVHKFHDRAYNRARYSLVSYVNPLQQIVLAMAEAAFNAINLELHDGAHPRLGAIDDIVFHPLACASMDDAAWLAKAVAADFGNQFNVPVFLYAAAHPTGKRRELGYYRPMGNQWAGWTMPDILPQTPDEGPINVSRTR........ 192
330 1.000e-31UniRef50_UPI000D626911 uncharacterized protein LOC102630112 n=1 Tax=Citrus sinensis TaxID=2711 RepID=UPI000D626911  ali  26  28LACCKVYISESRNKAALESIEQAAKLFSEAAIVNKFEDVTYNRVGYTVVSNSHPLKSTVFAMVKAAFENIDLDMHSGSHPRLGVVDHICFHPLASAPLGQVAKIAKSLAGDIGSDLQGLLYSYEKGRALSERTSALAVQQTGNQWAGGLNSESLLVKPDRGPDQVTQSKGVIVIG.. 238
331 2.000e-31UniRef50_L5LDQ1 Formimidoyltransferase-cyclodeaminase n=1 Tax=Myotis davidii TaxID=225400 RepID=L5LDQ1_MYODS  ali  31  10LAACLLNISEARRKHVVENIAKAAKKRPEVSVLNIFSDQDYNRSVITIAASVDELNHAVLAACVEAFRSIDMEAQEGIHPCLGAVDLIPIYPLAGVGVEECGAVARRLAETLVLRVPGSSVFLFGEADLPKKRPLVQRRKQLGWFAR---RDLSALEPDLG-AAPARRCGLTGVGA. 232
332 2.000e-31UniRef50_A0A136KWD9 Putative formiminotransferase-cyclodeaminase (Fragment) n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A136KWD9_9CHLR  ali  46  5LIECIPNFSEARRPEIIDQIVAAIQSVSDVKMLDRSSDLDHNRTVLTFAGSPAGVEEAAFLAIKTASELIDLDHHTGEHPRIGATDVVPFVP..................................................................................... 96
333 2.000e-31UniRef50_G1TTZ8 Uncharacterized protein n=6 Tax=Euteleostomi TaxID=117571 RepID=G1TTZ8_RABIT  ali  33  4LVECVPNFSEGNNQEVIDAISRAITQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGALNAARVASRLIDMSRHKGER--------GPGPTLSAGVLGQAQAWLWEKGRLCTSTFGSS-----------------WARAPPEPGWTSSQLKQAEWAHDFGPSSFVPSWGANAPGAR 155
334 4.000e-31UniRef50_A0A1M4SXD1 Glutamate formiminotransferase n=1 Tax=Ferrithrix thermotolerans DSM 19514 TaxID=1121881 RepID=A0A1M4SXD1_9ACTN  ali  34  1MIECVLNISEGSNYAALTDLA----NLSSRSLLDLHFDPHHNRSVFTLAG--DHLLEDLMEMTLYCAAHLNIDSHSGVHPRLGIIDVAPFIPKMGSSFDEAEAMRQAFAEFLARELDVPSFYYGK------ERSLPYVRKHAFQGL----------MPDIGPQESHKFLGASCLGVR 155
335 7.000e-31UniRef50_A0A257RQD1 Glutamate formimidoyltransferase (Fragment) n=2 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A257RQD1_9BACT  ali  50  2..........................................................................HTGEHPRMGATDVVPFIPLEGTSMDDCIALARQLGERAAAELDIPVFLYERAATRPDRENLADVRRGEFEALRDEIGTTPARTPDFGPARVHPTAGATAVGAR 104
336 3.000e-30UniRef50_X1QQ99 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1QQ99_9ZZZZ  ali  46  8IVESVPNYSEGTDGDKIERIVAEIKNTPETNIVDIQYDSDYNRAVITFVGSPEAVLKANIAAAKKAIDLIDMNNHEGQHPRIGAIDVVPFIPAQNITIEECIELSKQFAEEMAKE.............................................................. 122
337 3.000e-30UniRef50_UPI000C77BF17 uncharacterized protein LOC111706268 n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C77BF17  ali  30  6LIACLLNISEGRREKILETIKTIVTGGVTATIISTFSDKEYNRTVLTICGDEKGVSDAVTSTSCQVMKYIDIRVHQGGHPRLGAVDLIPIHPLTDISLEECGRIARKIANSI-EQQNVSSSFYFYGGSDPTNRTLINKRKEFGWFNSVIKKT-----PDMG--TYNPQVGLSGVG.. 178
338 4.000e-30UniRef50_W4ZHX9 Uncharacterized protein n=2 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4ZHX9_STRPU  ali  28  9...CLLNISEARNRLILENVAQAATRSTGSSVLNIFQDIDYNRSVLTIAAPINHLKTAVCGACKEAYRRIDLSKQEGVHPRLGAVDLIPIYPLSSVSLKECGEIAHSIAEELSDEITGTSFFLFGSADWPEQRGLVPRRKAVGWFKGKHGIDWSKFSHDLGAP-PSSRYGLTGCGA. 212
339 6.000e-30UniRef50_A0A0D8FTV9 Uncharacterized protein n=1 Tax=Ferrimicrobium acidiphilum DSM 19497 TaxID=1121877 RepID=A0A0D8FTV9_9ACTN  ali  37  1MLECVVNVSQGRDRATIDSLIEC----CGRSLLDVHTDFDYDRSVFTLAGP--RVYDDVQLLARRVFELVDFRSYGGVHPALGALDVVPFVPLGATPLEAAVSMRDRLGSWLAVAFDLPVFVYGG------ETTLPQLRKGAF----------VSVSPTYGNPQPNPIFGAVCVGAR 155
340 7.000e-30UniRef50_A0A0F9FC20 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0F9FC20_9ZZZZ  ali  47  1.......................................................................MSAHTGAHPRMGACDVCPFVPVSGITMLECADLAHRLGQKVGEGLGIPVFLYERAASSPGRKNLADIRSGEYECLEEMLKNPEW-KPDFGPADYSERTGATVIGAR 108
341 8.000e-30UniRef50_A0A0R2SIY3 Uncharacterized protein n=3 Tax=unclassified Cryomorphaceae TaxID=253244 RepID=A0A0R2SIY3_9FLAO  ali  35  1MVECVANVSEGRNLVTLDRMSTAIRQIPGCLLLHRDVGHDAHRSVFTFAGSGEAVAHAALALADVCLRDIDMREHQGSHPRIGALDVCPIVPLSPEADSEADAAVAAIAAGLQNR-GVGGWLYAQSACYPAYADLAEVRRGEYEGLPHRSIPM-----DFGTYQ--PAFGATALGKR 169
342 3.000e-29UniRef50_D8SZX2 Uncharacterized protein n=7 Tax=Embryophyta TaxID=3193 RepID=D8SZX2_SELML  ali  27  1MACCKMYVSTSSNRQAMENIEQAMRGHPQVPLLHTFRDEHYDRVGYTLAGSRENFADAIVDMIRAAILNIDLQKQSGSHPRLGVVDNLCFHPLKEASMDQAAELARSCARSIGAKLQVPTFLYGAAPLDAIRRSLGYFKAKPGIWQGSSNNTRLSQPPQFGPAHFPASTGIITAGA. 189
343 3.000e-29UniRef50_UPI000B91026E uncharacterized protein LOC110980206 n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B91026E  ali  27  7...CLLNISEGRNPKVVTVSDAEIGLQCKSTVLNVFSDYDYNRSVLTIAAPLKYLQDSIYNACREAYGQIDLGKQRGVHPRLGAVDLLPIYPLRDVRVEECGVIAKEIASTLAVDIPGTSFFLFGTSDVPHNRDLVARRKEVGWFLGRHHTDYGSLQYDLG-SRPSAKYGLTGAG.. 192
344 4.000e-29UniRef50_A0A136LFM6 Glutamate formiminotransferase (Fragment) n=1 Tax=Armatimonadetes bacterium OLB18 TaxID=1617424 RepID=A0A136LFM6_9BACT  ali  29  3LLLTIPQWSLGRDRVLTSAVEDLIRGA-NVSFHYCRSDVDLNRTVTAFSGKPNHVIGTLYELCAHYFDRIDLNRHVGAFPRIGALDVCPFVEVGGGGWEALLSVARAFGERLARTYDLPVFLYERSEGVRSESELAELRLGGFGGLMGKKLSS-----DYGPTQVHPRLGVTYTGVR 177
345 4.000e-29UniRef50_A0A1Q7F9S4 Uncharacterized protein n=13 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7F9S4_9CHLR  ali  38  6LFESVPNFSEGSRADV---IAELAGAAAPAHVLDVDADADHNRVVISLAGEGHHLLDALMASVQVAIDRIDLNDHVGVHPRVGAADVIPIVPLGGATIATARDLAHRLGERIWSELHVPVHYYG----DGESPTLADIRAGR-------------QSPILGGPELHVSAGAISVGAR 162
346 5.000e-29UniRef50_A0A250WWQ9 Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250WWQ9_9CHLO  ali  30  60VLAAIVYISEGRRRHVLEEILAVGRSDPRVLLLNVFEDSQYNRTGLTLTSTPEQLQRIAVSLVQKAVELIDLREHTALHPRLGVADHVSVHPLHSTTMSTAAECAQAIGEKVAVTTNIPVYLYGHAHTQGRRRQLGYFKSPSLWEGALPFRSLDHYPPDLGPTQVPEGLGVTTVGA. 283
347 7.000e-29UniRef50_A0A257RTB1 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A257RTB1_9ACTN  ali  39  1MFECVINVAEGRDLDALDDLARRA----GSSFRDLHSDPMHHRSVFTLVANAPELARDVRALISAAYEHFDLRRHEGVHPRFGVVDVVPFVAYHD-DEATALALRDETADWLVETYGVPVFFYVGQPTLGQR-TLPEVRRGAF----------RDFSPDRGPNEPTPAKGAVALGVR 161
348 1.000e-28UniRef50_UPI000870B55D formimidoyltransferase-cyclodeaminase-like isoform X2 n=1 Tax=Pyrus x bretschneideri TaxID=225117 RepID=UPI000870B55D  ali  32  6LGCCKVYISESRYRAALDSIERAAKLFSEARIVNKFEDETYNRVGYTLISDRCPLRMAVLAMVKAAFETIDVESHCGSHPRLGVVDHVCFHPLLGASLDQVAGVANSLVEDVGSSFQVPTFLYG--AAHEEGRTLDSVRR..................................... 151
349 1.000e-28UniRef50_A0A1Y0GXD2 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium Uphvl-Ar1 TaxID=2004467 RepID=A0A1Y0GXD2_9BACT  ali  30  3.ILAVPNWSIGRERTVLRQAFDFLESTP-VTVHFAEADIDHNRTVTAFSGTPHNVQQTLLGLAEILLPAINLQRHTGVHPRIGGLDVCPFIPIPETQESTLQSFITETAQILAQTHHIPIFLYEHSAP---GKSLPNLRKGGFGELINR-----PLNPDFGPNQAHPHLGATVLGWR 215
350 1.000e-28UniRef50_C7M2Q3 Formiminotransferase domain protein n=1 Tax=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) TaxID=5259  ali  37  1MLECVINLAEGRETRAVEAIVQAAAP----ALLDVHVDADHNRSVFTLAGP--MVEDAAWSIAEAAAHLLDIRHHVGVHPWLGAIDVVPFVPLGTASLDAAIEARNRMGARLASELSVPVFFYGP------ERGLPEVRRRAF----------RDLAPDLRPTRPNPRLGASCVGAR 155
351 1.000e-28UniRef50_A0A2N9N0J8 Fragment of glutamate formimidoyltransferase + methenyltetrahydrofolate cyclohydrolase n=2 Tax=Acidobacteria TaxID=57723 RepID=A0  ali  44  1..............................................................MEKAVALIDLTTHQGAHPRIGAADVVPFIPIEGVTLEGCVKLAERVGHEIWNRLQVPVYFYEAAAKRPDRVNLENIRRGQFEALVKEVGVVPERQPDCGDRC-HATAGATVVGAR 114
352 2.000e-28UniRef50_A0A2W6A6Q4 Uncharacterized protein (Fragment) n=1 Tax=candidate division AD3 bacterium TaxID=2052315 RepID=A0A2W6A6Q4_9BACT  ali  39  6.......................AALAGGRHVLDVHADPDHNRSVVTLAASPDVLIDELTAQVATAVERIDLASHAGVHPRVGAADVVPIVPLGEVTMAEAVNAAHRLGERLWRELGLPVFFYGEA---GGGRRLVEIRR-------------RSLAPDLGGPRLHPRAGAVCVGAR 144
353 2.000e-27UniRef50_C1E2A7 Uncharacterized protein n=2 Tax=Micromonas TaxID=38832 RepID=C1E2A7_MICCC  ali  26  19...AVVYVSEGKDADVLQTVAEKACQQHGTRVLNVFRDDEYNRTGFTLGVSVEPLKQSALALTEQALKTIDLRNHSATHPRCGAVDHISCHAVGDAPDDLAAQLAKCLGEGIGDRLKVPVLLYGLASSTGTRRKYGYFRRTSQGWSGAHRVGDGQVEADYGPSTIPPESGILMLGA. 212
354 3.000e-27UniRef50_A0A2K6FQF8 Formiminotransferase cyclodeaminase N-terminal like n=16 Tax=Euteleostomi TaxID=117571 RepID=A0A2K6FQF8_PROCO  ali  36  8LAACLLNISEARRKYIVENIAEAAQKHPEVTVLNIFSDQDYNRSVITIAASVDKLGSAVLAACLEAFRAIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEE............................................................................. 113
355 4.000e-27UniRef50_A0A293ML94 Formimidoyltransferase-cyclodeaminase (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293ML94_ORNER  ali  41  1.......................................................................MSKHKGEHPRLGAMDVCPFIPVRGVEMEECVYCARKFGEKLALELKVPVYLYGFAAQHDYRRTVPQIRSGEYEGIAEKILKPEW-KPDYGPAEFVP.......... 95
356 4.000e-27UniRef50_I1II92 Uncharacterized protein n=2 Tax=Brachypodium distachyon TaxID=15368 RepID=I1II92_BRADI  ali  31  206LACCKLYVSESRSAAALRAVEQAARRHPAVVLVNRFADDAYNRVGYTLVADSSPLRRAVVGMVGAALDAIDLRSHAGAHPRLGAVDHVCFHPLDASSLRLVADLAAAAAADIGDNLQVPTYLYGAAHR--EGRTLAAIRRQLGYFHSPRDGQWLPVAPDAGPGTPSASKGVLVMGA. 391
357 5.000e-27UniRef50_H2P3H4 Uncharacterized protein n=20 Tax=Amniota TaxID=32524 RepID=H2P3H4_PONAB  ali  33  3...................................................................QLVECVPNFSEGKNQEALDVCPFIPGRGVSMDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQAEW-APDFGPSSFVPSWGATATGAR 111
358 6.000e-27UniRef50_A0A2V6RY37 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6RY37_9BACT  ali  40  20............................................................AGSARVFARVDMREHHGMHPRLGALDVLPFVPLRDLTMDDAVAVARRVGASVARAYALPVYLYGAAASRPQRRLARDIRRGEYESLAARLADP-AWQPDAGPATFVARLGAVMVGAR 135
359 7.000e-27UniRef50_A0A209R3U1 Glutamate formiminotransferase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A209R3U1_ECOLX  ali  56  1..................................................................................GATDVCPFVPIKDITTQECVEISKQVAERINRELDIPIFLYEDSATRPERQNLAKVRKGQFEGMPEKLLE-EDWAPDYGDRKIHPTAGVTAVGAR 94
360 2.000e-26UniRef50_I0YZZ2 Formiminotransferase n=2 Tax=Chlorophyta TaxID=3041 RepID=I0YZZ2_COCSC  ali  30  8...CNVYISEGLRSTLVQQLVCADKCISGSALVHTFVDKPYNRTGFTLVSPPHELAGSVVRLARAALETIDLRSHAASHPRLGVVDHISCHPLRDAALTAAAETARSIGTQLGEELAVPVFLYGSAGSQQ--RSLADLRRACGYFKGSKISMPAGMRPDFGPSELDPRRGLATVGA. 191
361 2.000e-26UniRef50_M3ZMI5 Zgc:153901 n=2 Tax=Xiphophorus maculatus TaxID=8083 RepID=M3ZMI5_XIPMA  ali  28  10LVACLLNVSEARRTDLVENVAKAADAEGQSVTFSLSSQCDYFQTAFSALNAPFPPGDAVLSACQEACALIDMRGHVGVHPSMGSVDLIPIYPLGEAVGEDCVQQALAVARGLTDTVRGSSVFLFGWADAALQRGLARRRKEMFWF--RKSPDLRALTADVGPP-PRERYGLTGVGA. 188
362 2.000e-26UniRef50_A0A1D1Z590 Formimidoyltransferase-cyclodeaminase (Fragment) n=1 Tax=Anthurium amnicola TaxID=1678845 RepID=A0A1D1Z590_9ARAE  ali  32  5LACCKLYISESRNALSLESIEQATKFYPEVVTVNKFKDEEYNRVGYTLVSDAEPLRKAVFDMVREAFRTIDLQLHSGTHPRLGVVDHICFHPLSLASLNQVAGLAESLADDIGRK.............................................................. 127
363 3.000e-26UniRef50_A0A2K5K1F2 Formiminotransferase cyclodeaminase N-terminal like n=2 Tax=Colobus angolensis palliatus TaxID=336983 RepID=A0A2K5K1F2_COLAP  ali  33  10LAACLLNISEARRKYIVENIAKAAKKHPQVSVLNIFSDQDYNRSVILIAASVDKLGSSVLATCLEAFQAIDMEVQEGIHPCLGAVDLIPIYPLSGVTVE.............................................................................. 114
364 4.000e-26UniRef50_A0A0D8HDH4 Uncharacterized protein n=2 Tax=Acidithrix ferrooxidans TaxID=1280514 RepID=A0A0D8HDH4_9ACTN  ali  34  11.LEVVANVSEGQRQNVIDEIAVA----SGTSLLDLHSDPYHNRSVFSLYGRT--LRDDLRSLAIKTIEKIDIASHHGVHPRIGSLDVVPFVWLSKCTEDDARQARDLFATWLWEELSVPSYLYG------TGRTLPRLRSDFNAGQ----------APDIGDLSKVQRSGAVAVGER 170
365 5.000e-26UniRef50_A0A2H0XYN9 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=197552  ali  45  4IIECIPNFSEGRDPKIIQAITDAIQSVSGVKLLDVDPGADTNRTVVTFIGSKSSALEAAFAGIAKAAEVIDMRKHHGAHARIGATDVCPFVPISG.................................................................................. 98
366 1.000e-25UniRef50_A0A2G2Z3M8 Uncharacterized protein n=5 Tax=asterids TaxID=71274 RepID=A0A2G2Z3M8_CAPAN  ali  27  6LSCCKIYISESKNKAALKSIEKAAKLFPECPIVNKFEDEIYNRVGYTLVSKSTNLKNASFAMVKVAFEKIDFQEHCGTHPRLGVVDHICFHPLSGTSLDLIADTAKSLAFEVGSNLQ............................................................ 123
367 3.000e-25UniRef50_A0A2P5Y0X3 Uncharacterized protein n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5Y0X3_GOSBA  ali  31  54................................................VSALSPLQQTFLAMFEVAYETINLEQHSGTHPRLGVVDDIVLHPLARASLDEAAWLTKAVTTDIGNRFQVPVFLYGAAALDSIRRELGYYRPNFNQWAGWTMPEILSVKPDEGPTCVSRARGITMIGAR 189
368 4.000e-25UniRef50_C9M5F3 Formiminotransferase domain protein n=2 Tax=Jonquetella TaxID=428711 RepID=C9M5F3_9BACT  ali  40  1.......................................................................MEKQEGKHPRIGAQDTIPVFPLLGVSLDECKAFAEDLGQKLYDRFKVPVYFSGVNARCEERKELAFIRKGQYEGLKAVAHTPE-RAPDIGPAALHPSAGATIVSA. 104
369 7.000e-25UniRef50_A0A2I3RPP4 Formiminotransferase cyclodeaminase N-terminal like n=15 Tax=Eutheria TaxID=9347 RepID=A0A2I3RPP4_PANTR  ali  33  10LAACLLNVSEAGRKYIVENIAKAAKKHPQVSVLNIFSDQDYNRSVITIATSVDKLGSSVLAACLEAFQAIDMEVQEGIHPCLGAVVLIPIYPLSGVTVEE............................................................................. 115
370 7.000e-25UniRef50_A0A2P6S2Y7 Putative glutamate formimidoyltransferase, Formimidoyltetrahydrofolate cyclodeaminase n=3 Tax=fabids TaxID=91835 RepID=A0A2P6S2Y7  ali  31  20LLCCKLFISESRNLAVLDAIERAARLDPESVIVNKFEDRAYNRVRYTIVSYVSPLHQTVLAMAEAAFGAINLEQHSGAHPRLGVVDDIVFHPLARASLDEAAWLAKAVAVDIGNKFQGCS......................................................... 149
371 7.000e-25UniRef50_A0A0Q3XB44 Formimidoyltransferase-cyclodeaminase-like protein n=1 Tax=Amazona aestiva TaxID=12930 RepID=A0A0Q3XB44_AMAAE  ali  36  1.................................................................................MGALDVCPFVPVMXVSMEECXTXAHVFGQRLAAELGVPVYLYGEAAREESRKALPTIRAGEYEALPKKLAKPEW-APDFGPPTFVSRWGATVTGAR 95
372 8.000e-25UniRef50_C3Z6X6 Uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3Z6X6_BRAFL  ali  37  7LVGCLMNISEGRSKETVEAIAMSARDGCRASVLNIFSDHDYNRSVLTIASTVEDIGEAVFQACTSAYQDIDLSRHEGGHPRLGSVDLVPLHPLSGVTLQECGEIA........................................................................ 120
373 1.000e-24UniRef50_X1GVC7 Uncharacterized protein (Fragment) n=2 Tax=root TaxID=1 RepID=X1GVC7_9ZZZZ  ali  43  4LVECIPNVSEGRRKNIIEALRDEIISVKGIKLLDYSSDIDHNRSVFTFVGSPEKVLEVAYKLAAKSLELIDLNKHKGEHP................................................................................................. 83
374 2.000e-24UniRef50_UPI000D62F598 formiminotransferase N-terminal subdomain-containing protein isoform X3 n=3 Tax=Cynoglossus semilaevis TaxID=244447 RepID=UPI0  ali  31  19LVACLLNISEARRKDLVETVAMAAVRRGGATVLNIFNDHDYNRSVITIVATIDSIREAVLSACEKACSLIDMRVHVGVHPCMGAVDLIPIYPLGEEGVQDCAKEAQGEKSSVGSRGSGP.......................................................... 144
375 2.000e-24UniRef50_D8LBA3 Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBA3_ECTSI  ali  27  36..CAVVYVSEGRNSTLLDALAEAARTTAPGTLIRQFRDPQYHRTGFTIGGAPDAVARASVEVSRRAVRAIDLLEHEAAHPRIGVVDHVSVHPLGGESQEIAQKAGLAIATALGKDVGLPVLLYG---DLNNGRRLAEVRRSTPYFVGGEL--PATIDADLGPNEVDASRGIATVG.. 207
376 2.000e-24UniRef50_A0A1F9NLP0 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Desulfobacterales bacterium GWB2_56_26 TaxID=1797913 RepID=A0A1F9NLP0_9DELT :  ali  38  1....................................................................................MDVCPFVPVTGVTMAECVEISKKFAQRAAEELGVPFYLYEAAAVHDYRRHLPDLRQGEYEGLAERLKDPKWR-PDYGPTEFVPNWGITATGAR 92
377 2.000e-24UniRef50_H3BRX2 Formiminotransferase N-terminal subdomain-containing protein n=39 Tax=Boreoeutheria TaxID=1437010 RepID=H3BRX2_HUMAN  ali  32  10LAACLLNVSEAGRKYIVENIAKAAKKHPQVSVLNIFSDQDYKRSVITIATSVDKLGSSVLAACLEAFQAIDMEVQEGIHPCLGAVDLIPIYPLSGVTVE.............................................................................. 114
378 8.000e-24UniRef50_A4S2F9 Uncharacterized protein n=2 Tax=Ostreococcus TaxID=70447 RepID=A4S2F9_OSTLU  ali  28  12.FAAVVYVSEGRRTAVLDVIERVAREARPVALVNVFRDAEYNRTGFTLAGDVDDVRRAALDVAQVSLREVDMRAHDATHPRVGVVDHVSCHALAGE-RAGAAKLAKSIGEGLGT-LGVPVKLYGDAASDGIGLDEIRRRSGYFSGAAGGRWTGEGFAFDYGPSDVPEREGFGMVGA. 194
379 1.000e-23UniRef50_D3FCR8 Formimidoyltetrahydrofolate cyclodeaminase n=11 Tax=Bacteria TaxID=2 RepID=D3FCR8_CONWI  ali  40  13VLLAVPNVSEGRDDDAIDAIAAAFTGGDGVRLLDVHRDPDHNRSVVTLAGAPGALAPALAAGAREAIARIDLRANDGVHPHVGALDVAPVVHLTPDDRGA-ACAEALLAADLLARLGLPVLLYGALAQGRTRAQL---RRGGPAALAARLADGE-LATDFGPPRPHPTAGTTLVAAR 184
380 2.000e-23UniRef50_A0A067DLD7 Uncharacterized protein n=2 Tax=Citrus TaxID=2706 RepID=A0A067DLD7_CITSI  ali  30  6LTCCKVYISESQNKAALESIEQAARLFSAAIIVNKFEDVTYNRVGYTVVSDSCPLKSTVFAMIKAAFENIEPGMHSGSHPRLGVVDHICFHPLASAPLDQVAGIAKSVVGDIGS............................................................... 127
381 2.000e-23UniRef50_A0A251RKW3 Putative formiminotransferase subdomain-containing protein n=2 Tax=Helianthus annuus TaxID=4232 RepID=A0A251RKW3_HELAN  ali  25  6LSCCKVYISETRNKSALESIERAAKLFPDAPIVNKFEDHTYNRVGYTLVSKSSDSSAAVFSMVKAAYQSIDFDLHSGSHPRLGVVDHICFHPLASTSLDQVAITAKDLAKDFKTKFTISIIQFWW.................................................... 133
382 3.000e-23UniRef50_A0A2P6TQF4 Formimidoyltransferase-cyclodeaminase-like n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TQF4_CHLSO  ali  29  3.FACAVYVSEAREAATVERLERLARSASGACLANLFVDEPYNRTNFTLVGRSQPLTAAVVALAQEALQLLDLRQHTATHPRLGTVDHISCHPLTALPPAVAAGTAQQLGQRSGEQQACPVFTYGWAHPQQQRRQLGYFSAAASSWQGALSAAPLPLAPCHGPVAAPPRSGVCCVGA. 223
383 4.000e-23UniRef50_A0A1A8EDY4 Uncharacterized protein (Fragment) n=2 Tax=Euteleosteomorpha TaxID=1489388 RepID=A0A1A8EDY4_9TELE  ali  29  1........SEARRRHLVETVATAALSTEETTVLNIFNDFEYNRSVITIVATIDSIREAVLSASQKACELIDMHTHTGVHPCMGAVDLIPIYPLGEEGVEDCAREARAVAQGLTERVRGSSAFLFGWADSPSQRGL.......................................... 134
384 5.000e-23UniRef50_X1FXJ8 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1FXJ8_9ZZZZ  ali  37  1................................................................................RIGAVDTIEIYPAKDITIEECKEFAEDRGQELHKRYDVPIYFTGKNARRPENEGLTFIRKGNYEGLKEAVLVDPERAPDIGPAKLHPTAGATIVGA. 96
385 7.000e-23UniRef50_A0A254QGM0 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium Cent15-Ar3 TaxID=1987502 RepID=A0A254QGM0_9BACT  ali  32  3.ILAVPNWSFC-DPELCRNAVSEACN--NVTLHYAQGDIDHARTVTGFSGESVDVFEAMDRLCERLLPLINLGK-GGVHPFAGALDVCPFVQLDG-DLNELIELVRGWAREFSSRYSIPVHLYERAAQEGAEFRLPVLRGQLG----------PTSKPDFGIGS-NPKWGYSVIGVR 163
386 2.000e-22UniRef50_A0A0G4GYS2 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4GYS2_VITBC  ali  24  5.LACNVFISEAHSAAVLAQVQTHLTSHR-AALLFHFKDAIYNRSSFLLAAPSPELLGGVLQASRYLWKHLSLEGHQATHPRVGLIDHISVHPLGDSTLGDALAHAQAVGKALGEECGIPVFMYGA---PVYGTLVDARRRTRRYFSHDAADQDQPLCSDFGPSVWDPRTGVAVVGA. 191
387 5.000e-22UniRef50_K8F9L1 Uncharacterized protein n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8F9L1_9CHLO  ali  26  31.LACVVYVSEGRRMDVLKAIESVALNNNAVKLVKTFIDEPYNRTGFTFAVRTDDIANRVHEVATSAFMEISFKKHSATHPRLGIVDHVSVHPIGTCDMDAAKEAARAVGRRFGDELGVNAYMYGHATSNRERRELAEIRRKLGYFSAYDRMQKWEVKPDFGSSEKSEEKGVCCVGA. 300
388 8.000e-22UniRef50_A0A0D9WL60 Uncharacterized protein n=1 Tax=Leersia perrieri TaxID=77586 RepID=A0A0D9WL60_9ORYZ  ali  34  32LACCKLYISESRNAAALRAI-DHAGAGAGAVVVNRFTDDAYNRVGYTLVAXETPLRHAVFNMVKAALDSIDLAAHSGTHPRLGAVDHICFHPLANSSLPHVAHLAAAVAADIGDNLQVPTYLYG--AAHGEGRTLASIRRQLGYF................................ 189
389 4.000e-21UniRef50_A0A1Q6X646 Glutamate formimidoyltransferase (Fragment) n=3 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q6X646_9BACT  ali  46  1....................................................................................................CVTMARHVGEQIWKRYQIPVYLYESAATSPERQNLENIRRGQFEGIRAEIASNPSRKPDFGEARVHPTAGATVVGAR 77
390 4.000e-21UniRef50_A0A1V5WQ69 Methenyltetrahydrofolate cyclohydrolase n=1 Tax=Candidatus Cloacimonetes bacterium ADurb.Bin211 TaxID=1852838 RepID=A0A1V5WQ69_9B  ali  45  1...............................................................................................MTMEECVEYARRLGKRVGEELGIPVYLYEYAATKEEWRNLANIRAGEYEALPEKAKDP-AWKPDFGPHIFNARSGATAIGAR 81
391 1.000e-20UniRef50_A0A2V7Z9D6 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7Z9D6_9BACT  ali  60  1.........................................................................................IIPIGGATVEECVALSREVAAEIASRHGIPVYLYEDSATSEKRRNLAEIRKGEFEGFAAKMK-GADWKPDFGPEAPHPTAGVVAVGAR 87
392 1.000e-20UniRef50_M7YNC4 Formimidoyltransferase-cyclodeaminase n=8 Tax=Triticum TaxID=4564 RepID=M7YNC4_TRIUA  ali  31  269VICCKLYISESQNGAVVDSISRIGQKDPEVVLLSKFEDEYYNRVRYTLVSYISPIRKVLLAMIEAAFSAINLEVHSGTHPRIGVVDDMSFHPLSAATMEDAAQLAKLVASDIGNGLQE........................................................... 398
393 3.000e-20UniRef50_A0A1V5L2A7 Formiminotransferase domain protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1V5L2A7_9ACTN  ali  38  1......................................................................................MVPFVPLRGMEMTEAVDCAHRLGQIVA-EMGVPVYFYEEAALSPERRNLAEVRRGEYEGLRERLTESSGR-PDAGPATFNPRSGACIIGAR 89
394 3.000e-20UniRef50_A0A078H4Z0 BnaA07g00620D protein n=4 Tax=Brassicaceae TaxID=3700 RepID=A0A078H4Z0_BRANA  ali  28  60.................................................SSSSPLKNAVFAMVKTALHTINLELHSGSHPRLGVVDHICFHPLSQTSIDQVSAVATSLAMDIGSILRVPTYLYGAAQEDSIRRKLGYFKREGHEWAGGLELEVVPMKPDAGPLEVSKAKRVVAVGA. 194
395 4.000e-20UniRef50_A0A0B6XXC8 Uncharacterized protein (Fragment) n=3 Tax=Bilateria TaxID=33213 RepID=A0A0B6XXC8_9EUPU  ali  36  1.................................................................................................MEDCIKCAKEFGERLSIELGVPVFLYGAASNTDYRKTLPQVRAGEYEALSEKLKDP-KWKPDYGHPEFNPSWGATAVGAR 79
396 5.000e-20UniRef50_R0L800 Formimidoyltransferase-cyclodeaminase n=1 Tax=Anas platyrhynchos TaxID=8839 RepID=R0L800_ANAPL  ali  36  4MVECVPNFSEGCNKEVIEALGQAISRTPGCVLLDVDAGASTNRTVYTFVGTPEAVVEGALSAARVAGQLIDMSQHT..................................................................................................... 79
397 5.000e-20UniRef50_A0A1W9REV8 Uncharacterized protein (Fragment) n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1W9REV8_9BACT  ali  48  3LVECVPNFSEGRDMQKIEQIAGEVKSVEGVKLLDVDPGKDTNRTVVTFIGPPEAVLEAAFKAIAKAAEVIDMSKHKGA................................................................................................... 80
398 7.000e-20UniRef50_A0A2K3J988 Uncharacterized protein (Fragment) n=1 Tax=Thermoplasmata archaeon M8B2D TaxID=1933278 RepID=A0A2K3J988_9EURY  ali  38  4IVECVPNFSEGKDKSIINAISAAVESVEGVKLLDVDPGADFNRTVYTFVGEPEPILEAAFQAAKVGIS............................................................................................................. 71
399 2.000e-19UniRef50_A0A2N9EMM2 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9EMM2_FAGSY  ali  30  323LLCCKLFISESRNRAALDAIEQAARLNPETVIVNKFEDRAYNRVRYTLVSYVSPLQQTVLAMVEAAFGAINLELHSGAHPRLGVVDDIIFHPLARALLDEAAWLAKAVAADIANRFQ............................................................ 449
400 4.000e-19UniRef50_A0A150GE92 Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150GE92_GONPE  ali  36  10.IGCNIYISEGRNKQVIDRLQAEAEATPGVVLANLFTDHPYNRSGFTLVTHPDRLTAAVVRLSRAALALLDMRTHEARHPRLGVVDHISLHPLG................................................................................... 103
401 5.000e-19UniRef50_A0A2R8MTU5 Uncharacterized protein n=3 Tax=Simiiformes TaxID=314293 RepID=A0A2R8MTU5_CALJA  ali  31  10LPACLLNISEARRKYIVENTAKVAEKKHPLSVLNIFSDQDHNRSVITIAASVDKLGSSV--LCLEAFRAIDREFQEGIYPCLGAVDLIPVYLLSGVTVEE............................................................................. 112
402 7.000e-19UniRef50_A0A1F4X2T0 Glutamate formimidoyltransferase n=1 Tax=candidate division Zixibacteria bacterium RBG_16_40_9 TaxID=1802783 RepID=A0A1F4X2T0_9BA  ali  49  2..........................................................................................................ELAEQVGEKLQIPVYLYEEAATREDRRNLAIIRKGEYEGLKKEIGSNPDRQPDFGPAQMHPSAGAVVIGAR 72
403 1.000e-18UniRef50_T1CKQ6 Formiminotransferase-cyclodeaminase (Fragment) n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T1CKQ6_9ZZZZ  ali  42  1.................................................................................................MEEAIEWANRLGERVARELGVPVYLYGHAARRPERSDLARVREGQFEGLRESIGQDPSRAPDYGEPRLHPTAGAVAIGAR 80
404 1.000e-18UniRef50_T0CN15 Formiminotransferase, N-terminal subdomain protein n=1 Tax=Paeniclostridium sordellii ATCC 9714 TaxID=1292036 RepID=T0CN15_PAESO  ali  60  3IVQCVPNFSEGRDLEKIEKIVNPLRGKEGVKLLNYEADKDYNRVVVTVIGEPKAVKKAVLESIGVA............................................................................................................... 68
405 2.000e-18UniRef50_F0YBQ2 Uncharacterized protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YBQ2_AURAN  ali  27  1...................................FKDEAYERSSYCIGGAPEAVAESVVALTRDALARVDFRDFRGSHPTLGVMDHVAVNSLDAATIGVAADAARTIARRLGDEARLPTLFYG-AARPDGRTLAATRRLTPYFETTDPAAVVRIAAPDAGPATVDPAVGVATIGA. 141
406 4.000e-18UniRef50_A0A2G6MYU4 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium TaxID=2044940 RepID=A0A2G6MYU4_9DELT  ali  33  1MIECVPNFSEGRNQETIDTIADAIHRTTGCRLLDVDPGASTNRTVYTFVGDPCTVIEGALAAPGTGLGAMSAKLTYGVRKF................................................................................................ 81
407 4.000e-18UniRef50_UPI000CF83160 formimidoyltransferase-cyclodeaminase-like n=1 Tax=Oryzias melastigma TaxID=30732 RepID=UPI000CF83160  ali  32  1.................................................................................................MDDCVRCAHAFGEKLAEMLHVPVYLYGEAARTPARRALPSVRAGEYEALPDKLCRQEW-APDFGPPVFVPSWGATVTGAR 79
408 8.000e-18UniRef50_A0A2W6BSU1 Uncharacterized protein (Fragment) n=2 Tax=Solirubrobacterales TaxID=588673 RepID=A0A2W6BSU1_9ACTN  ali  39  1.........................................................ALATGAREALERIDLRLHHGIHPRVGVLDVAPIVYLRDRDRGAACAEALVLADLLGHEQGVPVFLYGELARGRTRQ---QVRRGGLHALATRMQAAET-APDFGPPELHPTGGAALVAAR 116
409 1.000e-17UniRef50_A0A257UJ93 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium 21-70-11 TaxID=1970485 RepID=A0A257UJ93_9BACT  ali  41  3LVECVPNISDGRHPEVYEAAAKAAAAVPGVTLLNVDPGAETNRTVITFVGEPEAVLEGAFRLTAKALELIDMS........................................................................................................ 75
410 6.000e-17UniRef50_A0A257UHK8 Formiminotransferase-cyclodeaminase (Fragment) n=1 Tax=Acidobacteria bacterium 21-70-11 TaxID=1970485 RepID=A0A257UHK8_9BACT  ali  50  1........................................................................................................ARRLGERVGGELGIPVYLYEFAASRPERRNLADIRAGEYEGLAEKLDDPAWR-PDFGPAAFVPRSGATVIGAR 72
411 2.000e-16UniRef50_A0A0P0WRU8 Os06g0128000 protein n=1 Tax=Oryza sativa subsp. japonica TaxID=39947 RepID=A0A0P0WRU8_ORYSJ  ali  33  14LACCKLYISESRNDAALRAIEQAARGGGGGAVVNRFTDDAYNRVGYTLVAPLTPSRHAVLGMVRAALEAIDFGAHAGTHPRLGAVDHICFHPLAHASLRHVADLAGAVAADIGDELQGWCC........................................................ 141
412 2.000e-16UniRef50_T1BL29 Protein containing Formiminotransferase n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T1BL29_9ZZZZ  ali  37  3LVECVPNFSEGQNDEVISQITNAMGSVKGIKILDIEKDPNHNRCVISFVGSEDVVVEAAFKGIKKSI.............................................................................................................. 69
413 2.000e-16UniRef50_A9V0F7 Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V0F7_MONBE  ali  26  14....KIYLSEGRSNVVLDQLVALAEACAGVRLVDTFRDKPYHRSSLTLLSDSSPLAEAAGVIGANACKLIDMESHVASHPRLGTIDHISCHDVTAVHSEQAIQLVHDVGASIAAQ-AVPVYLYGPAHPKQRRRALGYFDRTTPQGWCGIPPTLASLPPDVRASSDSQRHGVCTVG.. 204
414 3.000e-16UniRef50_B8C1N3 Uncharacterized protein n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8C1N3_THAPS  ali  17  3............................SVAMVHAYADIPYDRSSFHLAGRSDCVANVASSLIVNALREIDVDLDSSSHPFVGLVDHVSIMPLSSTTPSPAAEAAREIGNTLTTSNLVNVHYYGLACPNNTPLAKVRRESTGFFSSGGAIDYNNHNAKDGELTSASAKKGATTVG.. 157
415 4.000e-16UniRef50_UPI0008F54AB3 uncharacterized protein LOC101135371 n=1 Tax=Gorilla gorilla gorilla TaxID=9595 RepID=UPI0008F54AB3  ali  30  232LAACLLNVSEAGRKYIVENIAKAAKKHPQVSVLNIFSDQDYNRSVITIATSVDKLGSSVLAACLEAFQAIDMEVQEGIHPWPGS............................................................................................. 321
416 4.000e-16UniRef50_A0A2R5GCN0 Formimidoyltransferase-cyclodeaminase n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GCN0_9STRA  ali  23  30..............................TCVNVFSDEAYGRSSLTLAGELKTVMAAAHEIVALAVENLSLDDHHAKHPRIGVADHVLLSPVHPEDLDSLEDAARDLAQSLTESTPRL-----KTAAYSRSAPLAALRRATPYFTDAALSGPLDPSLDFGPERFDSSLGMTCVGA. 180
417 6.000e-16UniRef50_E1Z5R7 Uncharacterized protein (Fragment) n=1 Tax=Chlorella variabilis TaxID=554065 RepID=E1Z5R7_CHLVA  ali  28  1.....VYVSEARDGDILRQLESVARQAPGACLANLFTDEPYNRTNFTLVGSVPALAAAASTLARAALALLDLRQHAATHPRLGCVDHISCHPLRQQDEAGAAALAVAIASELGSGPQVPVYTYGWAH--QQRQPLDAVRRQLGYFQGSSWELQLPLAPCFGPAVVPARSGVCCVGA. 210
418 2.000e-15UniRef50_Q7P2A9 GLUTAMATE FORMIMINOTRANSFERASE n=1 Tax=Fusobacterium nucleatum subsp. vincentii ATCC 49256 TaxID=209882 RepID=Q7P2A9_FUSNV  ali  46  1.................................................................................MGTTKGGPFLTIPEMNNGRMVNFQKNKVRQLGKILIYLVFLYESTATAPNRVSLPDIRKGEYEGMAEKLKQPEW-APDFGERAPHPTAGVTAVGCR 96
419 3.000e-15UniRef50_A0A2V5XWX2 Uncharacterized protein (Fragment) n=2 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5XWX2_9BACT  ali  52  4LIECVPNFSEGRDQNIIRQITDAIRSAEGVSLLDVDPGASTNRTVVTFVG............................................................................................................................... 53
420 2.000e-14UniRef50_A0A1Y5ILI3 Uncharacterized protein n=2 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A1Y5ILI3_OSTTA  ali  28  882......................................EEYNRTGFTLAGAHDGIANTALDIAKKSLELIDFSTHDATHPRLGVVDHVSCHELRGERDAGAA-LARNIGRGLGDQ-GVPVKLYGDAASDKVGLAEIRRRAGYFEGRWMGDGGLRELAFEYGPSEMSSKIGFGCVGA. 1022
421 2.000e-14UniRef50_A0A1F8QKW4 Glutamate formimidoyltransferase (Fragment) n=1 Tax=Chloroflexi bacterium RBG_16_57_11 TaxID=1797651 RepID=A0A1F8QKW4_9CHLR  ali  45  1..........................................................................................................RLGQRVGQELGIPVYLYEAAATRPERTNLENIRHGQYEALKEEIGVKQERQPDFGPAVVGP-AGATVIGAR 70
422 2.000e-14UniRef50_A0A0K9P7W2 Formimidoyltetrahydrofolate cyclodeaminase, Glutamate formimidoyltransferase n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9P7W2_  ali  26  5LGCCKLYISETRNGAVLEEIEQAAKLYPKTAVVNKFEDTAYNRVGYTLVSDADSIRKIVFDMVRIALEQIDLRLHTGTHPRL............................................................................................... 90
423 2.000e-14UniRef50_A0A2V0PQN1 Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0PQN1_9CHLO  ali  34  10LLGCHVYTSEGRDARVIASLRDACAAQRGVVLASSFVDAPYHRSSYTLVGSAEALAAAVVNVSRAALAAIDLSAHDASHPRLGAVDHISCHPVPED................................................................................. 106
424 1.000e-13UniRef50_W7C7Z5 Glutamate formiminotransferase n=2 Tax=Firmicutes TaxID=1239 RepID=W7C7Z5_9LIST  ali  61  1.........................................................................................................................MYEESAATPERQNLAKVRKGQFEGMTDKLKEPEW-APDYGERKVHPTAGVTAVGAR 55
425 2.000e-13UniRef50_UPI000B44FAE9 uncharacterized protein LOC767707 isoform X2 n=5 Tax=Euteleostomi TaxID=117571 RepID=UPI000B44FAE9  ali  26  20LVACLLNISEARRKDLVETVARSAEKREGVTVLNIFNDSDYNRSVITVVANIELITLALTLAERVA---------------------------------------------------GTSAFLFGWADSPQHRGLAQRRKEIGWF--RKVLNVSNIKPDIG-SQPTRRYGITGVGA. 147
426 6.000e-13UniRef50_X1UGN5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1UGN5_9ZZZZ  ali  46  1.......................................................................................................................VYLYENAAKSPERKNLAKIRSGGYEGLEEKLKRPEW-KPDFGPSAYNKRSGATVIGAR 60
427 9.000e-13UniRef50_A0A2X3K9J5 Glutamate formiminotransferase n=1 Tax=Fusobacterium necrophorum subsp. necrophorum TaxID=143388 RepID=A0A2X3K9J5_9FUSO  ali  53  2......................................................................................................NCQKSGKSRLGK-IPSSNFLYENTASAPNRVSLPDIRKGEYEGMKEKMLLAEW-APDFGERAPHPTAGVTAVGCR 74
428 9.000e-13UniRef50_A0A2P6VBN0 Formimidoyltransferase-cyclodeaminase-like n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6VBN0_9CHLO  ali  25  119.LGCAVYVSEARDTALLRRLQAAAAAAPGTHLANVFIDEPYNRTNFTLVGDVHALAAAAVEVARAALTAVDLRRHAATHPRLGAVDHISCHPLPAAPAGSGSSAGRSIAQQLGAGPAVPVLTYGWAHPQQRRRQLGYFRGAAAAGGGMPEGLLLPLAPCYGPPGAPTRSGMCCVGA. 345
429 2.000e-12UniRef50_A0A1Z5K3F7 Uncharacterized protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5K3F7_FISSO  ali  17  3LVACNIYITAGRLPQHIQQAQTQCRDDPNVVVVHAFADRTYNRTSFHFAASAQSLVSVTSELAKTALQEFQNEQQRITHPQVGVVDHISVMSLADSAITDLTRTAHELGKRM-EDMGQIVHYYGHAHPNNH--PLAQVRREKTPFFDHEKDDSSNY-----LQSKETQSGMCLVGV. 199
430 3.000e-12UniRef50_A0A136LMN7 Putative glutamate formiminotransferase (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A136LMN7_9CHLR  ali  55  3LIECVPNFSEGRRTEVIDAIAAAITSAD-VYLLDYSADPDHNRCVFTF................................................................................................................................. 49
431 4.000e-12UniRef50_X0YXN9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0YXN9_9ZZZZ  ali  50  5....................................................................................................................GVPVYYYEDAATRPERKSLPKIRKGQYEALEEKLRDV-AWAPDEGPAEFNATAGATVTGSR 64
432 6.000e-12UniRef50_A0A2C9JWP0 Uncharacterized protein n=7 Tax=Eumetazoa TaxID=6072 RepID=A0A2C9JWP0_BIOGL  ali  37  1.....................................................................................................................MSVFLYGAASETEYRKTLPQIRAGEYEALPDKLKDPQW-KPDFGLPDFVPTWGATVVGAR 59
433 7.000e-12UniRef50_M7ANN0 Uncharacterized protein n=1 Tax=Chelonia mydas TaxID=8469 RepID=M7ANN0_CHEMY  ali  34  23..................................YFFDYDYHRSVIIIAATIDML---VIAACTEALQPTDMAIQEGIHPCLGAVDLVPIYPLLNVGLEECGKVAQNKIKLFVHFWGEKC......................................................... 105
434 9.000e-12UniRef50_A0A0M0JSV6 Uncharacterized protein n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0JSV6_9EUKA  ali  28  2LVSCAIYISSGVASIASRVAASALAAHPRVAVVDTFTDVAYARSSVKLVGETGPLVAAARAAAAEALSLIDLEPHPAPHPRQGAVDMVSFMPLSEASLAACDVAAWQLGGALG-ELGCPVLMYGPRAA----RSLLETRRGTSFFASVRAGSPREASTDFGGGGIVP.......... 176
435 1.000e-11UniRef50_A0A0S7IX35 FTCD (Fragment) n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A0S7IX35_9TELE  ali  41  1...........................................................................................................................GEAARSESRRNLPSVRSGEYEALPDKLKSAEW-APDFGPALFVPSWGATVTGAR 53
436 2.000e-11UniRef50_X1BBC9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1BBC9_9ZZZZ  ali  43  1.................................................................................................................................PERKNIDNIRLGEYEGLKESIETDPHRKPDYGPSKFHPTAGAIITGAR 48
437 3.000e-11UniRef50_E5RQL4 Formiminotransferase N-terminal subdomain-containing protein n=10 Tax=Boreoeutheria TaxID=1437010 RepID=FONG_HUMAN  ali  25  10LAACLLNVSEAGRKYIVENIAKAAKKHPQVSVLNIFSDQDYKRSVITIATSVDKLGLAE--------------------------DLVLHVP-------------------------GCSVFLFGEADLPEKRSLVQRRKQLGWFTR---RDFSALQPDLG-AAPSQRCGLTG.... 133
438 4.000e-11UniRef50_A0A024TS71 Uncharacterized protein n=2 Tax=Aphanomyces TaxID=100860 RepID=A0A024TS71_9STRA  ali  24  16...AIVYVSEGRCPSKVRELATLASTAPPALVAHSFADPTYNRTSFFFVGS--QVAASASAFVTSVLATLDFSRHRGTHPTLGTVDHVCFSPLGTATLDESAAEASSFASSLCNEPTLPIYAYG---PVLTGLRLRDIRKRLGYFSAKE............................ 166
439 4.000e-11UniRef50_UPI00073FD413 uncharacterized protein LOC102694103 isoform X2 n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=UPI00073FD413  ali  25  9LAACLLNISEARSKEVVERVARAAGRREGITVLNIFSDHDYNRSVITIVATIDQIAVAV---------------------------------------------------SLTERVPGTSVFHFGFADTPQQRSLVQRRKELGWF--RKNPDLRAMQSDVG-AMPGKRYGLTGVGA. 136
440 4.000e-11UniRef50_UPI000719B9CC formimidoyltransferase-cyclodeaminase-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719B9CC  ali  35  111.............REHILSISCYPRSYPPVFLYGYSSKQDYRKTMPQIRGEYEGLKD--KPARRKAYGLIDMSKHSGAHPRMGALDVCPFVPVKNATMDDCTQCAKEFGSKLADELDVPG......................................................... 218
441 5.000e-11UniRef50_A0A2I3GBU0 Formiminotransferase cyclodeaminase N-terminal like n=2 Tax=Nomascus leucogenys TaxID=61853 RepID=A0A2I3GBU0_NOMLE  ali  29  10LAACLLNISEARRKYIVENIAKAAKKHPQVSVVNIFSDQDYNRSVITIAGSVDKLVD........................................................................................................................ 72
442 6.000e-11UniRef50_A0A2I3M0R2 Formiminotransferase cyclodeaminase N-terminal like n=16 Tax=Euteleostomi TaxID=117571 RepID=A0A2I3M0R2_PAPAN  ali  29  10LAACLLNISEARRKYIVENIAKAAKKHPQVSVLNIFSDQDYNRSVITIAVSVDKLVD........................................................................................................................ 72
443 9.000e-11UniRef50_UPI000B7AFFB7 formiminotransferase N-terminal subdomain-containing protein-like isoform X2 n=1 Tax=Papio anubis TaxID=9555 RepID=UPI000B7AFF  ali  29  10LAACLLNISEARRKYIVENIAKAAKKHPQVSVLNIFSDQDYNRSVITIAVSVDKL.......................................................................................................................... 70
444 2.000e-10UniRef50_A0A2X3JVD4 Glutamate formiminotransferase n=1 Tax=Fusobacterium necrophorum subsp. necrophorum TaxID=143388 RepID=A0A2X3JVD4_9FUSO  ali  44  1...............................MLGVEPDGDYNRTVVTVMGEPEIVAEAVIRSIGIAAEVIDMNVHRGEHKRMGQPMSFPLSRLK................................................................................... 63
445 8.000e-10UniRef50_X1J2Y7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1J2Y7_9ZZZZ  ali  42  10.......................................................................................................................................DNIRLGEYEGLKESIETDPHRKPDYGPSKFHPTAGAIITGAR 51
446 1.000e-09UniRef50_A0A2E0FCL9 Uncharacterized protein (Fragment) n=1 Tax=Flammeovirgaceae bacterium TaxID=2026740 RepID=A0A2E0FCL9_9BACT  ali  43  4IIECVPNFSEGRNQDVINEISEAISNTKGVHLLNVDPGQAT........................................................................................................................................ 44
447 1.000e-09UniRef50_UPI000D71DE06 formiminotransferase N-terminal subdomain-containing protein n=1 Tax=Pelodiscus sinensis TaxID=13735 RepID=UPI000D71DE06  ali  25  37LAACLLNISEARKKDIVEKIAKSAQKHSQATVLNIFSDYDYNRSVITIAAPIDMLGVGASPYVMNCNVTID.......................................................................................................... 113
448 1.000e-09UniRef50_A0A2J7ZS48 Uncharacterized protein (Fragment) n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J7ZS48_9CHLO  ali  29  1.....................AAAESTPGVALANLFVDRPYNRTGFTLVSQAEQLAAAAVLLGRAALQLLDLRRHAASHPRLGIVDHISLHPLGP.................................................................................. 75
449 3.000e-09UniRef50_A0A2K6SS71 Formiminotransferase cyclodeaminase N-terminal like n=10 Tax=Theria TaxID=722675 RepID=A0A2K6SS71_SAIBB  ali  23  10LPACLLNTSEARRKYTVENTAKVALLDKNVSVLNIFSDQDYNRSVITIAASVDKLGSALLRVCCMFFGEADLPEKYS.................................................................................................... 89
450 6.000e-09UniRef50_L8IK44 Uncharacterized protein n=2 Tax=Boreoeutheria TaxID=1437010 RepID=L8IK44_9CETA  ali  26  54.......................................................GNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPPSGVGVEECGAVARRTGFKTQHHGLCTLIQYSRAVTPNGGSGLSRSEAGPSQETG.............................. 148
451 1.000e-08UniRef50_A0A2G8JBI5 Putative formimidoyltransferase-cyclodeaminase n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8JBI5_STIJA  ali  23  8..................................................................................GAVDLIPIHPLSAVSLEKCGNIANDIACQLVDKIDGFSCFLFGSAD-EEKKSLVDRRKEIGWFRGHSSVDYESGTSDLGSKC--KRFGITGIGA. 99
452 5.000e-08UniRef50_A0A2N9N0J6 Fragment of glutamate formimidoyltransferase + methenyltetrahydrofolate cyclohydrolase n=1 Tax=Candidatus Sulfopaludibacter sp. S  ali  52  5LVECVPNFSEGRDPAKIEAIVQAILGVPEVVLLDRESDAXARR...................................................................................................................................... 47
453 5.000e-08UniRef50_H3BMM2 Formiminotransferase N-terminal subdomain-containing protein n=9 Tax=Simiiformes TaxID=314293 RepID=H3BMM2_HUMAN  ali  26  10LAACLLNVSEAGRKYIVENIAKAAKKHPQVSVLNIFSDQDYKRSVITIATSVDKLVD........................................................................................................................ 72
454 8.000e-08UniRef50_UPI0008406D73 LOW QUALITY PROTEIN: uncharacterized protein LOC100392934 n=1 Tax=Callithrix jacchus TaxID=9483 RepID=UPI0008406D73  ali  23  185LPACLLNISEARRKYIVENTAKVAEKKHPLSVLNIFSDQDHNRSVITIAASVDKLGPAEDLVLHVXFGEVDLPEKHS.................................................................................................... 266
455 1.000e-07UniRef50_A0A2H0P3Q9 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6 TaxID=2014311 RepID=A0A2H0P3Q9_9BACT :  ali  62  1.........................................................................................................................................MRKGQFEGLKELIGKDETRTPDFGPNAIHPTAGAVAVGAR 40
456 2.000e-07UniRef50_K0S0T3 Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0S0T3_THAOC  ali  22  7....................................................QQVSEVTSRLICGALEEIDLNGEHGSHPFVGLVDHVSVMPMMDSSREAAARVAREIGAEMSQANLVNVHYYGAACPDN--TPLATVRRKNTAFFGAVQAKSDGTKPDSGSSRTSTTKGDSIVGV. 146
457 2.000e-07UniRef50_A0A2T4WBC8 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4WBC8_9BACT  ali  29  2......................................................................................................ERVRTFAKDISTKHDLAIYGYEYLASSSERKNLAAVRQGEYEGLEGRFASGDL--PDFGPQTFTPAVGATAMSVR 77
458 3.000e-07UniRef50_A0A0G0UEG5 Glutamate formiminotransferase n=1 Tax=Candidatus Woesebacteria bacterium GW2011_GWB1_41_10 TaxID=1618577 RepID=A0A0G0UEG5_9BACT  ali  44  13...............................................................................................................................PMPEYKNLADVRAGELESLRVTMK-----KPDYGPDKIHPTAGAVVIGAR 57
459 6.000e-07UniRef50_A0A257VID0 Uncharacterized protein (Fragment) n=1 Tax=Solibacteres bacterium 12-62-4 TaxID=1970571 RepID=A0A257VID0_9BACT  ali  51  1.....................................................................................................................VPVFLYDAAAQTESRRNLAHVRKAA--------AHPPFPVPDFGNAEPHPTAGAVAVGAR 52
460 2.000e-06UniRef50_A0A2P5E8W8 Formiminotransferase catalytic domain containing protein n=1 Tax=Trema orientalis TaxID=63057 RepID=A0A2P5E8W8_9ROSA  ali  22  1...................................................................................................................MNMPVYLYAAAALDTIRRELDYFRPMGNQWAGWTMPEVLPEKPDEGPTSVSRARGINLIGV. 68
461 3.000e-06UniRef50_A0A1E7FXL3 Uncharacterized protein n=1 Tax=Fragilariopsis cylindrus CCMP1102 TaxID=635003 RepID=A0A1E7FXL3_9STRA  ali  16  23...........................ERVVVVHAFSDGPYDRSSFHLAGTPDFVAIVGSSLATNAVEALMCFETSSEHPTVGLVDHVSILPLDEDDENTTGSVARKIGEALSMK-NVDVLYYGRAHPAGTPLATVRRESTRFFHSTDEKKYNSNENIDLEENNDVKSVGQTTVGA. 202
462 3.000e-06UniRef50_UPI00057A1C81 uncharacterized protein LOC105120364 n=1 Tax=Populus euphratica TaxID=75702 RepID=UPI00057A1C81  ali  27  1.......................................................................................................................VFLYAAAAPDTIRRELGYYRPMGSQWAGWNIPEILPENPDHGPTHVSRTRGITLIGAR 65
463 4.000e-06UniRef50_B7FZ02 Predicted protein n=1 Tax=Phaeodactylum tricornutum (strain CCAP 1055/1) TaxID=556484 RepID=B7FZ02_PHATC  ali  20  66.........................STRSAAVVHAYADPVYNRSSFHLAGTAPHVASLASKLAADAIQSIDVHTESVSHPNVGLVDHVAVMPITGRDETSKSGLAARMIGDRLSALNVQVFYYGTAHPQAI--PLAIVRKEQTSFFHSGGLSLDHGK--GGKRCSHPVVEVAMVGA. 234
464 4.000e-06UniRef50_A0A0F9FCH2 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0F9FCH2_9ZZZZ  ali  50  3IVECVPNFSEGRNRDIIKKISEAAVSVPGV................................................................................................................................................... 32
465 1.000e-05UniRef50_A0A2D7IM98 Formiminotransferase-cyclodeaminase (Fragment) n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D7IM98_9BACT :  ali  51  1.............................................................................................................................................EYEGLAKKISDP-KWKPDFGPSVVHPQAGATVIGCR 35
466 2.000e-05UniRef50_A0A2P2FEL6 Glutamate formiminotransferase n=1 Tax=Lawsonibacter asaccharolyticus TaxID=2108523 RepID=A0A2P2FEL6_9FIRM  ali  53  1...........................................................MEAIGTAVELIDMTRHEGQHPRIGCVDVIPSSRC-GMHIQEADQLAREIAQEAALLYGQPF......................................................... 60
467 2.000e-05UniRef50_A0A2V9YF50 Glutamate formiminotransferase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9YF50_9BACT  ali  52  4LVECVPNFSEGRDRARVDAIVDAMKM-DGVYLLDR.............................................................................................................................................. 37
468 2.000e-05UniRef50_A0A1F2XPC6 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_16_68_12 TaxID=1797203 RepID=A0A1F2XPC6_9ACTN  ali  36  1.................................................................................................METAKAAALAVADRVGRELGLPVFLYGE---VGGGRVPAFFRRGGVKELTRRVRAGE-LAPDFGPSELDARTGAVLVGAR 76
469 2.000e-05UniRef50_A0A067DXR0 Uncharacterized protein n=4 Tax=Mesangiospermae TaxID=1437183 RepID=A0A067DXR0_CITSI  ali  26  13.....................................................................................................................VPVFLYAAAHPTGKRRELGYYRSMGNQWAGWTMPEILPERPNEGPIQVSPARGIAMIGAR 79
470 4.000e-05UniRef50_A0A2D7TFX3 Formiminotransferase-cyclodeaminase (Fragment) n=1 Tax=Marinoscillum sp. TaxID=2024838 RepID=A0A2D7TFX3_9BACT  ali  39  1....................................................................................................................................RNLATIRSGEYEGLNKKINSNDW-KPDFG-SVFNKKSGATAIGVR 43
471 6.000e-05UniRef50_A0A2G2Z3R6 Uncharacterized protein n=1 Tax=Capsicum annuum TaxID=4072 RepID=A0A2G2Z3R6_CAPAN  ali  28  5................................................................................................................GKVAGVPTFLYGAAHQDSIRRELGYFRPNENQWIGGTELETLQLKPDEGPAQATRGKGIITIGA. 75
472 6.000e-05UniRef50_A0A1F4N9Q7 Uncharacterized protein n=1 Tax=Caldithrix sp. RBG_13_44_9 TaxID=1797576 RepID=A0A1F4N9Q7_9BACT  ali  41  3....................................................................................................................................................KKLKNPHWKPDFGPAKFNARSGATVIGAR 31
473 9.000e-05UniRef50_L0P0V9 Similar to formimidoyltransferase-cyclodeaminase-like n=1 Tax=Lupinus angustifolius TaxID=3871 RepID=L0P0V9_LUPAN  ali  30  215.....................................................................................................................VPTYLYG--AAHEEGRTLDSIRRTFGYFWIGSQEYSLPLKPDNGPAQLNPAKGVVVIGA. 279
474 1.000e-04UniRef50_A0A2P5E4W0 Formiminotransferase, N-terminal subdomain containing protein n=1 Tax=Parasponia andersonii TaxID=3476 RepID=A0A2P5E4W0_PARAD  ali  20  1...................................................................................................................MNMPVYLYAAAALDTIRWEVDDFRPMGNHWAGWTMPEDLPEKPDEGPTSVSRARGITMI... 66
475 2.000e-04UniRef50_T1A286 Glutamate formiminotransferase (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1A286_9ZZZZ  ali  35  2...........................................................................................................................ERQQISSGEKVLENIRNKGFQFEQISNEIFEHWKPDFGPQKVGP-AGASIIGAR 55
476 2.000e-04UniRef50_A3BNA9 Uncharacterized protein n=5 Tax=Oryza sativa TaxID=4530 RepID=A3BNA9_ORYSJ  ali  23  7LACCKLYISESRNAAALRAIEQAACG-GGAVVVNRFTDDAYNRVMCLLSASP............................................................................................................................. 57
477 2.000e-04UniRef50_X1A8B2 Uncharacterized protein (Fragment) n=2 Tax=root TaxID=1 RepID=X1A8B2_9ZZZZ  ali  44  1............................................................................................................................................GQYEALKEEIGTNPLRDPDFGPARVGP-AGATVIGAR 36
478 2.000e-04UniRef50_K1ZIS6 Uncharacterized protein (Fragment) n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1ZIS6_9ZZZZ  ali  54  4IVECVPNFSEGRNEETIEAIGSVI......................................................................................................................................................... 27
479 3.000e-04UniRef50_X1R681 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1R681_9ZZZZ  ali  44  11LIECVPNVSEGKRKDIIKTLKDEILSVKNIKLLD............................................................................................................................................... 44
480 6.000e-04UniRef50_M1BK97 Uncharacterized protein n=14 Tax=Mesangiospermae TaxID=1437183 RepID=M1BK97_SOLTU  ali  27  20...........................................................................................................TKSGLKRKTAVPTFLYG--AAQQEGRSLDSIRREENQWIGGTKLETLQLKPDEGPAHATQAKGVITIGA. 95
481 8.000e-04UniRef50_A0A2H0PC38 Glutamate formiminotransferase (Fragment) n=1 Tax=Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6 TaxID=2014311 RepID=  ali  38  1...............KVGKVVEAAKSA-GVTILDVETDADHHRCVLSFVGAPDACVEACFRVAKTAVELIDLN........................................................................................................ 57
482 9.000e-04UniRef50_A0A146NG11 Formiminotransferase N-terminal subdomain-containing protein n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146NG11_FUNHE  ali  33  47...........................................................................................................VAHGLTETVPGTSAFLFGWADSPLQRGLAQRRKEM--GWFRKTPDLQDLRPDVGPA-PQKRYGLTGVGA. 112
483 1.000e-03UniRef50_A0A1D2AIA9 Formimidoyltransferase cyclodeaminase like (Fragment) n=1 Tax=Ornithodoros brasiliensis TaxID=888526 RepID=A0A1D2AIA9_ORNBR  ali  50  1...........................................................................................................................................................WKPDYGPAEFVPNWGATMSGAR 22
484 0.002UniRef50_A0A2K3DN18 Uncharacterized protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3DN18_CHLRE  ali  26  221.................................................................................................................EVPALPVYFYGHAHPSRRRRKLGYFRRSPEGGWRGGLEDLSAFPPDLGPATASARWGVVTIGA. 296
485 0.004UniRef50_UPI0003D71079 formimidoyltransferase-cyclodeaminase isoform X2 n=3 Tax=Gnathostomata TaxID=35060 RepID=UPI0003D71079  ali  47  8..........................................................................................................................................................EWVPDFGPSSFVPSWGATVTGAR 30
486 0.004UniRef50_A0A212C1I5 Uncharacterized protein (Fragment) n=2 Tax=Boreoeutheria TaxID=1437010 RepID=A0A212C1I5_CEREH  ali  24  1...........................................................................................................LAENLVLSIPGCSVFLFGEADLPEKRPLVQRRKQLGWFTR---RDFSTLKPDLG-AAPARRCGLTGIGA. 65

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.